BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052M15

Length=914
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774328.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    404   4e-135   Nicotiana sylvestris
ref|XP_009773713.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    404   5e-135   Nicotiana sylvestris
ref|XP_009610999.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    402   1e-134   Nicotiana tomentosiformis
ref|XP_009619672.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    400   1e-133   Nicotiana tomentosiformis
ref|XP_011021140.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    400   2e-133   Populus euphratica
ref|XP_006363551.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    399   3e-133   Solanum tuberosum [potatoes]
ref|XP_004238989.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    399   5e-133   Solanum lycopersicum
gb|AFK45875.1|  unknown                                                 389   6e-133   Lotus japonicus
emb|CDP00510.1|  unnamed protein product                                398   8e-133   Coffea canephora [robusta coffee]
ref|XP_004237068.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    398   8e-133   Solanum lycopersicum
ref|XP_010257854.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    397   2e-132   Nelumbo nucifera [Indian lotus]
ref|XP_006297535.1|  hypothetical protein CARUB_v10013557mg             397   2e-132   Capsella rubella
ref|XP_006348606.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    397   3e-132   Solanum tuberosum [potatoes]
ref|XP_006484295.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    397   3e-132   Citrus sinensis [apfelsine]
gb|AHL19963.1|  6-phosphogluconate dehydrogenase                        397   3e-132   Hibiscus cannabinus [bimli-jute]
ref|XP_011085569.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    397   4e-132   Sesamum indicum [beniseed]
ref|XP_006373519.1|  phosphogluconate dehydrogenase family protein      396   5e-132   Populus trichocarpa [western balsam poplar]
ref|NP_186885.1|  6-phosphogluconate dehydrogenase, decarboxylati...    396   6e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477172.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    395   8e-132   Camelina sativa [gold-of-pleasure]
ref|XP_009117953.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    395   9e-132   Brassica rapa
gb|KDO70202.1|  hypothetical protein CISIN_1g0115012mg                  395   9e-132   Citrus sinensis [apfelsine]
ref|XP_006408422.1|  hypothetical protein EUTSA_v10020604mg             395   1e-131   
ref|XP_010485479.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    394   2e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010549952.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    394   4e-131   Tarenaya hassleriana [spider flower]
ref|XP_007032948.1|  6-phosphogluconate dehydrogenase family prot...    394   4e-131   Theobroma cacao [chocolate]
ref|XP_002882225.1|  6-phosphogluconate dehydrogenase family protein    394   5e-131   
ref|XP_007032949.1|  6-phosphogluconate dehydrogenase family prot...    393   6e-131   
ref|XP_009147357.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    393   6e-131   Brassica rapa
ref|XP_006437811.1|  hypothetical protein CICLE_v10031373mg             393   9e-131   Citrus clementina [clementine]
ref|XP_010091678.1|  6-phosphogluconate dehydrogenase                   393   9e-131   Morus notabilis
gb|AFK47475.1|  unknown                                                 387   1e-130   Lotus japonicus
gb|KJB10518.1|  hypothetical protein B456_001G205600                    392   1e-130   Gossypium raimondii
ref|XP_010463641.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    394   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_003531895.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    392   2e-130   Glycine max [soybeans]
gb|KJB22742.1|  hypothetical protein B456_004G063900                    392   2e-130   Gossypium raimondii
gb|KJB10517.1|  hypothetical protein B456_001G205600                    392   3e-130   Gossypium raimondii
ref|XP_010920025.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    391   4e-130   Elaeis guineensis
ref|XP_011011766.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    390   9e-130   Populus euphratica
ref|XP_011099073.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    390   1e-129   Sesamum indicum [beniseed]
ref|XP_010100892.1|  6-phosphogluconate dehydrogenase                   390   1e-129   Morus notabilis
gb|KDP24308.1|  hypothetical protein JCGZ_25604                         390   1e-129   Jatropha curcas
ref|XP_010681308.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    389   2e-129   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN67602.1|  hypothetical protein VITISV_032572                     387   3e-129   Vitis vinifera
ref|XP_002530803.1|  6-phosphogluconate dehydrogenase, putative         389   4e-129   Ricinus communis
ref|XP_010029445.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    388   7e-129   Eucalyptus grandis [rose gum]
ref|XP_002270984.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    388   1e-128   Vitis vinifera
ref|XP_007045684.1|  6-phosphogluconate dehydrogenase family prot...    387   1e-128   Theobroma cacao [chocolate]
ref|XP_002305978.2|  phosphogluconate dehydrogenase family protein      387   2e-128   
ref|XP_008788546.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    387   2e-128   Phoenix dactylifera
ref|XP_006601856.1|  PREDICTED: 6-phosphogluconate dehydrogenase ...    387   2e-128   
ref|XP_004491970.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    387   2e-128   
ref|XP_008803614.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    386   6e-128   Phoenix dactylifera
ref|XP_010261653.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    385   7e-128   
ref|XP_010261649.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    385   8e-128   Nelumbo nucifera [Indian lotus]
gb|KEH21786.1|  decarboxylating-like 6-phosphogluconate dehydroge...    385   8e-128   Medicago truncatula
sp|Q94KU1.1|6PGD1_SPIOL  RecName: Full=6-phosphogluconate dehydro...    385   8e-128   Spinacia oleracea
ref|NP_001236726.1|  6-phosphogluconate dehydrogenase                   386   1e-127   
ref|XP_010933404.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    385   1e-127   Elaeis guineensis
ref|XP_006603945.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    385   2e-127   
ref|XP_010261635.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    385   2e-127   Nelumbo nucifera [Indian lotus]
ref|XP_004304174.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    384   2e-127   Fragaria vesca subsp. vesca
ref|XP_008230333.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    384   3e-127   Prunus mume [ume]
ref|XP_007217218.1|  hypothetical protein PRUPE_ppa004860mg             384   3e-127   Prunus persica
ref|XP_009388425.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    384   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002305977.2|  hypothetical protein POPTR_0004s10870g             383   4e-127   
ref|XP_006482343.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    383   6e-127   Citrus sinensis [apfelsine]
gb|KDO38967.1|  hypothetical protein CISIN_1g011394mg                   383   7e-127   Citrus sinensis [apfelsine]
gb|EPS70190.1|  hypothetical protein M569_04567                         383   9e-127   Genlisea aurea
ref|XP_003555038.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    384   2e-126   Glycine max [soybeans]
ref|XP_008341826.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    382   2e-126   Malus domestica [apple tree]
ref|XP_009378306.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    382   3e-126   Pyrus x bretschneideri [bai li]
ref|XP_006430886.1|  hypothetical protein CICLE_v10011597mg             382   3e-126   Citrus clementina [clementine]
gb|AAB41553.1|  6-phosphogluconate dehydrogenase                        381   3e-126   Medicago sativa [alfalfa]
ref|XP_002311423.2|  phosphogluconate dehydrogenase family protein      373   5e-126   
ref|XP_009399427.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    379   2e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373738.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    379   2e-125   Pyrus x bretschneideri [bai li]
gb|EYU44260.1|  hypothetical protein MIMGU_mgv1a005435mg                379   3e-125   Erythranthe guttata [common monkey flower]
ref|XP_006857727.1|  hypothetical protein AMTR_s00061p00182310          379   4e-125   Amborella trichopoda
ref|XP_004141482.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    379   4e-125   Cucumis sativus [cucumbers]
ref|XP_008379478.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    378   7e-125   Malus domestica [apple tree]
gb|KDP31431.1|  hypothetical protein JCGZ_11807                         377   8e-125   Jatropha curcas
ref|XP_010558538.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    377   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_009399426.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    378   4e-124   
ref|XP_008459418.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    375   8e-124   Cucumis melo [Oriental melon]
ref|XP_001770880.1|  predicted protein                                  375   2e-123   
ref|XP_007151436.1|  hypothetical protein PHAVU_004G046100g             374   2e-123   Phaseolus vulgaris [French bean]
gb|ADP03318.1|  6-phosphogluconate dehydrogenase                        372   9e-123   Pinus pinaster [cluster pine]
ref|XP_001764215.1|  predicted protein                                  372   2e-122   
ref|XP_007139369.1|  hypothetical protein PHAVU_008G023700g             369   2e-121   Phaseolus vulgaris [French bean]
gb|ADP03059.1|  6-phosphogluconate dehydrogenase                        369   2e-121   Pinus sylvestris [Scotch pine]
gb|ADP03083.1|  6-phosphogluconate dehydrogenase                        369   2e-121   Pinus sylvestris [Scotch pine]
gb|ADP03057.1|  6-phosphogluconate dehydrogenase                        369   2e-121   Pinus sylvestris [Scotch pine]
gb|ADP03065.1|  6-phosphogluconate dehydrogenase                        369   2e-121   Pinus sylvestris [Scotch pine]
gb|ADP03058.1|  6-phosphogluconate dehydrogenase                        369   3e-121   Pinus sylvestris [Scotch pine]
gb|ADP03055.1|  6-phosphogluconate dehydrogenase                        369   3e-121   Pinus sylvestris [Scotch pine]
gb|ADP03070.1|  6-phosphogluconate dehydrogenase                        369   3e-121   Pinus sylvestris [Scotch pine]
tpg|DAA55929.1|  TPA: 6-phosphogluconate dehydrogenase2                 368   5e-121   
dbj|BAD67774.1|  putative phosphogluconate dehydrogenase                365   8e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971196.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    366   2e-120   Setaria italica
ref|NP_001056586.1|  Os06g0111500                                       366   3e-120   
ref|XP_004964329.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    365   6e-120   Setaria italica
gb|ACN35899.1|  unknown                                                 364   2e-119   Zea mays [maize]
ref|NP_001266302.1|  6-phosphogluconate dehydrogenase isoenzyme B...    363   2e-119   Zea mays [maize]
ref|XP_006655710.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    363   2e-119   Oryza brachyantha
ref|XP_003557150.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    363   2e-119   Brachypodium distachyon [annual false brome]
ref|NP_001104911.1|  6-phosphogluconate dehydrogenase2                  363   3e-119   
emb|CDM86736.1|  unnamed protein product                                363   4e-119   Triticum aestivum [Canadian hard winter wheat]
gb|AHM10416.1|  6-phosphogluconate dehydrogenase                        361   3e-118   Saccharum hybrid cultivar Yacheng05-179
ref|XP_002972874.1|  hypothetical protein SELMODRAFT_98399              358   3e-117   
ref|XP_002988062.1|  hypothetical protein SELMODRAFT_127384             358   4e-117   
gb|ADG38360.1|  AT3G02360-like protein                                  346   9e-117   Capsella grandiflora
gb|ADG38366.1|  AT3G02360-like protein                                  345   3e-116   Neslia paniculata [ball mustard]
ref|XP_001759464.1|  predicted protein                                  356   4e-116   
gb|AEN81731.1|  AT3G02360-like protein                                  344   5e-116   Capsella rubella
ref|XP_002966753.1|  hypothetical protein SELMODRAFT_168478             355   5e-116   Selaginella moellendorffii
gb|ADG38361.1|  AT3G02360-like protein                                  344   5e-116   Capsella grandiflora
ref|XP_001785214.1|  predicted protein                                  355   7e-116   
gb|AEN81732.1|  AT3G02360-like protein                                  344   7e-116   Capsella rubella
gb|EMT22120.1|  6-phosphogluconate dehydrogenase, decarboxylating       358   8e-116   
ref|XP_011080880.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    352   9e-115   Sesamum indicum [beniseed]
gb|KDO38968.1|  hypothetical protein CISIN_1g011394mg                   351   1e-114   Citrus sinensis [apfelsine]
gb|KHN16764.1|  6-phosphogluconate dehydrogenase, decarboxylating       342   2e-114   Glycine soja [wild soybean]
emb|CDP12110.1|  unnamed protein product                                349   1e-113   Coffea canephora [robusta coffee]
gb|EMT33408.1|  6-phosphogluconate dehydrogenase, decarboxylating       362   2e-113   
gb|KHM99927.1|  6-phosphogluconate dehydrogenase, decarboxylating       342   2e-113   Glycine soja [wild soybean]
ref|XP_004252580.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    348   3e-113   Solanum lycopersicum
gb|EYU40043.1|  hypothetical protein MIMGU_mgv1a019477mg                347   4e-113   Erythranthe guttata [common monkey flower]
ref|NP_001104910.1|  NADPH producing dehydrogenase of the oxidati...    348   4e-113   
gb|KDP25346.1|  hypothetical protein JCGZ_20502                         348   4e-113   Jatropha curcas
gb|KJB52237.1|  hypothetical protein B456_008G251800                    343   7e-113   Gossypium raimondii
gb|EMS57148.1|  6-phosphogluconate dehydrogenase, decarboxylating       347   1e-112   Triticum urartu
ref|XP_011073556.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    347   1e-112   Sesamum indicum [beniseed]
ref|XP_010545301.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    347   1e-112   Tarenaya hassleriana [spider flower]
ref|XP_009626290.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    347   1e-112   Nicotiana tomentosiformis
ref|XP_009789896.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    346   2e-112   Nicotiana sylvestris
ref|XP_007032950.1|  6-phosphogluconate dehydrogenase family prot...    345   2e-112   
ref|XP_009386035.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    345   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006856410.1|  hypothetical protein AMTR_s00047p00215210          343   2e-111   Amborella trichopoda
ref|XP_002517676.1|  6-phosphogluconate dehydrogenase, putative         343   2e-111   
gb|ACF20291.1|  6-phosphogluconate dehydrogenase                        337   2e-111   Cucumis sativus [cucumbers]
ref|XP_006476447.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    343   4e-111   Citrus sinensis [apfelsine]
ref|XP_006476449.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    343   4e-111   Citrus sinensis [apfelsine]
ref|XP_010436115.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    343   4e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006439417.1|  hypothetical protein CICLE_v10019859mg             343   4e-111   Citrus clementina [clementine]
ref|XP_006391659.1|  hypothetical protein EUTSA_v10023511mg             339   4e-111   
ref|XP_002886358.1|  6-phosphogluconate dehydrogenase family protein    342   5e-111   Arabidopsis lyrata subsp. lyrata
ref|XP_010473675.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   6e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007040418.1|  6-phosphogluconate dehydrogenase family prot...    342   6e-111   
ref|XP_010418473.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_003533072.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   7e-111   Glycine max [soybeans]
gb|KDO76416.1|  hypothetical protein CISIN_1g010652mg                   342   7e-111   Citrus sinensis [apfelsine]
gb|KDO76417.1|  hypothetical protein CISIN_1g010652mg                   342   9e-111   Citrus sinensis [apfelsine]
gb|KEH21177.1|  decarboxylating-like 6-phosphogluconate dehydroge...    342   1e-110   Medicago truncatula
gb|KDO76415.1|  hypothetical protein CISIN_1g010652mg                   342   1e-110   Citrus sinensis [apfelsine]
ref|XP_002275970.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   1e-110   Vitis vinifera
emb|CAN63456.1|  hypothetical protein VITISV_008240                     342   1e-110   Vitis vinifera
ref|XP_006391656.1|  hypothetical protein EUTSA_v10023427mg             342   1e-110   Eutrema salsugineum [saltwater cress]
ref|XP_008451978.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   1e-110   Cucumis melo [Oriental melon]
ref|XP_003525354.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   1e-110   Glycine max [soybeans]
ref|XP_006286028.1|  hypothetical protein CARUB_v10007559mg             341   1e-110   
ref|XP_007040417.1|  6-phosphogluconate dehydrogenase family prot...    342   2e-110   
ref|XP_008805334.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    341   2e-110   
ref|NP_198982.1|  6-phosphogluconate dehydrogenase, decarboxylati...    341   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36587.1|  hypothetical protein AALP_AA4G143200                    341   2e-110   Arabis alpina [alpine rockcress]
emb|CDY39725.1|  BnaA04g11280D                                          341   2e-110   Brassica napus [oilseed rape]
ref|XP_006301732.1|  hypothetical protein CARUB_v10022193mg             341   2e-110   Capsella rubella
ref|XP_011022562.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    341   3e-110   Populus euphratica
ref|XP_002304540.1|  6-phosphogluconate dehydrogenase family protein    340   3e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010441331.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    340   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006360699.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    340   4e-110   Solanum tuberosum [potatoes]
ref|NP_176601.1|  6-phosphogluconate dehydrogenase, decarboxylati...    340   4e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44457.1|  BnaCnng11100D                                          340   4e-110   Brassica napus [oilseed rape]
ref|XP_002868582.1|  6-phosphogluconate dehydrogenase family protein    340   4e-110   
sp|Q94KU2.1|6PGD2_SPIOL  RecName: Full=6-phosphogluconate dehydro...    342   5e-110   Spinacia oleracea
ref|XP_008811378.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    340   5e-110   Phoenix dactylifera
ref|XP_004503648.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    340   6e-110   Cicer arietinum [garbanzo]
ref|XP_002509902.1|  6-phosphogluconate dehydrogenase, putative         340   8e-110   Ricinus communis
gb|AFF18855.1|  6-phosphogluconate dehydrogenase                        329   8e-110   Dimocarpus longan [longan]
ref|XP_004168459.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    340   8e-110   
ref|XP_009140108.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    339   9e-110   Brassica rapa
ref|XP_010273961.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    340   1e-109   Nelumbo nucifera [Indian lotus]
ref|XP_004149760.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    339   1e-109   
ref|XP_006849590.1|  hypothetical protein AMTR_s00024p00196750          339   1e-109   
ref|XP_010676957.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    342   1e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010905189.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    338   2e-109   Elaeis guineensis
ref|XP_010261979.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    338   2e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010430539.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    338   3e-109   Camelina sativa [gold-of-pleasure]
gb|ACM68927.1|  6-phosphogluconate dehydrogenase                        338   4e-109   Cucumis sativus [cucumbers]
ref|XP_002297992.1|  6-phosphogluconate dehydrogenase family protein    337   8e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010447780.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    337   9e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011026944.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    337   1e-108   Populus euphratica
ref|XP_009112895.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    336   1e-108   Brassica rapa
ref|XP_010105006.1|  6-phosphogluconate dehydrogenase                   337   1e-108   Morus notabilis
ref|XP_009392493.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    337   1e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917535.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    336   3e-108   Elaeis guineensis
ref|XP_007209994.1|  hypothetical protein PRUPE_ppa005270mg             335   3e-108   
emb|CDY25568.1|  BnaC09g11930D                                          335   3e-108   Brassica napus [oilseed rape]
ref|XP_011462415.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    332   1e-106   Fragaria vesca subsp. vesca
gb|AAM61057.1|  6-phosphogluconate dehydrogenase                        331   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAP33506.2|  cytosolic 6-phosphogluconate dehydrogenase              330   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663451.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    327   7e-106   
gb|EMS56831.1|  6-phosphogluconate dehydrogenase, decarboxylating       325   9e-106   Triticum urartu
gb|EAY80943.1|  hypothetical protein OsI_36123                          325   1e-105   Oryza sativa Indica Group [Indian rice]
gb|EEE52109.1|  hypothetical protein OsJ_33909                          328   1e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160132.1|  hypothetical protein PHAVU_002G295300g             328   3e-105   Phaseolus vulgaris [French bean]
ref|NP_001067912.1|  Os11g0484500                                       328   3e-105   
gb|EMT00678.1|  6-phosphogluconate dehydrogenase, decarboxylating       324   1e-104   
gb|AFW60760.1|  putative 6-phosphogluconate dehydrogenase               326   2e-104   
ref|XP_002449496.1|  hypothetical protein SORBIDRAFT_05g016740          325   4e-104   Sorghum bicolor [broomcorn]
ref|XP_004979278.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    325   4e-104   Setaria italica
ref|XP_003557402.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    325   4e-104   Brachypodium distachyon [annual false brome]
dbj|BAK00156.1|  predicted protein                                      323   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS67575.1|  hypothetical protein M569_07199                         320   3e-102   Genlisea aurea
ref|XP_007513389.1|  6-phosphogluconate dehydrogenase                   319   2e-101   Bathycoccus prasinos
ref|XP_002502811.1|  predicted protein                                  318   3e-101   Micromonas commoda
ref|NP_001241786.1|  6-phosphogluconate dehydrogenase, decarboxyl...    318   3e-101   
ref|XP_008238987.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    317   5e-101   Prunus mume [ume]
gb|AIU64845.1|  6-phosphogluconate dehydrogenase                        316   1e-100   Prunus sibirica [Siberian apricot]
ref|XP_009334464.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    314   5e-100   Pyrus x bretschneideri [bai li]
ref|XP_001418779.1|  predicted protein                                  315   5e-100   Ostreococcus lucimarinus CCE9901
ref|XP_009336262.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    313   1e-99    Pyrus x bretschneideri [bai li]
gb|EMS64512.1|  6-phosphogluconate dehydrogenase, decarboxylating       315   8e-98    Triticum urartu
ref|XP_003060927.1|  predicted protein                                  308   1e-97    Micromonas pusilla CCMP1545
emb|CEF98862.1|  6-phosphogluconate dehydrogenase,decarboxylating       309   1e-97    Ostreococcus tauri
ref|XP_010533610.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    306   5e-97    
ref|XP_003080519.1|  6-phosphogluconate dehydrogenase (ISS)             310   5e-96    
gb|ABY87054.1|  phosphogluconate dehydrogenase                          283   2e-92    Glycyrrhiza lepidota [American licorice]
gb|ABY87053.1|  phosphogluconate dehydrogenase                          282   6e-92    Lessertia frutescens
gb|ABY87039.1|  phosphogluconate dehydrogenase                          281   6e-92    Robinia neomexicana
gb|ABY87059.1|  phosphogluconate dehydrogenase                          281   2e-91    Caragana arborescens [Siberian peashrub]
gb|ABY87047.1|  phosphogluconate dehydrogenase                          281   2e-91    Astragalus canadensis
gb|ABY87060.1|  phosphogluconate dehydrogenase                          280   4e-91    Alhagi maurorum [camel thorn]
ref|XP_002953515.1|  hypothetical protein VOLCADRAFT_109207             293   6e-91    Volvox carteri f. nagariensis
gb|ABY87050.1|  phosphogluconate dehydrogenase                          279   6e-91    Vicia faba [broad bean]
ref|XP_001696881.1|  6-phosphogluconate dehydrogenase, decarboxyl...    290   9e-91    Chlamydomonas reinhardtii
gb|ABY87061.1|  phosphogluconate dehydrogenase                          278   1e-90    Sesbania herbacea
ref|XP_001696880.1|  6-phosphogluconate dehydrogenase, decarboxyl...    292   1e-90    Chlamydomonas reinhardtii
gb|ABY87044.1|  phosphogluconate dehydrogenase                          278   1e-90    Sesbania vesicaria [bagpod]
gb|AEJ36088.1|  phosphogluconate dehydrogenase                          277   3e-90    Astragalus alpinus
gb|AEJ36087.1|  phosphogluconate dehydrogenase                          276   6e-90    Astragalus nothoxys
gb|ABY87063.1|  phosphogluconate dehydrogenase                          276   6e-90    Cicer pinnatifidum
gb|AEJ36089.1|  phosphogluconate dehydrogenase                          276   6e-90    Astragalus americanus
gb|ABY87057.1|  phosphogluconate dehydrogenase                          276   6e-90    Olneya tesota [desert ironwood]
gb|AEJ36078.1|  phosphogluconate dehydrogenase                          276   6e-90    Sesbania tomentosa [Oahu riverhemp]
gb|AEJ36097.1|  phosphogluconate dehydrogenase                          276   7e-90    Trigonella foenum-graecum [fenugreek]
gb|ABY87058.1|  phosphogluconate dehydrogenase                          276   7e-90    Galega orientalis
ref|XP_006441889.1|  hypothetical protein CICLE_v10023851mg             286   7e-90    
gb|AEJ36072.1|  phosphogluconate dehydrogenase                          276   8e-90    Sesbania punicea
gb|AEJ36094.1|  phosphogluconate dehydrogenase                          276   1e-89    Medicago lanigera
gb|ABY87048.1|  phosphogluconate dehydrogenase                          276   1e-89    Pisum sativum [garden pea]
gb|AEJ36074.1|  phosphogluconate dehydrogenase                          276   1e-89    Sesbania cinerascens
gb|AEJ36090.1|  phosphogluconate dehydrogenase                          275   2e-89    Oxytropis parryi
gb|ABY87040.1|  phosphogluconate dehydrogenase                          275   2e-89    Medicago truncatula
ref|XP_005651440.1|  decarboxylating 6-phosphogluconate dehydroge...    289   2e-89    Coccomyxa subellipsoidea C-169
gb|AEJ36099.1|  phosphogluconate dehydrogenase                          275   2e-89    Trifolium repens [creeping white clover]
gb|AEJ36086.1|  phosphogluconate dehydrogenase                          275   2e-89    Wisteria floribunda [Japanese wistaria]
gb|AEJ36092.1|  phosphogluconate dehydrogenase                          275   3e-89    Oxytropis pilosa
gb|AEJ36084.1|  phosphogluconate dehydrogenase                          275   3e-89    Peteria thompsoniae
gb|ABY87051.1|  phosphogluconate dehydrogenase                          275   3e-89    Medicago sativa [alfalfa]
gb|ABY87056.1|  phosphogluconate dehydrogenase                          274   6e-89    Oxytropis lambertii
gb|AEJ36073.1|  phosphogluconate dehydrogenase                          274   8e-89    Sesbania sesban [Egyptian sesban]
gb|AEJ36076.1|  phosphogluconate dehydrogenase                          273   9e-89    Sesbania formosa
gb|AEJ36085.1|  phosphogluconate dehydrogenase                          273   1e-88    Coursetia glandulosa
ref|XP_004343090.1|  6-phosphogluconate dehydrogenase                   283   3e-88    Capsaspora owczarzaki ATCC 30864
gb|AEJ36095.1|  phosphogluconate dehydrogenase                          270   2e-87    Medicago monantha
gb|AEJ36093.1|  phosphogluconate dehydrogenase                          270   2e-87    Lathyrus sativus [chickling vetch]
ref|XP_011400114.1|  6-phosphogluconate dehydrogenase, decarboxyl...    281   3e-87    Auxenochlorella protothecoides
dbj|BAC67018.1|  cytosolic 6-phosphogluconate dehydrogenase             269   1e-86    Selaginella remotifolia
ref|XP_002681464.1|  6-phosphogluconate dehydrogenase                   278   4e-86    Naegleria gruberi strain NEG-M
ref|XP_008872677.1|  6-phosphogluconate dehydrogenase (decarboxyl...    278   5e-86    Aphanomyces invadans
gb|KDO26201.1|  6-phosphogluconate dehydrogenase                        277   1e-85    Saprolegnia parasitica CBS 223.65
ref|XP_009832556.1|  6-phosphogluconate dehydrogenase (decarboxyl...    276   2e-85    Aphanomyces astaci
ref|XP_008610309.1|  6-phosphogluconate dehydrogenase (decarboxyl...    276   3e-85    Saprolegnia diclina VS20
gb|KDD75074.1|  6-phosphogluconate dehydrogenase                        276   7e-85    Helicosporidium sp. ATCC 50920
ref|XP_008905173.1|  6-phosphogluconate dehydrogenase (decarboxyl...    274   2e-84    Phytophthora parasitica INRA-310
gb|ETL93890.1|  6-phosphogluconate dehydrogenase (decarboxylating)      275   2e-84    Phytophthora parasitica
emb|CCI10945.1|  unnamed protein product                                274   2e-84    Albugo candida
ref|XP_002902568.1|  6-phosphogluconate dehydrogenase                   273   4e-84    Phytophthora infestans T30-4
emb|CBJ29697.1|  6-phosphogluconate dehydrogenase                       273   5e-84    Ectocarpus siliculosus
ref|XP_009524396.1|  hypothetical protein PHYSODRAFT_557596             272   1e-83    
emb|CCA16382.1|  6phosphogluconate dehydrogenase putative               272   2e-83    
emb|CAQ52407.1|  6-phosphogluconate dehydrogenase                       270   1e-82    
emb|CAB61332.1|  6-phosphogluconate dehydrogenase                       270   3e-82    
gb|AFF18790.1|  6-phosphogluconate dehydrogenase                        256   5e-82    
gb|ABY87052.1|  phosphogluconate dehydrogenase                          255   8e-82    
gb|KCW56358.1|  hypothetical protein EUGRSUZ_I02092                     266   2e-81    
dbj|BAG32444.1|  6-phosphogluconate dehydrogenase                       264   4e-81    
gb|ABK92740.1|  unknown                                                 253   1e-80    
gb|ABY87055.1|  phosphogluconate dehydrogenase                          252   2e-80    
gb|ABK21124.1|  unknown                                                 252   2e-80    
dbj|BAG32445.1|  6-phosphogluconate dehydrogenase                       261   4e-80    
gb|AAL76324.1|AF394514_1  6-phosphogluconate dehydrogenase              258   4e-80    
dbj|BAG32446.1|  6-phosphogluconate dehydrogenase                       261   6e-80    
gb|ACF84407.1|  unknown                                                 248   1e-78    
gb|ABY87038.1|  phosphogluconate dehydrogenase                          244   1e-77    
ref|WP_015163879.1|  6-phosphogluconate dehydrogenase                   255   2e-77    
ref|WP_006276220.1|  6-phosphogluconate dehydrogenase                   254   7e-77    
dbj|BAG32442.1|  6-phosphogluconate dehydrogenase                       253   2e-76    
ref|WP_015161893.1|  6-phosphogluconate dehydrogenase, decarboxyl...    250   1e-75    
ref|WP_012412521.1|  6-phosphogluconate dehydrogenase                   250   2e-75    
ref|WP_009342009.1|  6-phosphogluconate dehydrogenase                   249   6e-75    
gb|KIJ81127.1|  6-phosphogluconate dehydrogenase                        249   6e-75    
ref|WP_017713841.1|  6-phosphogluconate dehydrogenase                   248   2e-74    
ref|WP_041034937.1|  6-phosphogluconate dehydrogenase                   248   2e-74    
dbj|GAN31818.1|  6-phosphogluconate dehydrogenase                       248   2e-74    
ref|WP_011377413.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     248   2e-74    
ref|WP_025747349.1|  6-phosphogluconate dehydrogenase                   247   2e-74    
ref|WP_035150629.1|  6-phosphogluconate dehydrogenase                   247   2e-74    
gb|AAL76319.1|AF394509_1  6-phosphogluconate dehydrogenase              246   3e-74    
ref|WP_009626993.1|  6-phosphogluconate dehydrogenase (decarboxyl...    247   3e-74    
ref|WP_015113327.1|  6-phosphogluconate dehydrogenase                   247   3e-74    
gb|EEC79860.1|  hypothetical protein OsI_21345                          247   3e-74    
ref|WP_016876892.1|  6-phosphogluconate dehydrogenase                   246   6e-74    
ref|WP_019494671.1|  6-phosphogluconate dehydrogenase                   246   7e-74    
ref|WP_017323165.1|  6-phosphogluconate dehydrogenase                   245   1e-73    
ref|WP_015079789.1|  phosphogluconate dehydrogenase (decarboxylat...    245   2e-73    
ref|WP_027404549.1|  6-phosphogluconate dehydrogenase                   245   2e-73    
emb|CDQ31490.1|  6-phosphogluconate dehydrogenase, NADP(+)-depend...    244   2e-73    
ref|WP_016871155.1|  6-phosphogluconate dehydrogenase                   245   2e-73    
ref|WP_009458224.1|  6-phosphogluconate dehydrogenase                   245   2e-73    
ref|WP_016864745.1|  6-phosphogluconate dehydrogenase                   244   2e-73    
ref|WP_029632576.1|  6-phosphogluconate dehydrogenase [                 244   3e-73    
ref|WP_017654467.1|  6-phosphogluconate dehydrogenase                   244   3e-73    
ref|WP_011243770.1|  6-phosphogluconate dehydrogenase                   244   4e-73    
ref|WP_015213766.1|  6-phosphogluconate dehydrogenase (decarboxyl...    244   5e-73    
ref|WP_016859338.1|  6-phosphogluconate dehydrogenase                   244   5e-73    
ref|WP_019502503.1|  hypothetical protein                               244   5e-73    
ref|WP_015130850.1|  6-phosphogluconate dehydrogenase                   244   6e-73    
gb|KIE06984.1|  6-phosphogluconate dehydrogenase                        244   6e-73    
ref|WP_026486789.1|  6-phosphogluconate dehydrogenase                   243   6e-73    
ref|WP_019378044.1|  6-phosphogluconate dehydrogenase                   243   6e-73    
ref|WP_017739751.1|  6-phosphogluconate dehydrogenase                   244   6e-73    
gb|EWM28595.1|  6-phosphogluconate dehydrogenase                        244   7e-73    
ref|WP_040956504.1|  6-phosphogluconate dehydrogenase                   243   7e-73    
gb|AFG48494.1|  hypothetical protein 2_1160_01                          232   8e-73    
ref|XP_005709854.1|  6-phosphogluconate dehydrogenase, decarboxyl...    242   8e-73    
ref|WP_023066473.1|  6-phosphogluconate dehydrogenase                   243   8e-73    
ref|WP_026722377.1|  6-phosphogluconate dehydrogenase                   243   9e-73    
ref|WP_017317334.1|  6-phosphogluconate dehydrogenase                   243   9e-73    
ref|WP_017311909.1|  6-phosphogluconate dehydrogenase                   243   9e-73    
ref|WP_013190584.1|  6-phosphogluconate dehydrogenase                   243   1e-72    
ref|WP_028091552.1|  6-phosphogluconate dehydrogenase                   243   2e-72    
ref|WP_016952493.1|  6-phosphogluconate dehydrogenase                   243   2e-72    
ref|WP_044477081.1|  6-phosphogluconate dehydrogenase                   242   2e-72    
ref|WP_009786972.1|  6-phosphogluconate dehydrogenase                   242   3e-72    
ref|WP_015199315.1|  6-phosphogluconate dehydrogenase                   242   3e-72    
ref|WP_017473766.1|  6-phosphogluconate dehydrogenase                   242   3e-72    
ref|XP_002179526.1|  6-phosphogluconate dehydrogenase                   242   3e-72    
ref|WP_034287428.1|  6-phosphogluconate dehydrogenase                   241   3e-72    
ref|WP_018394822.1|  6-phosphogluconate dehydrogenase                   241   3e-72    
ref|WP_015206507.1|  6-phosphogluconate dehydrogenase (decarboxyl...    242   4e-72    
ref|WP_039737718.1|  6-phosphogluconate dehydrogenase                   241   4e-72    
ref|WP_028085123.1|  6-phosphogluconate dehydrogenase                   241   4e-72    
gb|AFG48495.1|  hypothetical protein 2_1160_01                          230   5e-72    
ref|XP_002179525.1|  6-phosphogluconate dehydrogenase                   243   5e-72    
ref|WP_017367561.1|  6-phosphogluconate dehydrogenase                   241   5e-72    
ref|WP_006197555.1|  6-phosphogluconate dehydrogenase                   241   6e-72    
ref|WP_008342251.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     241   6e-72    
gb|AEJ36082.1|  phosphogluconate dehydrogenase                          229   6e-72    
ref|WP_009768718.1|  6-phosphogluconate dehydrogenase (decarboxyl...    241   6e-72    
ref|WP_015009328.1|  6-phosphogluconate dehydrogenase                   241   6e-72    
ref|WP_025207592.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     241   6e-72    
ref|WP_015140467.1|  6-phosphogluconate dehydrogenase                   241   7e-72    
ref|WP_034319791.1|  6-phosphogluconate dehydrogenase                   241   8e-72    
emb|CEG33582.1|  6-phosphogluconate dehydrogenase                       240   1e-71    
ref|WP_034308220.1|  6-phosphogluconate dehydrogenase                   240   1e-71    
ref|WP_037220009.1|  6-phosphogluconate dehydrogenase                   240   1e-71    
ref|WP_015203163.1|  6-phosphogluconate dehydrogenase                   241   2e-71    
ref|WP_006519482.1|  6-phosphogluconate dehydrogenase, decarboxyl...    239   2e-71    
ref|WP_011319298.1|  6-phosphogluconate dehydrogenase                   239   2e-71    
ref|WP_008358805.1|  6-phosphogluconate dehydrogenase                   239   2e-71    
ref|WP_017728576.1|  6-phosphogluconate dehydrogenase                   239   2e-71    
ref|WP_006529013.1|  6-phosphogluconate dehydrogenase, decarboxyl...    239   3e-71    
ref|WP_036578406.1|  6-phosphogluconate dehydrogenase                   239   3e-71    
ref|WP_026736692.1|  6-phosphogluconate dehydrogenase                   239   4e-71    
ref|WP_013490241.1|  6-phosphogluconate dehydrogenase                   239   4e-71    
ref|WP_008318187.1|  6-phosphogluconate dehydrogenase, decarboxyl...    239   5e-71    
ref|WP_031335187.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     238   6e-71    
ref|WP_010999399.1|  6-phosphogluconate dehydrogenase                   238   6e-71    
ref|WP_015172901.1|  6-phosphogluconate dehydrogenase                   238   6e-71    
ref|WP_019504344.1|  6-phosphogluconate dehydrogenase                   238   7e-71    
ref|WP_035992882.1|  6-phosphogluconate dehydrogenase                   238   8e-71    
ref|WP_027416002.1|  6-phosphogluconate dehydrogenase                   238   8e-71    
ref|WP_017716214.1|  6-phosphogluconate dehydrogenase                   239   8e-71    
ref|XP_002289820.1|  6-phosphogluconate dehydrogenase                   238   9e-71    
ref|WP_041122773.1|  6-phosphogluconate dehydrogenase                   238   1e-70    
ref|WP_042346144.1|  6-phosphogluconate dehydrogenase                   238   1e-70    
ref|WP_021656649.1|  phosphogluconate dehydrogenase                     238   1e-70    
emb|CDQ38350.1|  6-phosphogluconate dehydrogenase, NADP(+)-depend...    238   1e-70    
gb|EHL73831.1|  6-phosphogluconate dehydrogenase, decarboxylating 2     238   1e-70    
ref|WP_040341911.1|  6-phosphogluconate dehydrogenase                   238   1e-70    
ref|WP_026073246.1|  6-phosphogluconate dehydrogenase                   238   1e-70    
gb|EQB38146.1|  6-phosphogluconate dehydrogenase                        238   1e-70    
ref|WP_044641166.1|  6-phosphogluconate dehydrogenase                   237   2e-70    
ref|WP_015168707.1|  6-phosphogluconate dehydrogenase                   237   2e-70    
ref|WP_007501118.1|  6-phosphogluconate dehydrogenase                   237   2e-70    
ref|WP_017357947.1|  6-phosphogluconate dehydrogenase                   237   2e-70    
ref|WP_028403012.1|  6-phosphogluconate dehydrogenase                   237   2e-70    
ref|WP_026582924.1|  6-phosphogluconate dehydrogenase                   237   3e-70    
ref|WP_035390773.1|  6-phosphogluconate dehydrogenase                   236   3e-70    
ref|WP_040948521.1|  6-phosphogluconate dehydrogenase                   236   3e-70    
ref|WP_035404291.1|  6-phosphogluconate dehydrogenase                   236   3e-70    
ref|WP_006836649.1|  6-phosphogluconate dehydrogenase                   236   4e-70    
ref|WP_015255095.1|  6-phosphogluconate dehydrogenase                   236   4e-70    
ref|WP_028596938.1|  6-phosphogluconate dehydrogenase                   236   4e-70    
ref|WP_016429461.1|  6-phosphogluconate dehydrogenase, decarboxyl...    236   5e-70    
ref|WP_026576078.1|  6-phosphogluconate dehydrogenase                   236   5e-70    
ref|WP_015150970.1|  6-phosphogluconate dehydrogenase                   236   5e-70    
ref|WP_029098773.1|  6-phosphogluconate dehydrogenase                   236   5e-70    
ref|WP_044340081.1|  6-phosphogluconate dehydrogenase                   236   5e-70    
ref|WP_042530979.1|  6-phosphogluconate dehydrogenase                   236   6e-70    
ref|WP_011611465.1|  6-phosphogluconate dehydrogenase                   236   7e-70    
ref|WP_006619367.1|  6-phosphogluconate dehydrogenase                   236   7e-70    
ref|WP_026587774.1|  6-phosphogluconate dehydrogenase                   235   8e-70    
ref|WP_006626188.1|  6-phosphogluconate dehydrogenase                   236   8e-70    
ref|WP_041059071.1|  6-phosphogluconate dehydrogenase                   235   8e-70    
ref|WP_007431050.1|  6-phosphogluconate dehydrogenase                   235   9e-70    
gb|AEW08148.1|  hypothetical protein 2_1160_01                          224   9e-70    
ref|WP_028395902.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
gb|EJK62811.1|  hypothetical protein THAOC_16563                        236   1e-69    
ref|WP_034770879.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_036533247.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_011141117.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_010470771.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_042221468.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_041090191.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_007505343.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_003215871.1|  6-phosphogluconate dehydrogenase                   235   1e-69    
ref|WP_034407522.1|  6-phosphogluconate dehydrogenase                   231   1e-69    
ref|WP_040984901.1|  6-phosphogluconate dehydrogenase                   234   1e-69    
ref|WP_029419400.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_026681743.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_014432809.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_006637460.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_025910295.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
dbj|GAF64735.1|  6-phosphogluconate dehydrogenase                       234   2e-69    
ref|WP_026571184.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     234   2e-69    
ref|WP_012810440.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_015186613.1|  6-phosphogluconate dehydrogenase (decarboxyl...    235   2e-69    
ref|WP_035469547.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_034661210.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
ref|WP_003472926.1|  6-phosphogluconate dehydrogenase                   234   2e-69    
emb|CDN43701.1|  6-phosphogluconate dehydrogenase, NADP(+)-depend...    234   2e-69    
ref|WP_006669299.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     234   2e-69    
ref|WP_026794863.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     234   3e-69    
ref|WP_024028439.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
ref|WP_044141026.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
ref|WP_041431203.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
ref|WP_012010492.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
gb|KDO38672.1|  hypothetical protein CISIN_1g041006mg                   230   3e-69    
ref|WP_014099786.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
ref|WP_025716140.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
ref|WP_016886716.1|  6-phosphogluconate dehydrogenase                   234   3e-69    
gb|AFY60394.1|  6-phosphogluconate dehydrogenase (decarboxylating)      234   3e-69    
ref|WP_003183299.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     234   4e-69    
ref|WP_041062161.1|  6-phosphogluconate dehydrogenase                   234   4e-69    
ref|WP_037993082.1|  6-phosphogluconate dehydrogenase                   234   4e-69    
ref|WP_017435253.1|  6-phosphogluconate dehydrogenase                   234   4e-69    
ref|WP_008233275.1|  6-phosphogluconate dehydrogenase, decarboxyl...    234   4e-69    
ref|WP_012162595.1|  6-phosphogluconate dehydrogenase                   234   4e-69    
ref|WP_044747917.1|  6-phosphogluconate dehydrogenase                   233   4e-69    
ref|WP_035330038.1|  6-phosphogluconate dehydrogenase                   233   5e-69    
ref|WP_022629069.1|  6-phosphogluconate dehydrogenase                   233   5e-69    
ref|WP_032087792.1|  6-phosphogluconate dehydrogenase                   233   5e-69    
ref|WP_024422907.1|  6-phosphogluconate dehydrogenase                   233   5e-69    
gb|ACS24987.1|  6-phosphogluconate dehydrogenase, decarboxylating       233   6e-69    
ref|WP_010345521.1|  6-phosphogluconate dehydrogenase                   233   6e-69    
ref|WP_035297117.1|  6-phosphogluconate dehydrogenase                   233   6e-69    
ref|WP_022737048.1|  6-phosphogluconate dehydrogenase                   233   6e-69    
ref|WP_009332861.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     233   6e-69    
gb|EED06433.1|  6-phosphogluconate dehydrogenase, decarboxylating       234   6e-69    
ref|WP_018932519.1|  6-phosphogluconate dehydrogenase                   233   7e-69    
ref|WP_043905384.1|  6-phosphogluconate dehydrogenase                   233   7e-69    
ref|WP_041269706.1|  6-phosphogluconate dehydrogenase                   233   7e-69    
ref|WP_044162633.1|  6-phosphogluconate dehydrogenase                   233   8e-69    
ref|WP_003324474.1|  6-phosphogluconate dehydrogenase                   233   8e-69    
gb|EPY12879.1|  hypothetical protein PAAL66ix_09891                     228   8e-69    
ref|WP_034280291.1|  6-phosphogluconate dehydrogenase                   233   8e-69    
ref|WP_036591186.1|  6-phosphogluconate dehydrogenase                   228   8e-69    
ref|WP_015120370.1|  6-phosphogluconate dehydrogenase                   233   8e-69    
ref|WP_041086071.1|  6-phosphogluconate dehydrogenase                   233   9e-69    
ref|WP_039043604.1|  6-phosphogluconate dehydrogenase                   233   9e-69    
ref|WP_028545022.1|  6-phosphogluconate dehydrogenase                   233   9e-69    
ref|WP_039179776.1|  6-phosphogluconate dehydrogenase                   233   1e-68    
ref|WP_024428028.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     233   1e-68    
ref|WP_020452102.1|  MULTISPECIES: NADP+-dependent 6-P-gluconate ...    233   1e-68    
ref|WP_025093007.1|  6-phosphogluconate dehydrogenase                   233   1e-68    
ref|WP_041047270.1|  6-phosphogluconate dehydrogenase                   233   1e-68    
emb|CEG24957.1|  6-phosphogluconate dehydrogenase                       233   1e-68    
ref|WP_034622350.1|  6-phosphogluconate dehydrogenase                   233   1e-68    
ref|WP_026788582.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     233   1e-68    
ref|WP_041244422.1|  6-phosphogluconate dehydrogenase                   232   1e-68    
ref|WP_039809539.1|  6-phosphogluconate dehydrogenase                   232   1e-68    
ref|WP_004435493.1|  6-phosphogluconate dehydrogenase                   232   1e-68    
ref|WP_003249346.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     232   1e-68    
ref|WP_034758126.1|  6-phosphogluconate dehydrogenase                   232   1e-68    
gb|AGY57488.1|  6-phosphogluconate dehydrogenase                        233   1e-68    
ref|WP_029271032.1|  6-phosphogluconate dehydrogenase                   232   2e-68    
ref|WP_010197545.1|  6-phosphogluconate dehydrogenase                   232   2e-68    
ref|WP_036621515.1|  6-phosphogluconate dehydrogenase                   232   2e-68    



>ref|XP_009774328.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
 ref|XP_009774330.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
 ref|XP_009774331.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
Length=485

 Score =   404 bits (1038),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKS+G+ DIL +Q+VDK
Sbjct  265  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSSGVSDILVEQSVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  KQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNPDLA+LLVDEEFAKE++ERQSAWRRVVCLAI+SGIS PGMS+SLAYFD+YRRE
Sbjct  385  KQAYDRNPDLANLLVDEEFAKEVVERQSAWRRVVCLAISSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DMPG+FHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERTDMPGAFHTEWF  477


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  298



>ref|XP_009773713.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
 ref|XP_009773720.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
 ref|XP_009773725.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
Length=484

 Score =   404 bits (1037),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFK++G+ DIL DQ+VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKASGVSDILVDQSVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLIDDVRKALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  NQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDRNPDLA+LLVDEEFAKE++ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  384  KGAYDRNPDLANLLVDEEFAKEMVERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+PGS+HTEWF
Sbjct  444  RLPANLVQAQRDYFGAHTYERIDVPGSYHTEWF  476


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  297



>ref|XP_009610999.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
 ref|XP_009611000.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
 ref|XP_009611001.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
Length=485

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKS+G+ DIL +Q+VDK
Sbjct  265  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSSGVSDILVEQSVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASK+CSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  KQLIDDVRKALYASKVCSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNPDLA+LLVDEEFAKE++ERQSAWRRVVCL+I+SGIS PGMS+SLAYFD+YRRE
Sbjct  385  KQAYDRNPDLANLLVDEEFAKEVVERQSAWRRVVCLSISSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DMPG+FHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERTDMPGAFHTEWF  477


 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  298



>ref|XP_009619672.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
 ref|XP_009619673.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
 ref|XP_009619674.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
Length=484

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFK++G+ DIL DQ+VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKASGVSDILVDQSVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLIDDVRKALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  NQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDRNPDLA+LLVDEEFAKE++ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  384  KGAYDRNPDLANLLVDEEFAKEMVERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             L ANLVQAQRDYFGAHTYERID+PGS+HTEWF
Sbjct  444  RLSANLVQAQRDYFGAHTYERIDVPGSYHTEWF  476


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  297



>ref|XP_011021140.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Populus euphratica]
 ref|XP_011021141.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Populus euphratica]
Length=488

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFK+ G GDILTDQ VDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKAGGFGDILTDQVVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW L+LGELARIWKGGCIIRAIFLDRI
Sbjct  328  KQLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLELGELARIWKGGCIIRAIFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS+PGMS+SLAYFDTYRRE
Sbjct  388  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISIPGMSSSLAYFDTYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GSFHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERVDVEGSFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>ref|XP_006363551.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Solanum tuberosum]
 ref|XP_006363552.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Solanum tuberosum]
Length=485

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLKDERVQAAKVF+S+G+ DI  +Q VDK
Sbjct  265  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKDERVQAAKVFESSGVSDIFVEQTVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLIDDVRKALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  NQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDRNPDLA+LLVDEEFAKE++ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  385  KGAYDRNPDLANLLVDEEFAKEMVERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYERID+PG+FHTEWF
Sbjct  445  SLPANLVQAQRDYFGAHTYERIDVPGAFHTEWF  477


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFG+KDDKADGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGVKDDKADGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  298



>ref|XP_004238989.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Solanum lycopersicum]
Length=485

 Score =   399 bits (1024),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIASSLDSRFLSGLKDERVQAAKVFKS G+ DIL +Q+VDK
Sbjct  265  KGTGKWTVQQAAELSIAAPTIASSLDSRFLSGLKDERVQAAKVFKSCGVSDILVEQSVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  KQLIDDVRKALYASKICSYAQGMNLIRAKSAEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVDEEFAKE++ERQSAWRRVVCLAI SGIS PGMS+SLAYFD+YRRE
Sbjct  385  KQAYDRNADLANLLVDEEFAKEVVERQSAWRRVVCLAITSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DMPGSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERTDMPGSFHTEWF  477


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADG+LVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKADGHLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIASSLDSRFLSGLK  298



>gb|AFK45875.1| unknown [Lotus japonicus]
Length=222

 Score =   389 bits (998),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI +SLD+RFLSGLKDERV+AAKVFKS G GDILTDQ VDK
Sbjct  2    KGTGKWTVQQAAELSVPAPTIEASLDARFLSGLKDERVEAAKVFKSGGFGDILTDQPVDK  61

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            +QLIDDVRKALYASKICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRAIFL RI
Sbjct  62   QQLIDDVRKALYASKICSYAQGMNLIRAKSNEKGWDLKLGELARIWKGGCIIRAIFLGRI  121

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  122  KQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  181

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYER+DM GS+HTEWF
Sbjct  182  SLPANLVQAQRDYFGAHTYERVDMEGSYHTEWF  214



>emb|CDP00510.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   398 bits (1023),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ER +AAKVFKS+G+ DILTDQ VDK
Sbjct  265  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERTEAAKVFKSSGVSDILTDQNVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKS E+GWGL+LGELARIWKGGCIIRAIFLDRI
Sbjct  325  KKLIDDVRQALYASKICSYAQGMNLIRAKSTEKGWGLRLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFAKE++ERQSAWRR+VCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  385  KKAYDRNPELANLLVDPEFAKEVVERQSAWRRIVCLAINSGISTPGMSSSLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+PGSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERIDVPGSFHTEWF  477


 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  298



>ref|XP_004237068.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum lycopersicum]
 ref|XP_010319490.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum lycopersicum]
Length=485

 Score =   398 bits (1023),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLKDERV+AAKVF+S+G+ DI  +Q+VDK
Sbjct  265  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKDERVEAAKVFESSGVSDIFVEQSVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLIDDVRKALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  NQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDRNPDLA+LLVDEEFAKE++ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  385  KGAYDRNPDLANLLVDEEFAKEMVERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYERID+PG+FHTEWF
Sbjct  445  SLPANLVQAQRDYFGAHTYERIDVPGAFHTEWF  477


 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFG+KDDKADGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGVKDDKADGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  298



>ref|XP_010257854.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nelumbo nucifera]
Length=486

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS+G+ DILTDQ VDK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSSGVCDILTDQVVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  QKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEI+ERQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  386  KKAYDRNPDLANLLVDPEFAKEIVERQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERIDVEGSFHTEWF  478


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  242  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  299



>ref|XP_006297535.1| hypothetical protein CARUB_v10013557mg [Capsella rubella]
 gb|EOA30433.1| hypothetical protein CARUB_v10013557mg [Capsella rubella]
Length=486

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQTVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNADLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_006348606.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum tuberosum]
Length=485

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIASSLDSRFLSGLKDERVQAAKVFKS G+ DIL +Q+VDK
Sbjct  265  KGTGKWTVQQAAELSIAAPTIASSLDSRFLSGLKDERVQAAKVFKSCGVSDILVEQSVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  325  KQLIDDVRKALYASKICSYAQGMNLIRAKSAEKGWDLTLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVDEEFAKE++ERQSAWRRVVCLAI SGIS PGMS+SLAYFD+YRRE
Sbjct  385  KQAYDRNADLANLLVDEEFAKEVVERQSAWRRVVCLAITSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DMPGSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERTDMPGSFHTEWF  477


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADG+LVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKADGHLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIASSLDSRFLSGLK  298



>ref|XP_006484295.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Citrus sinensis]
Length=484

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTI SSLD+RFLSGLK+ERV+AAKVF+S+GIGD+L +Q VDK
Sbjct  264  KGTGKWTVQQAADLSVAAPTIESSLDARFLSGLKEERVEAAKVFRSSGIGDVLAEQTVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGEL RIWKGGCIIRAIFLDRI
Sbjct  324  KKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELTRIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  384  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  444  RLPANLVQAQRDYFGAHTYERVDMSGSFHTEWF  476


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   +  S +  F++G K
Sbjct  240  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIESSLDARFLSGLK  297



>gb|AHL19963.1| 6-phosphogluconate dehydrogenase [Hibiscus cannabinus]
Length=485

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GDILTDQ VDK
Sbjct  265  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDILTDQVVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMSTSLAYFDTYRRE
Sbjct  385  KKAYDRNPELANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSTSLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  445  RVPANLVQAQRDYFGAHTYERVDMDGSFHTEWF  477


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  298



>ref|XP_011085569.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
Length=489

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLK+ER +AAKVFKS G GDILTDQ VDK
Sbjct  269  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKEERTEAAKVFKSGGFGDILTDQVVDK  328

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  329  EKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  388

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  389  KKAYDRNSELANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  448

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPGSFHTEWF
Sbjct  449  RLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  481


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  245  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  302



>ref|XP_006373519.1| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|ERP51316.1| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=488

 Score =   396 bits (1018),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFK+ G GDILTDQ VDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKAGGFGDILTDQVVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW L+LGELARIWKGGCIIRA+FLDRI
Sbjct  328  KQLIDDVRQALYASKICSYAQGMNLIRAKSMEKGWDLELGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS+SLAYFDT+RRE
Sbjct  388  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSSSLAYFDTFRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GSFHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERVDVEGSFHTEWF  480


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>ref|NP_186885.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 ref|NP_850502.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 sp|Q9FWA3.1|6GPD3_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
3 [Arabidopsis thaliana]
 gb|AAG12595.1|AC068900_1 6-phosphogluconate dehydrogenase, putative; 13029-14489 [Arabidopsis 
thaliana]
 gb|AAL11585.1|AF424591_1 AT3g02360/F11A12_104 [Arabidopsis thaliana]
 gb|AAM64891.1| 6-phosphogluconate dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAN73296.1| At3g02360/F11A12_104 [Arabidopsis thaliana]
 dbj|BAE99202.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AEE73796.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 gb|AEE73797.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
Length=486

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQKVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQL+DDVRKALYASKICSYAQGMNL+RAKSIE+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLVDDVRKALYASKICSYAQGMNLIRAKSIEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_010477172.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Camelina sativa]
 ref|XP_010478251.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 isoform X1 [Camelina sativa]
 ref|XP_010478914.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 isoform X2 [Camelina sativa]
Length=486

 Score =   395 bits (1016),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQTVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_009117953.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
 ref|XP_009117961.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
 ref|XP_009117968.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
Length=486

 Score =   395 bits (1016),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV +PTI SSLD+RFLSGLKDERVQAAKVFK  G GD+LTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPSPTIESSLDARFLSGLKDERVQAAKVFKEGGFGDVLTDQTVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYASKICSYAQGMNLIRAKSVEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCL+INSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLSINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DM GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDMEGSFHTEWF  478


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPSPTIESSLDARFLSGLK  299



>gb|KDO70202.1| hypothetical protein CISIN_1g0115012mg [Citrus sinensis]
Length=484

 Score =   395 bits (1016),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTI SSLD+RFLSGLK+ERV+AAKVF+S+GIGD+L +Q VDK
Sbjct  264  KGTGKWTVQQAADLSVAAPTIESSLDARFLSGLKEERVEAAKVFRSSGIGDVLAEQTVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGEL RIWKGGCIIRAIFLDRI
Sbjct  324  KKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELTRIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA++LVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  384  KKAYDRNPDLANVLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  444  RLPANLVQAQRDYFGAHTYERVDMSGSFHTEWF  476


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   +  S +  F++G K
Sbjct  240  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIESSLDARFLSGLK  297



>ref|XP_006408422.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 ref|XP_006408423.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 gb|ESQ49875.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 gb|ESQ49876.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
Length=488

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK  G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKEGGFGDILTDQTVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKSIE+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYASKICSYAQGMNLIRAKSIEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCL+INSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLSINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_010485479.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
 ref|XP_010485480.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
Length=486

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERV+AAKVFK+ G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVEAAKVFKAGGFGDILTDQTVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_010549952.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Tarenaya hassleriana]
 gb|ABD96861.1| hypothetical protein [Cleome spinosa]
Length=485

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLK+ERVQAAKVFK  G GDILTDQAVDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKEERVQAAKVFKEGGFGDILTDQAVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVR+ALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRRALYASKICSYAQGMNLIRAKSLEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP+L +LLVD EFAKEIIERQSAWRRVV LAINSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNPELPNLLVDPEFAKEIIERQSAWRRVVSLAINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DM G+FHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDMDGAFHTEWF  478


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DGYLVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFKIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_007032948.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY03874.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G+GD+LT+Q VDK
Sbjct  265  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGLGDVLTEQTVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+R KSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  ARLIDDVRQALYASKICSYAQGMNLIREKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  385  KKAYDRNPDLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PAN+VQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  445  RVPANMVQAQRDYFGAHTYERIDMEGSFHTEWF  477


 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  298



>ref|XP_002882225.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58484.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=486

 Score =   394 bits (1011),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQKVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQL+DDVRKALYASKICSYAQGMNL+RAKSIE+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLVDDVRKALYASKICSYAQGMNLIRAKSIEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQ AWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQCAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  299



>ref|XP_007032949.1| 6-phosphogluconate dehydrogenase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY03875.1| 6-phosphogluconate dehydrogenase family protein isoform 2, partial 
[Theobroma cacao]
Length=486

 Score =   393 bits (1010),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G+GD+LT+Q VDK
Sbjct  265  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGLGDVLTEQTVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+R KSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  ARLIDDVRQALYASKICSYAQGMNLIREKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  385  KKAYDRNPDLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PAN+VQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  445  RVPANMVQAQRDYFGAHTYERIDMEGSFHTEWF  477


 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  298



>ref|XP_009147357.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Brassica rapa]
 ref|XP_009147358.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Brassica rapa]
Length=488

 Score =   393 bits (1010),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV +PTI SSLD+RFLSGLKDERVQAAKVFK  G GD+LTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPSPTIESSLDARFLSGLKDERVQAAKVFKEGGFGDVLTDQTVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCL+INSGIS PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLSINSGISTPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  478


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPSPTIESSLDARFLSGLK  299



>ref|XP_006437811.1| hypothetical protein CICLE_v10031373mg [Citrus clementina]
 gb|ESR51051.1| hypothetical protein CICLE_v10031373mg [Citrus clementina]
Length=484

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTI SSLD+RFLSGLK+ERV+AAKVF+S+GIGD+L +Q VDK
Sbjct  264  KGTGKWTVQQAADLSVAAPTIESSLDARFLSGLKEERVEAAKVFRSSGIGDVLAEQTVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGEL RIWKGGCIIRAIFLDRI
Sbjct  324  EKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELTRIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  384  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GSFHTEWF
Sbjct  444  RLPANLVQAQRDYFGAHTYERVDISGSFHTEWF  476


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   +  S +  F++G K
Sbjct  240  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIESSLDARFLSGLK  297



>ref|XP_010091678.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXB44944.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=485

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKS+G+ + LT+Q V+K
Sbjct  265  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSSGVDNALTEQEVNK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K LIDDVR+ALYASKICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  325  KNLIDDVRQALYASKICSYAQGMNLIRAKSTEKGWNLKLGELARIWKGGCIIRAVFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EF+KEIIE+QSAWRRVVCLAI +GISVPGMS+SLAYFDTYRR+
Sbjct  385  KKAYDRNPDLANLLVDPEFSKEIIEQQSAWRRVVCLAIKTGISVPGMSSSLAYFDTYRRD  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+PGSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERIDIPGSFHTEWF  477


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  298



>gb|AFK47475.1| unknown [Lotus japonicus]
Length=341

 Score =   387 bits (995),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTV QAAELSVAAPTI +SLD RFLSGLK+ERV+AAKVFKS G  +ILTDQ VDK
Sbjct  121  KGTGKWTVPQAAELSVAAPTIEASLDGRFLSGLKEERVEAAKVFKSGGFDEILTDQPVDK  180

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  181  KKLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  240

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS SLAYFDTYRR+
Sbjct  241  KKAYDRNPELANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRD  300

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  301  RLPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  333


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  97   DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVPQAAELSVAAPTIEASLDGRFLSGLK  154



>gb|KJB10518.1| hypothetical protein B456_001G205600 [Gossypium raimondii]
Length=485

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LS+AAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GD+LTDQ VDK
Sbjct  265  KGTGKWTVQQAADLSIAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDVLTDQTVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+ AKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  AKLIDDVRQALYASKICSYAQGMNLIHAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEII+RQ AWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  385  KKAYDRNPDLANLLVDPEFAKEIIDRQFAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  445  RVPANLVQAQRDYFGAHTYERVDMEGSFHTEWF  477


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDSRFLSGLK  298



>ref|XP_010463641.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
Length=538

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI SSLD+RFLSGLKDERV+AAKVFK+ G GDILTDQ VDK
Sbjct  318  KGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVEAAKVFKAGGFGDILTDQTVDK  377

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  378  KQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRI  437

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN +LA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  438  KQAYDRNAELANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  497

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  498  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  530


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  294  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLK  351



>ref|XP_003531895.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform 1 [Glycine max]
 gb|KHN14455.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=486

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI +SLD+RFLSGLK+ERV+AAKVFKS GIGDI+TDQ VDK
Sbjct  266  KGTGKWTVQQAAELSIAAPTIEASLDARFLSGLKEERVEAAKVFKSGGIGDIVTDQPVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+L+DDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  KKLVDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  386  KQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GS+HTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDIEGSYHTEWF  478


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDARFLSGLK  299



>gb|KJB22742.1| hypothetical protein B456_004G063900 [Gossypium raimondii]
 gb|KJB22743.1| hypothetical protein B456_004G063900 [Gossypium raimondii]
Length=485

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LS+AAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GD+LTDQ VDK
Sbjct  265  KGTGKWTVQQAADLSIAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDVLTDQVVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  ARLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  385  KKAYDRNSDLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  445  RVPANLVQAQRDYFGAHTYERVDMDGSFHTEWF  477


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDSRFLSGLK  298



>gb|KJB10517.1| hypothetical protein B456_001G205600 [Gossypium raimondii]
Length=504

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LS+AAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GD+LTDQ VDK
Sbjct  284  KGTGKWTVQQAADLSIAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDVLTDQTVDK  343

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+ AKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  344  AKLIDDVRQALYASKICSYAQGMNLIHAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  403

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEII+RQ AWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  404  KKAYDRNPDLANLLVDPEFAKEIIDRQFAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  463

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  464  RVPANLVQAQRDYFGAHTYERVDMEGSFHTEWF  496


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  260  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSIAAPTIAASLDSRFLSGLK  317



>ref|XP_010920025.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Elaeis guineensis]
Length=488

 Score =   391 bits (1005),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GDIL+ Q VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDILSSQPVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LI+DVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  AKLIEDVRQALYASKICSYAQGMNLIRAKSMEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L SLLVD EFAKEI++RQSAWRRV+CLAIN+GIS PGMS SLAYFDTYRRE
Sbjct  384  KKAYDRNPELPSLLVDPEFAKEILDRQSAWRRVICLAINAGISTPGMSASLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERIDMPGSFHTEWF
Sbjct  444  RVPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  476


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  297



>ref|XP_011011766.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Populus euphratica]
 ref|XP_011011767.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Populus euphratica]
Length=471

 Score =   390 bits (1001),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFK+ G GDILT Q VDK
Sbjct  251  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKAGGFGDILTGQVVDK  310

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLD I
Sbjct  311  KQLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDWI  370

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EF+KEIIERQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRR 
Sbjct  371  KKAYDRNPDLANLLVDPEFSKEIIERQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRG  430

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GSFHTEWF
Sbjct  431  RLPANLVQAQRDYFGAHTYERVDVEGSFHTEWF  463


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  227  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  284



>ref|XP_011099073.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099074.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099075.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099076.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
Length=487

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 198/213 (93%), Gaps = 2/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQ  ELSVAAPTI +SLDSRFLSGLK+ER +AAKVFKS G GDIL DQ VDK
Sbjct  269  KGTGKWTVQQ--ELSVAAPTIEASLDSRFLSGLKEERTEAAKVFKSGGFGDILADQVVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVRKALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  327  EKLIDDVRKALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  387  KKAYDRNPDLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+PGSFHTEWF
Sbjct  447  RLPANLVQAQRDYFGAHTYERVDIPGSFHTEWF  479


 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTG----QVDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG    Q + S +   +  S ++ F++G K
Sbjct  245  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQELSVAAPTIEASLDSRFLSGLK  300



>ref|XP_010100892.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXB85816.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=488

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GD+LT+Q VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDVLTEQEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GWG+KLG+LA+IWKGGCIIRAIFLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWGIKLGDLAKIWKGGCIIRAIFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEIIERQSAWR+VVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  388  KKAYDRNADLANLLVDPEFAKEIIERQSAWRKVVCLAINSGISTPGMSSSLAYFDTYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D  GSFHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERTDHEGSFHTEWF  480


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  301



>gb|KDP24308.1| hypothetical protein JCGZ_25604 [Jatropha curcas]
Length=488

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFK+ G GD+L DQ VDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKAGGFGDVLADQVVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  KKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  388  KKAYDRNADLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERIDVEGSFHTEWF  480


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>ref|XP_010681308.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLDSRFLSGLKDERV AAKVFK+ G+ DIL+DQ VDK
Sbjct  265  KGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLKDERVAAAKVFKAGGVEDILSDQVVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  KKLIDDVRQALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LL+D EF+KE+IERQSAWRRVVCLAI+SGIS PGMS+SLAYFD+YRRE
Sbjct  385  KKAYDRNADLANLLIDPEFSKEMIERQSAWRRVVCLAISSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERVDMAGSFHTEWF  477


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  241  DIFGIKDDKDEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLK  298



>emb|CAN67602.1| hypothetical protein VITISV_032572 [Vitis vinifera]
Length=438

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS+G  ++L+DQ VDK
Sbjct  218  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSSGFENVLSDQTVDK  277

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  278  KKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  337

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI+ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRR+
Sbjct  338  KKAYDRNADLANLLVDPEFAKEIVERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRD  397

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID  GSFHTEWF
Sbjct  398  RLPANLVQAQRDYFGAHTYERIDTTGSFHTEWF  430


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  194  DIFSIKDDKGDGFLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  251



>ref|XP_002530803.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF31571.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=488

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS G GDILTDQ +DK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSGGFGDILTDQVIDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+L+DDVR+ALYA+KICSYAQGMNL+RAKSIE+ W LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  KKLVDDVRQALYAAKICSYAQGMNLIRAKSIEKVWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI++RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  388  KKAYDRNADLANLLVDPEFAKEIVDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERVDMEGSFHTEWF  480


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>ref|XP_010029445.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Eucalyptus grandis]
 gb|KCW56359.1| hypothetical protein EUGRSUZ_I02092 [Eucalyptus grandis]
Length=487

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLDSRFLSGLK+ERV+AA+VFKS G GDIL DQ VDK
Sbjct  267  KGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLKEERVKAAEVFKSGGFGDILADQEVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  327  KKLIDDVRQALYASKICSYAQGMNLIRAKSVEKGWDLTLGELARIWKGGCIIRAIFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVD EFAKEII+RQ+AWRRVVCLAINSGISVPGMS+SLAYFDTYRR 
Sbjct  387  KQAYDRNADLANLLVDPEFAKEIIDRQAAWRRVVCLAINSGISVPGMSSSLAYFDTYRRS  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYER+DM GSFHTEWF
Sbjct  447  RVPANLVQAQRDYFGAHTYERVDMEGSFHTEWF  479


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  243  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLK  300



>ref|XP_002270984.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Vitis vinifera]
 ref|XP_010654343.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Vitis vinifera]
Length=485

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS+G  ++L+DQ VDK
Sbjct  265  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSSGFENVLSDQTVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  325  KKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI+ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRR+
Sbjct  385  KKAYDRNADLANLLVDPEFAKEIVERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRD  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID  GSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERIDTTGSFHTEWF  477


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  241  DIFSIKDDKGDGFLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  298



>ref|XP_007045684.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007045685.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01516.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01517.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPT+ASSLD+RFLSGLK+ERV+AAK+F S G  +IL D AVDK
Sbjct  265  KGTGKWTVQQAAELSIAAPTMASSLDARFLSGLKEERVEAAKIFTSRGFSNILADVAVDK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GWGLKLGELARIWKGGCIIRA+FLDRI
Sbjct  325  KKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWGLKLGELARIWKGGCIIRAVFLDRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVV LAINSGIS PGMS+SLAYFD+YRRE
Sbjct  385  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVSLAINSGISTPGMSSSLAYFDSYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERIDVSGSFHTEWF  477


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   ++ S +  F++G K
Sbjct  241  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTMASSLDARFLSGLK  298



>ref|XP_002305978.2| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE86489.2| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=488

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFK+ G GDILT Q VDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKAGGFGDILTGQVVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLD I
Sbjct  328  KQLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDWI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVC+AI+SGIS PGMS+SLAYFDTYRR 
Sbjct  388  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCVAISSGISTPGMSSSLAYFDTYRRG  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GSFHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERVDVEGSFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>ref|XP_008788546.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Phoenix dactylifera]
Length=488

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G GDIL+ Q VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFGDILSSQPVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +L++DVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  AKLVEDVRQALYASKICSYAQGMNLIRAKSMEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L +LLVD EFA EI++RQSAWRRV+CLAIN+GIS PGMS SLAYFDTYRRE
Sbjct  384  KKAYDRNPELPNLLVDPEFAMEILDRQSAWRRVICLAINAGISTPGMSASLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERIDMPGSFHTEWF
Sbjct  444  RVPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  476


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  297



>ref|XP_006601856.1| PREDICTED: 6-phosphogluconate dehydrogenase isoform X1 [Glycine 
max]
 gb|KHN13784.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=486

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI +SLD+RFLSGLK+ERV+AAKVFKS GIGDI+TDQ VDK
Sbjct  266  KGTGKWTVQQAAELSIAAPTIEASLDARFLSGLKEERVEAAKVFKSGGIGDIVTDQPVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  QKLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AY+RNP+LA+LLVD EFAKEII+ QSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  386  KQAYERNPNLANLLVDPEFAKEIIDYQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GS+HTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDIEGSYHTEWF  478


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDARFLSGLK  299



>ref|XP_004491970.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 3-like [Cicer arietinum]
Length=493

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLD+RFLSGLK+ERV+AAK+FKS G+GDILT + VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIEASLDARFLSGLKEERVEAAKIFKSGGLGDILTGEPVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+L+DDVRKALYA+KICSYAQGMNL+RAKS EQGW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  328  KKLVDDVRKALYAAKICSYAQGMNLIRAKSAEQGWDLKLGELARIWKGGCIIRAIFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP+LA+LLVD EFAKEII+RQ++WRRVVCLA+NSGIS+PGMS SLAYFDTYRRE
Sbjct  388  KQAYDRNPNLANLLVDPEFAKEIIDRQTSWRRVVCLAVNSGISIPGMSASLAYFDTYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYERID+ GS+HTEWF
Sbjct  448  SLPANLVQAQRDYFGAHTYERIDIEGSYHTEWF  480


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDARFLSGLK  301



>ref|XP_008803614.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Phoenix dactylifera]
Length=488

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G  DIL+ Q +DK
Sbjct  264  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFSDILSSQPIDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LI+DVR+ALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  AKLIEDVRQALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L +LLVD EFAKEI++RQSAWRRV+CLAIN+GIS PGMS SLAYFDTYRRE
Sbjct  384  KKAYDRNPELPNLLVDPEFAKEILDRQSAWRRVICLAINAGISTPGMSASLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERIDMPGSFHT WF
Sbjct  444  RVPANLVQAQRDYFGAHTYERIDMPGSFHTGWF  476


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  297



>ref|XP_010261653.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X3 [Nelumbo nucifera]
Length=486

 Score =   385 bits (990),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLD+R LSGLK ERV+AAKVFKS+G+  ILT+  +DK
Sbjct  266  KGTGKWTVQQAAELSVAAPTIASSLDARSLSGLKKERVEAAKVFKSSGVCGILTEHTIDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  326  RKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWNLKLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSG+S PGMS+SLAY+DTYRRE
Sbjct  386  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGVSTPGMSSSLAYYDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  446  RVPANLVQAQRDYFGAHTYERIDVKGSFHTEWF  478


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGI+DDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S +   ++G K
Sbjct  242  DIFGIRDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDARSLSGLK  299



>ref|XP_010261649.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Nelumbo nucifera]
Length=490

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLD+R LSGLK ERV+AAKVFKS+G+  ILT+  +DK
Sbjct  266  KGTGKWTVQQAAELSVAAPTIASSLDARSLSGLKKERVEAAKVFKSSGVCGILTEHTIDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  326  RKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWNLKLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSG+S PGMS+SLAY+DTYRRE
Sbjct  386  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGVSTPGMSSSLAYYDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  446  RVPANLVQAQRDYFGAHTYERIDVKGSFHTEWF  478


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGI+DDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S +   ++G K
Sbjct  242  DIFGIRDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDARSLSGLK  299



>gb|KEH21786.1| decarboxylating-like 6-phosphogluconate dehydrogenase [Medicago 
truncatula]
Length=486

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI +SLD+RFLSGLKDERV+AAKVFKS G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIEASLDARFLSGLKDERVEAAKVFKSGGFGDILTDQQVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW L+LGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLELGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP+LA+LLVD EFAKEIIERQ+AWRRVV LA+NSGIS+PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNPNLANLLVDPEFAKEIIERQTAWRRVVSLAVNSGISLPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GS+HTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDIEGSYHTEWF  478


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIEASLDARFLSGLK  299



>sp|Q94KU1.1|6PGD1_SPIOL RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1 [Spinacia oleracea]
 gb|AAK51690.1|AF307144_1 cytosolic 6-phosphogluconate dehydrogenase [Spinacia oleracea]
Length=483

 Score =   385 bits (989),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERV+AAKVFK+ G+ D L+DQ VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVEAAKVFKAGGVEDTLSDQVVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYA+KICSYAQGMNL+RAKS+E+ W LKLGELARIWKGGCIIRA+FLDRI
Sbjct  324  KKLIDDVRQALYAAKICSYAQGMNLIRAKSVEKEWDLKLGELARIWKGGCIIRAMFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L++LL+D EF+KE+IERQSAWRRVVCLAI +GIS PGMS+SLAYFD+YRRE
Sbjct  384  KKAYDRNPNLSNLLIDPEFSKEMIERQSAWRRVVCLAIGAGISTPGMSSSLAYFDSYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+PG+FHTEWF
Sbjct  444  RLPANLVQAQRDYFGAHTYERIDIPGAFHTEWF  476


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  297



>ref|NP_001236726.1| 6-phosphogluconate dehydrogenase [Glycine max]
 dbj|BAA22812.1| 6-phosphogluconate dehydrogenase [Glycine max]
Length=511

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI +SLD+RFLSGLK+ERV+AAKVFKS GIGDI+TDQ VDK
Sbjct  266  KGTGKWTVQQAAELSIAAPTIEASLDARFLSGLKEERVEAAKVFKSGGIGDIVTDQHVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  326  QKLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AY+RNP+LA+LLVD EFAKEII+ QSAWRRVVCLAINSGIS PGMS SLAYFDTYRRE
Sbjct  386  KQAYERNPNLANLLVDPEFAKEIIDYQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GS+HTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDIEGSYHTEWF  478


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  242  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDARFLSGLK  299



>ref|XP_010933404.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Elaeis guineensis]
 ref|XP_010933405.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Elaeis guineensis]
Length=488

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G  DIL+ Q +DK
Sbjct  264  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGFSDILSSQPLDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  AKLIDDVRQALYASKICSYAQGMNLIRAKSMEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L +LL+D EFAKEI++RQSAWRRV+CLAIN+GIS PGMS SLAYFDTYRRE
Sbjct  384  KKAYDRNPELPNLLMDPEFAKEILDRQSAWRRVICLAINAGISTPGMSASLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERIDMPGSFHTEWF
Sbjct  444  RVPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  476


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  297



>ref|XP_006603945.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Glycine max]
 gb|KHN30764.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=488

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI +SLD+RFLSGLK+ERV+A+KVFKS+G  +IL+DQ VDK
Sbjct  268  KGTGKWTVQQAAELSIAAPTIEASLDARFLSGLKEERVEASKVFKSSGFDEILSDQHVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  328  KQLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFAKEI++RQSAWRRVVCLAIN G S PGM+ SLAYFDTYRRE
Sbjct  388  KKAYDRNPNLANLLVDPEFAKEIVDRQSAWRRVVCLAINYGTSTPGMAASLAYFDTYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  448  RVPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  480


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +G+LVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGEGHLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDARFLSGLK  301



>ref|XP_010261635.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010261644.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Nelumbo nucifera]
Length=511

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLD+R LSGLK ERV+AAKVFKS+G+  ILT+  +DK
Sbjct  266  KGTGKWTVQQAAELSVAAPTIASSLDARSLSGLKKERVEAAKVFKSSGVCGILTEHTIDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  326  RKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWNLKLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEIIERQSAWRRVVCLAINSG+S PGMS+SLAY+DTYRRE
Sbjct  386  KKAYDRNPDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGVSTPGMSSSLAYYDTYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  446  RVPANLVQAQRDYFGAHTYERIDVKGSFHTEWF  478


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGI+DDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S +   ++G K
Sbjct  242  DIFGIRDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDARSLSGLK  299



>ref|XP_004304174.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Fragaria vesca subsp. vesca]
Length=488

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI SSLD+RFLSGLKDERV+A+KVFK+ G GDILTDQ VDK
Sbjct  268  KGTGKWTVQQAAELSIAAPTIESSLDARFLSGLKDERVEASKVFKAGGFGDILTDQEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +L+DDVR+ALYASKICSYAQGMNL+RAKSIEQGW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLVDDVRQALYASKICSYAQGMNLIRAKSIEQGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVD EF+KEIIERQSAWRRVVCLAINSGIS PGMS SLAYFDTYRR 
Sbjct  388  KQAYDRNCDLANLLVDPEFSKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDTYRRA  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ G+FHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERTDVEGAFHTEWF  480


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIESSLDARFLSGLK  301



>ref|XP_008230333.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Prunus mume]
 ref|XP_008230334.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Prunus mume]
Length=488

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI SSLD+RFLSGLK+ERV+AAKVFKSAG GDILT   VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIESSLDARFLSGLKEERVKAAKVFKSAGFGDILTAPEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIEQGW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEQGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVD EF+KEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  388  KQAYDRNADLANLLVDPEFSKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ G+FHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERTDVEGAFHTEWF  480


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIESSLDARFLSGLK  301



>ref|XP_007217218.1| hypothetical protein PRUPE_ppa004860mg [Prunus persica]
 gb|EMJ18417.1| hypothetical protein PRUPE_ppa004860mg [Prunus persica]
Length=488

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI SSLD+RFLSGLK+ERV+AAKVFKSAG GDILT   VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIESSLDARFLSGLKEERVKAAKVFKSAGFGDILTAPEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIEQGW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEQGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRN DLA+LLVD EF+KEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  388  KQAYDRNADLANLLVDPEFSKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ G+FHTEWF
Sbjct  448  RLPANLVQAQRDYFGAHTYERTDVEGAFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIESSLDARFLSGLK  301



>ref|XP_009388425.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388426.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Musa acuminata subsp. malaccensis]
Length=484

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLK+ERV+A+KVF+S G  DIL  Q VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKEERVRASKVFQSGGFSDILGGQPVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LI+DVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  AKLIEDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L +LLVD EFAKEI++RQ+AWRRV+CLAIN GIS PGMS SLAYFDTYRRE
Sbjct  384  KKAYDRNPELPNLLVDPEFAKEIMDRQAAWRRVICLAINHGISTPGMSASLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            ++PANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  444  SVPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  476


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLK  297



>ref|XP_002305977.2| hypothetical protein POPTR_0004s10870g [Populus trichocarpa]
 gb|EEE86488.2| hypothetical protein POPTR_0004s10870g [Populus trichocarpa]
Length=472

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFK+ G GDILT Q VDK
Sbjct  252  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKAGGFGDILTGQVVDK  311

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKL ELARIWKGGCII+++FL RI
Sbjct  312  KQLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLRELARIWKGGCIIQSVFLGRI  371

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLASLLVD EFAKEIIERQSAWRRVVCL+I SGIS PGMS+SLAYFDTYRR 
Sbjct  372  KKAYDRNPDLASLLVDPEFAKEIIERQSAWRRVVCLSITSGISTPGMSSSLAYFDTYRRG  431

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GSFHTEWF
Sbjct  432  RLPANLVQAQRDYFGAHTYERVDVEGSFHTEWF  464


 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  228  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  285



>ref|XP_006482343.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Citrus sinensis]
 ref|XP_006482344.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Citrus sinensis]
Length=487

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS G G + ++QAVDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSGGFG-VQSNQAVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  327  QKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI++RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  387  KKAYDRNADLANLLVDPEFAKEIVDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  447  RLPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  479


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>gb|KDO38967.1| hypothetical protein CISIN_1g011394mg [Citrus sinensis]
Length=487

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS G G + ++QAVDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSGGFG-VQSNQAVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  327  QKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI++RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  387  KKAYDRNADLANLLVDPEFAKEIVDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  447  RLPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  479


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>gb|EPS70190.1| hypothetical protein M569_04567, partial [Genlisea aurea]
Length=504

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI +SLDSRFLSGLK+ERV AAKVF+S G+ DIL +Q VDK
Sbjct  285  KGTGKWTVQQAAELSIAAPTIEASLDSRFLSGLKEERVAAAKVFRSGGLEDILREQEVDK  344

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQL+DDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  345  KQLVDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  404

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP L +LLVD EFAKEI+ERQ+AWRRVVCLAI SGIS PGMS SLAYFD+YRRE
Sbjct  405  KKAYDRNPQLPNLLVDPEFAKEIVERQAAWRRVVCLAIKSGISTPGMSASLAYFDSYRRE  464

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+PG+FHTEWF
Sbjct  465  RLPANLVQAQRDYFGAHTYERIDVPGAFHTEWF  497


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  261  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDSRFLSGLK  318



>ref|XP_003555038.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoformX1 [Glycine max]
Length=533

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTI +SLD+RFLSGLK+ERV+A+KVFKS+G  +IL+DQ VDK
Sbjct  313  KGTGKWTVQQAAELSIAAPTIEASLDARFLSGLKEERVEASKVFKSSGFDEILSDQHVDK  372

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  373  KQLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  432

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFAKEI++RQSAWRRVVCLAIN G S PGM+ SLAYFDTYRRE
Sbjct  433  KKAYDRNPNLANLLVDPEFAKEIVDRQSAWRRVVCLAINYGTSTPGMAASLAYFDTYRRE  492

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             +PANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  493  RVPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  525


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +G+LVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  289  DIFGIKDDKGEGHLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDARFLSGLK  346



>ref|XP_008341826.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
Length=488

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI SSLD+RFLSGLKDERV+AAKVFKSAG  D L    VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIESSLDARFLSGLKDERVKAAKVFKSAGFEDSLNTPEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIEQGW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEQGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EF+KEI+ERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  388  KKAYDRNADLANLLVDPEFSKEIVERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYER DM G+FHTEWF
Sbjct  448  SLPANLVQAQRDYFGAHTYERTDMEGAFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIESSLDARFLSGLK  301



>ref|XP_009378306.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Pyrus x bretschneideri]
 ref|XP_009378308.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Pyrus x bretschneideri]
Length=488

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI SSLD+RFLSGLKDERV+AAKVFKSAG  D L    VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIESSLDARFLSGLKDERVKAAKVFKSAGFEDSLNAPEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIEQGW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEQGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EF+KEI+ERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  388  KKAYDRNADLANLLVDPEFSKEIVERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYER DM G+FHTEWF
Sbjct  448  SLPANLVQAQRDYFGAHTYERTDMEGTFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIESSLDARFLSGLK  301



>ref|XP_006430886.1| hypothetical protein CICLE_v10011597mg [Citrus clementina]
 gb|ESR44126.1| hypothetical protein CICLE_v10011597mg [Citrus clementina]
Length=487

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AA+VFKS G G + ++QAVDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAQVFKSGGFG-VQSNQAVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  327  QKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI++RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  387  KKAYDRNADLANLLVDPEFAKEIVDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  447  RLPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  479


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDARFLSGLK  301



>gb|AAB41553.1| 6-phosphogluconate dehydrogenase [Medicago sativa]
Length=486

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSV APTI +SLD+RFLSGL DERV+AAKVFKS G GDILTDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVPAPTIEASLDARFLSGLMDERVEAAKVFKSGGFGDILTDQQVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  326  KQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLALGELARIWKGGCIIRAIFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP+LA+LLVD EFAKEIIERQ+AWRRVV L++NSGIS+PGMS SLAYFD+YRRE
Sbjct  386  KQAYDRNPNLANLLVDPEFAKEIIERQTAWRRVVSLSVNSGISLPGMSASLAYFDSYRRE  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+ GS+HTEWF
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDIEGSYHTEWF  478


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 6/57 (11%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGF  745
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S     +  S +  F++G 
Sbjct  242  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIEASLDARFLSGL  298



>ref|XP_002311423.2| phosphogluconate dehydrogenase family protein, partial [Populus 
trichocarpa]
 gb|EEE88790.2| phosphogluconate dehydrogenase family protein, partial [Populus 
trichocarpa]
Length=272

 Score =   373 bits (958),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLD RFLSGLK+ERV+AAKVFKS+GI D+L DQ VDK
Sbjct  52   KGTGKWTVQQAAELSVAAPTIASSLDGRFLSGLKEERVEAAKVFKSSGIIDMLADQVVDK  111

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LI DVR+ALY SKICSYAQGMNL+RAKS E+GW LKLG+L RIWKGGCIIRA+FLDRI
Sbjct  112  EKLIYDVRQALYVSKICSYAQGMNLIRAKSAEKGWDLKLGQLTRIWKGGCIIRAVFLDRI  171

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+L +LLVD EFAKEIIERQSAWRRVV +AINSGIS PGMS+SLAYFDTYRR 
Sbjct  172  KKAYDRNPNLPNLLVDPEFAKEIIERQSAWRRVVSIAINSGISTPGMSSSLAYFDTYRRS  231

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERID+ GSFHTEWF
Sbjct  232  RLPANLVQAQRDYFGAHTYERIDIDGSFHTEWF  264


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   ++ S +  F++G K
Sbjct  28   DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDGRFLSGLK  85



>ref|XP_009399427.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399428.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=484

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLK+ERV+AAKVF+S G  D+L  + VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKEERVEAAKVFQSGGFSDVLESKPVDK  323

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  324  AKLIDDVRQALYASKICSYAQGMNLIRAKSTEKGWDLKLGELARIWKGGCIIRAIFLDRI  383

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +L++LLVD EFAKEI++RQSAWRRVVCLAIN GIS PGMSTSLAYFDTYRRE
Sbjct  384  KKAYDRNAELSNLLVDPEFAKEILDRQSAWRRVVCLAINHGISTPGMSTSLAYFDTYRRE  443

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             + ANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  444  RVSANLVQAQRDYFGAHTYERVDMPGSFHTEWF  476


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFG+KDDK DG+LVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  240  DIFGVKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  297



>ref|XP_009373738.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Pyrus x bretschneideri]
Length=488

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI SSLD+RFLSGLKDERV+AAKVFKSAG  D L    VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIESSLDARFLSGLKDERVKAAKVFKSAGFEDSLNTPEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EF+KEI+ERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE
Sbjct  388  KKAYDRNADLANLLVDPEFSKEIVERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRE  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYER DM G FHTEWF
Sbjct  448  SLPANLVQAQRDYFGAHTYERTDMEGVFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIESSLDARFLSGLK  301



>gb|EYU44260.1| hypothetical protein MIMGU_mgv1a005435mg [Erythranthe guttata]
 gb|EYU44261.1| hypothetical protein MIMGU_mgv1a005435mg [Erythranthe guttata]
Length=483

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 197/214 (92%), Gaps = 6/214 (3%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV-D  648
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDER +AAKVF     GDIL+D+ V D
Sbjct  269  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERTEAAKVF-----GDILSDEVVVD  323

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            K+QLIDDVRKALYASKICSYAQGMNL+RAKS E+GWGL+LGELARIWKGGCIIRAIFLDR
Sbjct  324  KEQLIDDVRKALYASKICSYAQGMNLIRAKSEEKGWGLELGELARIWKGGCIIRAIFLDR  383

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AYDRN DLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFDTYRR
Sbjct  384  IKQAYDRNSDLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDTYRR  443

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            E LPANLVQAQRDYFGAHTYER+D+PGS+HTEWF
Sbjct  444  ERLPANLVQAQRDYFGAHTYERVDIPGSYHTEWF  477


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKADGYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  245  DIFGIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  302



>ref|XP_006857727.1| hypothetical protein AMTR_s00061p00182310 [Amborella trichopoda]
 gb|ERN19194.1| hypothetical protein AMTR_s00061p00182310 [Amborella trichopoda]
Length=488

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 196/215 (91%), Gaps = 2/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQA--V  651
            +  GKWTVQQAA+LSVAAPTIASSLDSRFLSGLKDERV+AAKVFK  G+ DI++     V
Sbjct  266  KGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLKDERVEAAKVFKHGGMDDIISGDHGFV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DK +LID+VRKALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLD
Sbjct  326  DKSKLIDEVRKALYASKICSYAQGMNLIRAKSVEKGWDLKLGELARIWKGGCIIRAIFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIK+AYDRN +LA+LLVD EFAKEI+ERQSAWRRVVCLAINSGIS PGM  SLAYFDTYR
Sbjct  386  RIKQAYDRNSELANLLVDPEFAKEIVERQSAWRRVVCLAINSGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            RE LPANLVQAQRDYFGAHTYER DMPGSFHTEWF
Sbjct  446  RERLPANLVQAQRDYFGAHTYERTDMPGSFHTEWF  480


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKD+K DGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFSIKDNKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLK  299



>ref|XP_004141482.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 ref|XP_004171525.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 gb|KGN52541.1| hypothetical protein Csa_5G642720 [Cucumis sativus]
Length=487

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVA PTIASSLD+RFLSGLK+ERV+AAKVF S G+ D+L  Q VDK
Sbjct  268  KGTGKWTVQQAADLSVAVPTIASSLDARFLSGLKEERVEAAKVFGS-GLNDVLVPQEVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  327  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDR PDLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  387  KRAYDRKPDLANLLVDTEFAKEIIERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DM GSFHTEWF
Sbjct  447  RLPANLVQAQRDYFGAHTYERTDMEGSFHTEWF  479


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDKADGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFSIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAADLSVAVPTIASSLDARFLSGLK  301



>ref|XP_008379478.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
 ref|XP_008379479.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
Length=488

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI SSLD+RFLSGLKDERV+AAKVFKSAG  D L    VDK
Sbjct  268  KGTGKWTVQQAAELSVAAPTIESSLDARFLSGLKDERVKAAKVFKSAGFEDSLNAPEVDK  327

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  328  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  387

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EF+KEI+ERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRR+
Sbjct  388  KKAYDRNADLANLLVDPEFSKEIVERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRD  447

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER DM G+FHTEWF
Sbjct  448  TLPANLVQAQRDYFGAHTYERTDMEGAFHTEWF  480


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIESSLDARFLSGLK  301



>gb|KDP31431.1| hypothetical protein JCGZ_11807 [Jatropha curcas]
Length=485

 Score =   377 bits (969),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIASSLD RFLSGLK+ER++AAK+FKS+G+GDIL DQ V+K
Sbjct  265  KGTGKWTVQQAAELSVAAPTIASSLDGRFLSGLKEERIEAAKIFKSSGVGDILADQVVNK  324

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LI D  +ALYASKICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRA+FL+RI
Sbjct  325  EKLIGDAGQALYASKICSYAQGMNLIRAKSAEKGWDLKLGELARIWKGGCIIRAVFLNRI  384

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNPDL +LLVD EFA+EIIERQSAWRRVV LAINSGIS PGMS SLAYFDTYRRE
Sbjct  385  KQAYDRNPDLPNLLVDPEFAREIIERQSAWRRVVYLAINSGISTPGMSASLAYFDTYRRE  444

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+PGSFHTEWF
Sbjct  445  RLPANLVQAQRDYFGAHTYERTDVPGSFHTEWF  477


 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGI+DDK DGYLVDKVLDKTGMKGTG+       + S +   ++ S +  F++G K
Sbjct  241  DIFGIRDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIASSLDGRFLSGLK  298



>ref|XP_010558538.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558539.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558540.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558541.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558542.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 gb|ABD96905.1| hypothetical protein [Cleome spinosa]
Length=483

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 199/214 (93%), Gaps = 1/214 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAELSV APTI +SLD+RF+SGLK+ERVQAAKVFK +G+ GDILTDQ +D
Sbjct  263  KGTGKWTVQQAAELSVPAPTIEASLDARFISGLKEERVQAAKVFKESGLCGDILTDQEID  322

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KKQLI+DVR+ALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDR
Sbjct  323  KKQLIEDVRRALYASKICSYAQGMNLVRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDR  382

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AYDRNPDL +LLVD EFAKE++ERQSAWRRVV LA++SGIS+PGM+ SLAYFD+YRR
Sbjct  383  IKQAYDRNPDLPNLLVDPEFAKEMVERQSAWRRVVSLAVDSGISMPGMTASLAYFDSYRR  442

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            E LPANLVQAQRDYFGAHTYER D  GSFHTEWF
Sbjct  443  ERLPANLVQAQRDYFGAHTYERADFDGSFHTEWF  476


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF I+DDK DGYLVDKVLDKTGMKGTG+       + S     +  S +  F++G K
Sbjct  239  DIFKIEDDKGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIEASLDARFISGLK  296



>ref|XP_009399426.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLDSRFLSGLK+ERV+AAKVF+S G  D+L  + VDK
Sbjct  321  KGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLKEERVEAAKVFQSGGFSDVLESKPVDK  380

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  381  AKLIDDVRQALYASKICSYAQGMNLIRAKSTEKGWDLKLGELARIWKGGCIIRAIFLDRI  440

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +L++LLVD EFAKEI++RQSAWRRVVCLAIN GIS PGMSTSLAYFDTYRRE
Sbjct  441  KKAYDRNAELSNLLVDPEFAKEILDRQSAWRRVVCLAINHGISTPGMSTSLAYFDTYRRE  500

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             + ANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  501  RVSANLVQAQRDYFGAHTYERVDMPGSFHTEWF  533


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFG+KDDK DG+LVDKVLDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  297  DIFGVKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRFLSGLK  354



>ref|XP_008459418.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Cucumis melo]
 ref|XP_008459420.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Cucumis melo]
Length=487

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVA PTIASSLD+RFLSGLK+ERV+AAKVF S G+ D+L  Q VDK
Sbjct  268  KGTGKWTVQQAADLSVAVPTIASSLDARFLSGLKEERVEAAKVFGS-GLNDVLAPQEVDK  326

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  327  AKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  386

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDR PDLA+LLVD EFAKEI+ERQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  387  KRAYDRKPDLANLLVDTEFAKEIMERQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  446

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER D+ GSFHTEWF
Sbjct  447  RLPANLVQAQRDYFGAHTYERTDVEGSFHTEWF  479


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDKADGYLVDKVLDKTGMKGTG+       D S +   ++ S +  F++G K
Sbjct  244  DIFSIKDDKADGYLVDKVLDKTGMKGTGKWTVQQAADLSVAVPTIASSLDARFLSGLK  301



>ref|XP_001770880.1| predicted protein [Physcomitrella patens]
 gb|EDQ64210.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIA+SLDSRFLSGLK+ER++AA++F+ AG+ DIL  +++DK
Sbjct  271  KGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLKEERLEAARIFREAGVEDILAVKSLDK  330

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQL+DDVRKALYASKICSYAQGMNL+RAKSIEQGW L LGELARIWKGGCIIRA FLDRI
Sbjct  331  KQLVDDVRKALYASKICSYAQGMNLIRAKSIEQGWDLNLGELARIWKGGCIIRAKFLDRI  390

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LASLL+D EF KE++ERQSAWRRVV LAI  G+S PGM+ SLAYFDTYRR 
Sbjct  391  KKAYDRNPELASLLIDPEFTKEMVERQSAWRRVVSLAIEVGVSTPGMTASLAYFDTYRRG  450

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPGS+HTEWF
Sbjct  451  RLPANLVQAQRDYFGAHTYERIDMPGSYHTEWF  483


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDDK DG+LVDK+LDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  247  DIFSVKDDKGDGFLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLK  304



>ref|XP_007151436.1| hypothetical protein PHAVU_004G046100g [Phaseolus vulgaris]
 gb|ESW23430.1| hypothetical protein PHAVU_004G046100g [Phaseolus vulgaris]
Length=490

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 199/215 (93%), Gaps = 2/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQA--V  651
            +  GKWTVQQAAELS+AAPTI +SLD+RFLSGLK+ERV+AAK+FKS G+  IL DQ   V
Sbjct  268  KGTGKWTVQQAAELSIAAPTIEASLDARFLSGLKEERVEAAKLFKSRGLDSILNDQHQIV  327

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGELARIWKGGCIIRAIFLD
Sbjct  328  DKKKLVDDVRKALYAAKICSYAQGMNLIRAKSKEKGWELKLGELARIWKGGCIIRAIFLD  387

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAYDR+P+LA+LLVD EFAKEI++RQSAWRRVVCLAIN+GIS PGM+ SLAYFDTYR
Sbjct  388  RIKKAYDRSPNLANLLVDPEFAKEIVDRQSAWRRVVCLAINNGISTPGMAASLAYFDTYR  447

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            RE++PANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  448  RESVPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  482


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDKA+GYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  244  DIFGIKDDKAEGYLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDARFLSGLK  301



>gb|ADP03318.1| 6-phosphogluconate dehydrogenase [Pinus pinaster]
Length=483

 Score =   372 bits (956),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL SLLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFSLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            +LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  SLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIASSLDSRFLSGLK  299



>ref|XP_001764215.1| predicted protein [Physcomitrella patens]
 gb|EDQ71056.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIA+SLDSRFLSGLK+ER++AA++FK AG+ DI+  + +DK
Sbjct  271  KGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLKEERLEAARIFKEAGVDDIIAVKNLDK  330

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K L+DDVRKALYASKICSYAQGMNL+RAKSIEQGW L LGELARIWKGGCIIRA FLDRI
Sbjct  331  KVLVDDVRKALYASKICSYAQGMNLIRAKSIEQGWNLNLGELARIWKGGCIIRAKFLDRI  390

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LASLL+D EF KE++ERQSAWRRVV LAI  G+S PGM+ SLAYFDTYRR 
Sbjct  391  KKAYDRNPELASLLIDPEFTKEMVERQSAWRRVVSLAIEVGVSTPGMTASLAYFDTYRRG  450

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPGS+HTEWF
Sbjct  451  RLPANLVQAQRDYFGAHTYERIDMPGSYHTEWF  483


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDDKA+G+LVDK+LDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  247  DIFSVKDDKAEGFLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLK  304



>ref|XP_007139369.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 ref|XP_007139370.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 gb|ESW11363.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 gb|ESW11364.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
Length=483

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLD+RFLSGLK+ERV+AAKVFKS   GDI+TDQ VDK
Sbjct  266  KGTGKWTVQQAAELSVAAPTIEASLDARFLSGLKEERVEAAKVFKS---GDIVTDQPVDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            +QLIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW L+LGELARIWKGGCIIRAIFLDRI
Sbjct  323  QQLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLQLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP LA+LLVD EFAKEI++RQSAWRRVVCLA+NS IS PGMS SL YFD+Y RE
Sbjct  383  KQAYDRNPSLANLLVDPEFAKEILDRQSAWRRVVCLAVNSRISTPGMSASLNYFDSYSRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            + PANLVQAQRDYFGAHTYER+D+ GS+HTEWF
Sbjct  443  SSPANLVQAQRDYFGAHTYERVDIEGSYHTEWF  475


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   +  S +  F++G K
Sbjct  242  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDARFLSGLK  299



>gb|ADP03059.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03067.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03068.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03076.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03079.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03082.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03088.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFAIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>gb|ADP03083.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFAIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>gb|ADP03057.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03066.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03080.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>gb|ADP03065.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFAIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>gb|ADP03058.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03074.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03084.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03086.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFAIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>gb|ADP03055.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03056.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03060.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03061.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03062.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03063.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03064.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03069.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03071.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03072.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03073.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03075.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03077.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03078.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03081.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03085.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03087.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03089.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFAIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>gb|ADP03070.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+A+KVFK+  +G +     +DK
Sbjct  266  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTV---PDLDK  322

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  323  TKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRI  382

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDL +LLVD EFAKE+IERQSAWRRVV LAIN+G+SVPGMS SLAYFD+YRRE
Sbjct  383  KKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRE  442

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDMPG FHTEWF
Sbjct  443  TLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF  475


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDDK DG+LVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  242  DIFVIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  299



>tpg|DAA55929.1| TPA: 6-phosphogluconate dehydrogenase2 [Zea mays]
Length=480

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 194/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD  T   VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYSTGLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSSEKGWGLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFA+EII+RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNPNLANLLVDPEFAQEIIDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  472


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>dbj|BAD67774.1| putative phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
Length=406

 Score =   365 bits (936),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 194/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+AAKVF+    GD  ++  VDK
Sbjct  190  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEAAKVFQ----GDFSSNLPVDK  245

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS+E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  246  AQLIEDVRQALYASKICSYAQGMNIIKAKSMEKGWSLNLGELARIWKGGCIIRAIFLDRI  305

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  306  KKAYDRNSDLANLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  365

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  366  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  398


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+  G+LVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  166  DIFSIKDDQGSGHLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  223



>ref|XP_004971196.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Setaria italica]
Length=480

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 193/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD  T   VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYSTGLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSSEKGWALNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNPDLANLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  472


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKD++ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDEQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|NP_001056586.1| Os06g0111500 [Oryza sativa Japonica Group]
 sp|Q9LI00.1|6PGD1_ORYSJ RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1; Short=OsG6PGH1 [Oryza sativa Japonica Group]
 gb|AAL92029.1|AF486280_1 cytosolic 6-phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAA93024.1| putative phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF18500.1| Os06g0111500 [Oryza sativa Japonica Group]
 gb|EAZ35578.1| hypothetical protein OsJ_19864 [Oryza sativa Japonica Group]
 dbj|BAG89736.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98434.1| 6-phosphogluconate dehydrogenase, partial [Oryza sativa]
Length=480

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 194/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+AAKVF+    GD  ++  VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEAAKVFQ----GDFSSNLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS+E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSMEKGWSLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNSDLANLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  472


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+  G+LVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFSIKDDQGSGHLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|XP_004964329.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X1 [Setaria italica]
 ref|XP_004964330.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X2 [Setaria italica]
Length=481

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 193/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD  T   VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYSTGLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSSEKGWGLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNADLANLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  472


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDD+ DGYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDDQGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>gb|ACN35899.1| unknown [Zea mays]
Length=480

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 193/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD  T   VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYSTGLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSSEKGWGLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFA+EII+RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNPNLANLLVDPEFAQEIIDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGA TYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGARTYERVDMPGSFHTEWF  472


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|NP_001266302.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 1 [Zea mays]
 gb|ACF85199.1| unknown [Zea mays]
 gb|ACF87821.1| unknown [Zea mays]
 gb|ACR36789.1| unknown [Zea mays]
 gb|AFW75252.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 1 [Zea mays]
 gb|AFW75253.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 2 [Zea mays]
 gb|AFW75254.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 3 [Zea mays]
Length=482

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 193/214 (90%), Gaps = 5/214 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL-TDQAVD  648
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD   T   VD
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYYSTGSPVD  319

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            K QL++DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDR
Sbjct  320  KAQLVEDVRQALYASKICSYAQGMNIIKAKSAEKGWGLNLGELARIWKGGCIIRAIFLDR  379

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP LASLLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR
Sbjct  380  IKKAYDRNPGLASLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRR  439

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            + LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  DRLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  473


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKD+  DGYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDEHGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|XP_006655710.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X1 [Oryza brachyantha]
 ref|XP_006655711.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X2 [Oryza brachyantha]
Length=481

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 194/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+AAK+F+    GD  +D  VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEAAKIFQ----GDFSSDLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS+E+GW L LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSMEKGWSLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNSDLANLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+D+PG+FHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDVPGAFHTEWF  472


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFSIKDDQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|XP_003557150.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Brachypodium distachyon]
Length=479

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV A+K+F+    GD  TD  VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVAASKIFQ----GDYSTDLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVRKALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRA FLDRI
Sbjct  320  AQLIEDVRKALYASKICSYAQGMNIIKAKSTEKGWGLNLGELARIWKGGCIIRASFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LA+LL+D EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNAELANLLIDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  472


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDD+ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDDQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|NP_001104911.1| 6-phosphogluconate dehydrogenase2 [Zea mays]
 gb|AAC27703.1| putative cytosolic 6-phosphogluconate dehydrogenase [Zea mays]
Length=482

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 193/214 (90%), Gaps = 5/214 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL-TDQAVD  648
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD   T   VD
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYYSTGSPVD  319

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            K QL++DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDR
Sbjct  320  KAQLVEDVRQALYASKICSYAQGMNIIKAKSAEKGWGLNLGELARIWKGGCIIRAIFLDR  379

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP LASLLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR
Sbjct  380  IKKAYDRNPGLASLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRR  439

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
            + LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  DRLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  473


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKD+  DGYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDEHGDGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>emb|CDM86736.1| unnamed protein product [Triticum aestivum]
Length=479

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 193/213 (91%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV A+K+F+    GD  + + VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVAASKIFQ----GDYSSGETVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVRKALYASKICSYAQGMN+++AKS+E+GWGL LGELARIWKGGCIIRA FLDRI
Sbjct  320  AQLIEDVRKALYASKICSYAQGMNIIKAKSVEKGWGLNLGELARIWKGGCIIRASFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LA+LL+D EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRRE
Sbjct  380  KKAYDRNGELANLLIDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRE  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEW+
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWY  472


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFSIKDDQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>gb|AHM10416.1| 6-phosphogluconate dehydrogenase [Saccharum hybrid cultivar Yacheng05-179]
Length=480

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+ +    GD  T   VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKILQ----GDYSTGLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSSEKGWGLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LA+LLVD EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNSNLANLLVDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEWF
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWF  472


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKD++ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDEQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>ref|XP_002972874.1| hypothetical protein SELMODRAFT_98399 [Selaginella moellendorffii]
 gb|EFJ26095.1| hypothetical protein SELMODRAFT_98399 [Selaginella moellendorffii]
Length=491

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIA+SLDSRFLSGLK+ERV AA +F  AG+ D+L   AVDK
Sbjct  266  KGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLKEERVAAAAIFAEAGLPDVLNHVAVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQL+DDVRKALYASKICSYAQGMNLLRAKS+EQGW L LGELARIWKGGCIIRA+FLDRI
Sbjct  326  KQLVDDVRKALYASKICSYAQGMNLLRAKSLEQGWKLDLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LASLL+D EFAKE++ERQ+AWRRVV LA+++GIS PGM+ SLAYFDTYRR 
Sbjct  386  KKAYDRNSNLASLLIDPEFAKEMVERQAAWRRVVSLAVSAGISTPGMTASLAYFDTYRRG  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRDYFGAHTYER+DM GSFHTEW
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDMSGSFHTEW  477


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDDKA G LVDK+LDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  242  DIFSVKDDKAGGDLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLK  299



>ref|XP_002988062.1| hypothetical protein SELMODRAFT_127384 [Selaginella moellendorffii]
 gb|EFJ10854.1| hypothetical protein SELMODRAFT_127384 [Selaginella moellendorffii]
Length=491

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIA+SLDSRFLSGLK+ERV AA +F  AG+ D+L   AVDK
Sbjct  266  KGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLKEERVAAAAIFAEAGLPDVLNHVAVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQL+DDVRKALYASKICSYAQGMNLLRAKS+EQGW L LGELARIWKGGCIIRA+FLDRI
Sbjct  326  KQLVDDVRKALYASKICSYAQGMNLLRAKSLEQGWKLDLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LASLL+D EFAKE++ERQ+AWRRVV LA+++GIS PGM+ SLAYFDTYRR 
Sbjct  386  KKAYDRNSNLASLLIDPEFAKEMVERQAAWRRVVSLAVSAGISTPGMTASLAYFDTYRRG  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRDYFGAHTYER+DM GSFHTEW
Sbjct  446  RLPANLVQAQRDYFGAHTYERVDMSGSFHTEW  477


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDDKA G LVDK+LDKTGMKGTG+       + S +   ++ S ++ F++G K
Sbjct  242  DIFSVKDDKAGGDLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDSRFLSGLK  299



>gb|ADG38360.1| AT3G02360-like protein [Capsella grandiflora]
 gb|ADG38362.1| AT3G02360-like protein [Capsella grandiflora]
 gb|ADG38363.1| AT3G02360-like protein [Capsella grandiflora]
 gb|ADG38364.1| AT3G02360-like protein [Capsella grandiflora]
 gb|ADG38365.1| AT3G02360-like protein [Capsella grandiflora]
Length=187

 Score =   346 bits (888),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  809  WTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLID  630
            WTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDKKQLID
Sbjct  1    WTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQTVDKKQLID  60

Query  629  DVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYD  450
            DVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRIK+AYD
Sbjct  61   DVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYD  120

Query  449  RNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPAN  270
            RN DLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE LPAN
Sbjct  121  RNADLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPAN  180

Query  269  LVQAQRD  249
            LVQAQRD
Sbjct  181  LVQAQRD  187



>gb|ADG38366.1| AT3G02360-like protein [Neslia paniculata]
Length=187

 Score =   345 bits (884),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  809  WTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLID  630
            WTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDKKQLID
Sbjct  1    WTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQTVDKKQLID  60

Query  629  DVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYD  450
            DVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRIK+AYD
Sbjct  61   DVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYD  120

Query  449  RNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPAN  270
            RN +LA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE LPAN
Sbjct  121  RNAELANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPAN  180

Query  269  LVQAQRD  249
            LVQAQRD
Sbjct  181  LVQAQRD  187



>ref|XP_001759464.1| predicted protein [Physcomitrella patens]
 gb|EDQ75766.1| predicted protein [Physcomitrella patens]
Length=504

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 189/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ERV+AAKVFKS G+ D+L +  VDK
Sbjct  266  KGTGKWTVQQAAELSVAAPTIATSLDLRYLSGLKEERVEAAKVFKSLGVSDLLAEVKVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LID+VRKALYASKICSYAQGMNL+RAKSIE+GW L LGELARIWKGGCIIRA FLDRI
Sbjct  326  QELIDNVRKALYASKICSYAQGMNLIRAKSIEKGWNLDLGELARIWKGGCIIRAKFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDR+P LASLL+D EFAKE++ERQ AWR+VV LAI  G+S PGMS SL YFDTYRR 
Sbjct  386  KQAYDRDPKLASLLIDPEFAKEMVERQGAWRKVVSLAIEVGVSTPGMSASLGYFDTYRRA  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFG+HTYER+DM  SFHTEW+
Sbjct  446  RLPANLVQAQRDYFGSHTYERVDMKDSFHTEWY  478


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF + DDK +G LVDKVLDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFSVPDDKGEGELVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIATSLDLRYLSGLK  299



>gb|AEN81731.1| AT3G02360-like protein, partial [Capsella rubella]
 gb|AEN81733.1| AT3G02360-like protein, partial [Capsella rubella]
 gb|AEN81735.1| AT3G02360-like protein, partial [Capsella rubella]
 gb|AEN81736.1| AT3G02360-like protein, partial [Capsella rubella]
Length=186

 Score =   344 bits (883),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -1

Query  809  WTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLID  630
            WTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ VDKKQLID
Sbjct  1    WTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQTVDKKQLID  60

Query  629  DVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYD  450
            DVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRIK+AYD
Sbjct  61   DVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYD  120

Query  449  RNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPAN  270
            RN DLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE LPAN
Sbjct  121  RNADLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPAN  180

Query  269  LVQAQR  252
            LVQAQR
Sbjct  181  LVQAQR  186



>ref|XP_002966753.1| hypothetical protein SELMODRAFT_168478 [Selaginella moellendorffii]
 ref|XP_002977996.1| hypothetical protein SELMODRAFT_268134 [Selaginella moellendorffii]
 gb|EFJ20653.1| hypothetical protein SELMODRAFT_268134 [Selaginella moellendorffii]
 gb|EFJ32780.1| hypothetical protein SELMODRAFT_168478 [Selaginella moellendorffii]
Length=487

 Score =   355 bits (911),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLK+ERV AAK FK  G+ DIL    VDK
Sbjct  269  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKEERVAAAKNFKELGVSDILAPSNVDK  328

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LID VRKALYASKICSYAQGMNL+RAKS+E+ W L LGELARIWKGGCIIRA+FLDRI
Sbjct  329  KELIDGVRKALYASKICSYAQGMNLIRAKSMEKSWNLNLGELARIWKGGCIIRAVFLDRI  388

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LL+D EFA E++ERQ AWR+VV LAIN+GIS PGMS SLAYFDTYRR 
Sbjct  389  KKAYDRNPDLANLLMDPEFATEMVERQGAWRKVVTLAINAGISTPGMSASLAYFDTYRRS  448

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRDYFGAHTYER+D  G FH+EW
Sbjct  449  RLPANLVQAQRDYFGAHTYERVDQSGWFHSEW  480


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 6/57 (11%)
 Frame = -3

Query  894  IFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            IF +KDDK DG LVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  246  IFSVKDDKGDGELVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  302



>gb|ADG38361.1| AT3G02360-like protein [Capsella grandiflora]
Length=187

 Score =   344 bits (883),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  809  WTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLID  630
            WTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GDILTDQ  DKKQLID
Sbjct  1    WTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTDQTXDKKQLID  60

Query  629  DVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYD  450
            DVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRIK+AYD
Sbjct  61   DVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYD  120

Query  449  RNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPAN  270
            RN DLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE LPAN
Sbjct  121  RNADLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPAN  180

Query  269  LVQAQRD  249
            LVQAQRD
Sbjct  181  LVQAQRD  187



>ref|XP_001785214.1| predicted protein [Physcomitrella patens]
 gb|EDQ49993.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   355 bits (912),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVA PT+A+SLD RFLSGLK+ERV+A+KVFKS G+ D+LT+  VDK
Sbjct  266  KGTGKWTVQQAAELSVACPTVATSLDLRFLSGLKEERVEASKVFKSLGVSDLLTEVKVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LID+VRKALYASKICSYAQGMNL+RAKS E+GW L LGELARIWKGGCIIRA FLDRI
Sbjct  326  QELIDNVRKALYASKICSYAQGMNLIRAKSAEKGWNLDLGELARIWKGGCIIRAKFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K+AYDRNP LASLL+D EFAKE++ERQSAWR+VV LAI  G+S PGMS SLAYFDTYRR 
Sbjct  386  KQAYDRNPKLASLLIDPEFAKEMVERQSAWRKVVSLAIEVGVSTPGMSASLAYFDTYRRA  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQ+QRDYFG+HTYER+DM  ++HTEW+
Sbjct  446  RLPANLVQSQRDYFGSHTYERVDMNDAYHTEWY  478


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF + DDKA+G LVDKVLDKTGMKGTG+       + S +C  ++ S +  F++G K
Sbjct  242  DIFSVPDDKAEGELVDKVLDKTGMKGTGKWTVQQAAELSVACPTVATSLDLRFLSGLK  299



>gb|AEN81732.1| AT3G02360-like protein, partial [Capsella rubella]
 gb|AEN81734.1| AT3G02360-like protein, partial [Capsella rubella]
 gb|AEN81737.1| AT3G02360-like protein, partial [Capsella rubella]
Length=186

 Score =   344 bits (882),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -1

Query  809  WTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLID  630
            WTVQQAAELSV APTI SSLD+RFLSGLKDERVQAAKVFK+ G GD+LTDQ VDKKQLID
Sbjct  1    WTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDVLTDQTVDKKQLID  60

Query  629  DVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYD  450
            DVRKALYASKICSYAQGMNL+RAKS+E+GWGLKLGELARIWKGGCIIRAIFLDRIK+AYD
Sbjct  61   DVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYD  120

Query  449  RNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPAN  270
            RN DLA+LLVD EFAKEIIERQSAWRRVVCLAINSGIS PGMS SLAYFD+YRRE LPAN
Sbjct  121  RNADLANLLVDPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPAN  180

Query  269  LVQAQR  252
            LVQAQR
Sbjct  181  LVQAQR  186



>gb|EMT22120.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=595

 Score =   358 bits (919),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 192/213 (90%), Gaps = 4/213 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV A+K+F+    GD  + + V+K
Sbjct  380  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVAASKIFQ----GDYSSGETVNK  435

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVRKALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRA FLDRI
Sbjct  436  AQLIEDVRKALYASKICSYAQGMNIIKAKSTEKGWGLNLGELARIWKGGCIIRASFLDRI  495

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LA+LL+D EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  496  KKAYDRNGELANLLIDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  555

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYER+DMPGSFHTEW+
Sbjct  556  RLPANLVQAQRDYFGAHTYERVDMPGSFHTEWY  588


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  356  DIFSIKDDQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  413



>ref|XP_011080880.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Sesamum indicum]
Length=488

 Score =   352 bits (903),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD-QAVD  648
            +  GKWTVQQAAELS+AAPTIA+SLDSR++SGLK+ER +AA++FK  G+ + + +  AVD
Sbjct  267  KGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLKEEREEAAEIFKKEGLKEEINNVSAVD  326

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GWGL LGELARIWKGGCIIRA+FLDR
Sbjct  327  KKRLIDDVRQALYASKICSYAQGMNLLRAKSMEKGWGLNLGELARIWKGGCIIRAVFLDR  386

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AY RNP LA+LLVD EFA+E+++RQ+AWRRVV LAI  GISVPGMS SL YFDTYRR
Sbjct  387  IKQAYQRNPGLANLLVDPEFAREMVQRQAAWRRVVGLAIQKGISVPGMSASLQYFDTYRR  446

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANLVQAQRDYFGAHTYERID PGS+HTEW
Sbjct  447  GRLPANLVQAQRDYFGAHTYERIDRPGSYHTEW  479



>gb|KDO38968.1| hypothetical protein CISIN_1g011394mg [Citrus sinensis]
Length=474

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 188/213 (88%), Gaps = 14/213 (7%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTI             +ERV+AAKVFKS G G + ++QAVDK
Sbjct  268  KGTGKWTVQQAADLSVAAPTI-------------EERVEAAKVFKSGGFG-VQSNQAVDK  313

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            ++LIDDVR+ALYASKICSYAQGMNL+RAKSIE+GW LKLGELARIWKGGCIIRA+FLDRI
Sbjct  314  QKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELARIWKGGCIIRAVFLDRI  373

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEI++RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  374  KKAYDRNADLANLLVDPEFAKEIVDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  433

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEWF  186
             LPANLVQAQRDYFGAHTYERIDM GSFHTEWF
Sbjct  434  RLPANLVQAQRDYFGAHTYERIDMEGSFHTEWF  466


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ  811
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+
Sbjct  244  DIFGIKDDKGDGYLVDKVLDKTGMKGTGK  272



>gb|KHN16764.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=231

 Score =   342 bits (877),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 186/215 (87%), Gaps = 3/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL---TDQA  654
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLK+ER  AA V K AG+ D L   +   
Sbjct  2    KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKEERESAAAVLKEAGLSDELGRVSVSG  61

Query  653  VDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFL  474
            VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA+FL
Sbjct  62   VDKKRLIDDVRQALYASKICSYAQGMNLLRAKSNEKGWNLNLGELARIWKGGCIIRAVFL  121

Query  473  DRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTY  294
            DRIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTY
Sbjct  122  DRIKKAYQRNPNLASLIVDPEFAREMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTY  181

Query  293  RRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            RR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  182  RRARLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  216



>emb|CDP12110.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 187/213 (88%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD-QAVD  648
            +  GKWTVQQAAELS+AAPTIA+SLDSR+LSGLKDER  AA++FK  G  + + +   VD
Sbjct  268  KGTGKWTVQQAAELSIAAPTIAASLDSRYLSGLKDEREAAAEIFKGQGFKEEINNVGVVD  327

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLDR
Sbjct  328  KKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVFLDR  387

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAY RNP LA+LLVD EFA+E+++RQ+AWRRVV LAI  GISVPGMS SL YFDTYRR
Sbjct  388  IKKAYQRNPALANLLVDPEFAREMVQRQAAWRRVVGLAIQKGISVPGMSASLQYFDTYRR  447

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANLVQAQRDYFGAHTYERID PGS+HTEW
Sbjct  448  ARLPANLVQAQRDYFGAHTYERIDRPGSYHTEW  480



>gb|EMT33408.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=996

 Score =   362 bits (929),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 192/216 (89%), Gaps = 4/216 (2%)
 Frame = -1

Query  836  KRA*RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQ  657
            K   +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV A+K+F+    GD  + +
Sbjct  260  KTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVAASKIFQ----GDYSSGE  315

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             VDK QLI+DVRKALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRA F
Sbjct  316  TVDKAQLIEDVRKALYASKICSYAQGMNIIKAKSTEKGWGLNLGELARIWKGGCIIRASF  375

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAYDRN +LA+LL+D EFA+EI++RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+
Sbjct  376  LDRIKKAYDRNGELANLLIDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSASLAYFDS  435

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR+ LPANLVQAQRDYFGAHTYER+DMPGSFHTEW
Sbjct  436  YRRDRLPANLVQAQRDYFGAHTYERVDMPGSFHTEW  471


 Score = 60.8 bits (146),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFSIKDDQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>gb|KHM99927.1| 6-phosphogluconate dehydrogenase, decarboxylating, partial [Glycine 
soja]
Length=299

 Score =   342 bits (876),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 3/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL---TDQA  654
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLK+ER  AA V K AG+ D L       
Sbjct  70   KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKEERESAAAVLKEAGLSDELGRVNVSG  129

Query  653  VDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFL  474
            VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA+FL
Sbjct  130  VDKKRLIDDVRQALYASKICSYAQGMNLLRAKSNEKGWNLNLGELARIWKGGCIIRAVFL  189

Query  473  DRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTY  294
            DRIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTY
Sbjct  190  DRIKKAYQRNPNLASLIVDPEFAREMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTY  249

Query  293  RRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            RR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  250  RRARLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  284


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = -3

Query  909  KSQLDIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTG  748
            K  ++IF +KD+  +G+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G
Sbjct  42   KITVNIFKVKDEDGEGFLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDCRYLSG  101

Query  747  FKIP*WIEGREGSSC  703
             K     E RE ++ 
Sbjct  102  LK-----EERESAAA  111



>ref|XP_004252580.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Solanum lycopersicum]
Length=496

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 190/217 (88%), Gaps = 5/217 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-----GDILTD  660
            +  GKWTVQQAAELS+AAPTIA+SLDSR++SGLKDERV+A+++F+  G+      DI   
Sbjct  271  KGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLKDERVEASEIFRKEGLKEEISSDINGI  330

Query  659  QAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAI  480
             +VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGE+ARIWKGGCIIRA+
Sbjct  331  SSVDKKRLIDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNLGEMARIWKGGCIIRAV  390

Query  479  FLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFD  300
            FLDRIKKAY RNP+LA+L+VD EFA+E+++RQ+AWRRVV LA+  GISVPGMS SL YFD
Sbjct  391  FLDRIKKAYQRNPNLANLMVDTEFAREMVQRQAAWRRVVGLAVQKGISVPGMSASLQYFD  450

Query  299  TYRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            TYRR  LPANLVQAQRDYFGAHTYER+D PG++HTEW
Sbjct  451  TYRRSRLPANLVQAQRDYFGAHTYERVDKPGAYHTEW  487



>gb|EYU40043.1| hypothetical protein MIMGU_mgv1a019477mg [Erythranthe guttata]
Length=460

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQA-VD  648
            +  GKWTVQQAAELS+AAPTIA+SLDSR++SGLK+ER  A+++FK+ G+ + + +   VD
Sbjct  239  KGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLKEEREAASEIFKNEGLKEEIENVGDVD  298

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GWGL LGELARIWKGGCIIRA+FLDR
Sbjct  299  KKRLIDDVRQALYASKICSYAQGMNLLRAKSMEKGWGLNLGELARIWKGGCIIRAVFLDR  358

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AY RNP LA+LLVD EFA+E+++RQSAWRRVV +AI  G+SVPGMS SL YFDTYRR
Sbjct  359  IKQAYQRNPGLANLLVDPEFAREMVQRQSAWRRVVGVAIQKGVSVPGMSASLQYFDTYRR  418

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANLVQAQRDYFGAHTYERID+PG++HTEW
Sbjct  419  GRLPANLVQAQRDYFGAHTYERIDLPGAYHTEW  451



>ref|NP_001104910.1| NADPH producing dehydrogenase of the oxidative pentose phosphate 
pathway [Zea mays]
 gb|AAC27702.1| putative cytosolic 6-phosphogluconate dehydrogenase [Zea mays]
Length=484

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 186/205 (91%), Gaps = 4/205 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV+A+K+F+    GD  T   VDK
Sbjct  264  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVEASKIFQ----GDYSTGLPVDK  319

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR+ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRAIFLDRI
Sbjct  320  AQLIEDVRQALYASKICSYAQGMNIIKAKSSEKGWGLNLGELARIWKGGCIIRAIFLDRI  379

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNP+LA+LLVD EFA+EII+RQ+AWRRVVCLAIN+G+S PGMS SLAYFD+YRR+
Sbjct  380  KKAYDRNPNLANLLVDPEFAQEIIDRQAAWRRVVCLAINNGVSTPGMSASLAYFDSYRRD  439

Query  284  NLPANLVQAQRDYFGAHTYERIDMP  210
             LPANLVQAQRDYFGAHTYER+DMP
Sbjct  440  RLPANLVQAQRDYFGAHTYERVDMP  464


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  240  DIFGIKDDKGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  297



>gb|KDP25346.1| hypothetical protein JCGZ_20502 [Jatropha curcas]
Length=492

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLDSR+LSGLK+ER  AA+V K AG+ + +      +
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLKEERENAAEVLKEAGLKEEVGAIKSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERIDMPG+FHTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERIDMPGAFHTEW  480


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S ++ +++G K
Sbjct  243  DIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLK  300



>gb|KJB52237.1| hypothetical protein B456_008G251800 [Gossypium raimondii]
Length=383

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA+V K AG+ + +    + +
Sbjct  155  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAEVLKEAGLKEEVGSLAKGI  214

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  215  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNFGELARIWKGGCIIRAVFLD  274

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  275  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  334

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  335  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  368


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD +DG+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  131  DIFRVKDDLSDGFLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  188



>gb|EMS57148.1| 6-phosphogluconate dehydrogenase, decarboxylating [Triticum urartu]
Length=480

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 186/204 (91%), Gaps = 4/204 (2%)
 Frame = -1

Query  797  QAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLIDDVRK  618
            Q+AELSVAAPTI +SLDSRFLSGLKDERV A+K+F+    GD  + + VDK QLI+DVRK
Sbjct  274  QSAELSVAAPTIEASLDSRFLSGLKDERVAASKIFQ----GDYSSGETVDKAQLIEDVRK  329

Query  617  ALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYDRNPD  438
            ALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRA FLDRIKKAYDRN +
Sbjct  330  ALYASKICSYAQGMNIIKAKSTEKGWGLNLGELARIWKGGCIIRASFLDRIKKAYDRNGE  389

Query  437  LASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPANLVQA  258
            LA+LL+D EFA+EI++RQ+AWRRVVCLAIN+G+S PGMSTSLAYFD+YRR+ LPANLVQA
Sbjct  390  LANLLIDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSTSLAYFDSYRRDRLPANLVQA  449

Query  257  QRDYFGAHTYERIDMPGSFHTEWF  186
            QRDYFGAHTYER+DMPGSFHTEW+
Sbjct  450  QRDYFGAHTYERVDMPGSFHTEWY  473



>ref|XP_011073556.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Sesamum indicum]
Length=488

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 187/213 (88%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIG-DILTDQAVD  648
            +  GKWTVQQAAELS+AAPTIA+SLD R++SGLK+ER  AA++FK  G+  DI    AVD
Sbjct  267  KGTGKWTVQQAAELSIAAPTIAASLDCRYMSGLKEEREAAAEIFKEEGLKEDINNVGAVD  326

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+ WGL LGELARIWKGGCIIRA+FLDR
Sbjct  327  KKRLIDDVRQALYASKICSYAQGMNLLRAKSMEKVWGLNLGELARIWKGGCIIRAVFLDR  386

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AY RNP LA+LLVD EFAKE+++RQ+AWRRVV LAI  GISVPGMS SL YFDTYRR
Sbjct  387  IKQAYQRNPGLANLLVDPEFAKEMVQRQAAWRRVVGLAIQKGISVPGMSASLQYFDTYRR  446

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANLVQAQRDYFGAHTYERID PGS+HTEW
Sbjct  447  GRLPANLVQAQRDYFGAHTYERIDRPGSYHTEW  479



>ref|XP_010545301.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Tarenaya hassleriana]
Length=491

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AAKV   AG+ + +    + +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAKVLNEAGLKEEIGSASRGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNLGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID+PGS+HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDLPGSYHTEW  479


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  300  ---EERENAA  306



>ref|XP_009626290.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nicotiana tomentosiformis]
Length=495

 Score =   347 bits (889),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 188/216 (87%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILT----DQ  657
            +  GKWTVQQAAELS+AAPTIA+SLDSR++SGLK+ER  AA++FK  G+ + +       
Sbjct  271  KGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLKEEREDAARIFKKEGLKEEINFDVNGS  330

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            +VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGE+ARIWKGGCIIRA+F
Sbjct  331  SVDKKRLIDDVRQALYASKICSYAQGMNLLRAKSAEKGWNLNLGEMARIWKGGCIIRAVF  390

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY RNP LA+L+VD EFA+E+++RQ+AWRRVV LAI  GISVPGMS SL YFDT
Sbjct  391  LDRIKKAYQRNPGLANLMVDPEFAREMVQRQAAWRRVVGLAIQRGISVPGMSASLQYFDT  450

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYER+DMPG++HTEW
Sbjct  451  YRRSRLPANLVQAQRDYFGAHTYERVDMPGAYHTEW  486



>ref|XP_009789896.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Nicotiana sylvestris]
Length=495

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 187/216 (87%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILT----DQ  657
            +  GKWTVQQAAELS+AAPTIA+SLDSR++SGLK+ER  AA +FK  G+ + +       
Sbjct  271  KGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLKEEREDAAGIFKKEGLKEEINFDVNGS  330

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            +VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGE+ARIWKGGCIIRA+F
Sbjct  331  SVDKKRLIDDVRQALYASKICSYAQGMNLLRAKSAEKGWNLNLGEMARIWKGGCIIRAVF  390

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY RNP LA+L+VD EFA+E+++RQ+AWRRVV LAI  GISVPGMS SL YFDT
Sbjct  391  LDRIKKAYQRNPGLANLMVDTEFAREMVQRQAAWRRVVGLAIQRGISVPGMSASLQYFDT  450

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYERIDMPG++HTEW
Sbjct  451  YRRSRLPANLVQAQRDYFGAHTYERIDMPGAYHTEW  486



>ref|XP_007032950.1| 6-phosphogluconate dehydrogenase family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY03876.1| 6-phosphogluconate dehydrogenase family protein isoform 3, partial 
[Theobroma cacao]
Length=476

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIA+SLDSRFLSGLK+ERV+AAKVFKS G+GD+LT+Q VDK
Sbjct  285  KGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEAAKVFKSGGLGDVLTEQTVDK  344

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             +LIDDVR+ALYASKICSYAQGMNL+R KSIE+GW LKLGELARIWKGGCIIRAIFLDRI
Sbjct  345  ARLIDDVRQALYASKICSYAQGMNLIREKSIEKGWDLKLGELARIWKGGCIIRAIFLDRI  404

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRNPDLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS+SLAYFDTYRRE
Sbjct  405  KKAYDRNPDLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSSSLAYFDTYRRE  464

Query  284  NLPANLVQAQRD  249
             +PAN+VQAQRD
Sbjct  465  RVPANMVQAQRD  476


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFGIKDDK DGYLVDKVLDKTGMKGTG+       D S +   ++ S ++ F++G K
Sbjct  261  DIFGIKDDKGDGYLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLK  318



>ref|XP_009386035.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIG--DILTDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAK    AGIG  D ++ ++V
Sbjct  268  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDEREAAAKALDQAGIGSGDFISGRSV  327

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA FLD
Sbjct  328  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSAEKGWNLNLGELARIWKGGCIIRARFLD  387

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY+RN  LA+L+VD EFA+E+++RQ+AWRRVV LAI +GIS PGM  SLAYFDTYR
Sbjct  388  RIKKAYERNRGLANLIVDPEFAREMVQRQAAWRRVVGLAIEAGISTPGMCASLAYFDTYR  447

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRDYFGAHTYER+D PGSFHTEW
Sbjct  448  RARLPANLVQAQRDYFGAHTYERVDRPGSFHTEW  481


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIFG++D+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  244  DIFGVRDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  301



>ref|XP_006856410.1| hypothetical protein AMTR_s00047p00215210 [Amborella trichopoda]
 gb|ERN17877.1| hypothetical protein AMTR_s00047p00215210 [Amborella trichopoda]
Length=492

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  A+K F   G+ ++L   AVDK
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREAASKAFSEFGLSEVLARPAVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LI+DVR+ALYASKICSYAQGMNLLRAKS+E+GWGL LGELARIWKGGCIIRA+FLDRI
Sbjct  326  KKLIEDVRQALYASKICSYAQGMNLLRAKSVEKGWGLNLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAY+RN +L +L+VD EFA+E+++RQ+AWRRVV LAI +GIS PGM+ SLAYFD+YRR 
Sbjct  386  KKAYERNRELPNLMVDPEFAREMVQRQAAWRRVVGLAIEAGISTPGMNASLAYFDSYRRA  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRD FGAHTYERID PGS+HTEW
Sbjct  446  RLPANLVQAQRDLFGAHTYERIDRPGSYHTEW  477



>ref|XP_002517676.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF44840.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA+V K AG+ + +      +
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESAAQVLKEAGLKEEVEAVKSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNFGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  480


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  300



>gb|ACF20291.1| 6-phosphogluconate dehydrogenase [Cucumis sativus]
Length=311

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELS+ APTIA+SLD R+LSGLKDER  AA+V K AG+ D +      +
Sbjct  83   KGTGKWTVQQAAELSIVAPTIAASLDCRYLSGLKDERESAAEVLKEAGMTDSVGSVRSGI  142

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LI+DVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  143  DKKKLIEDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNFGELARIWKGGCIIRAVFLD  202

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASLLVD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  203  RIKKAYQRNPNLASLLVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  262

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D  GS+HTEW
Sbjct  263  RARLPANLVQAQRDLFGAHTYERVDRQGSYHTEW  296



>ref|XP_006476447.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006476448.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X2 [Citrus sinensis]
Length=494

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479



>ref|XP_006476449.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X3 [Citrus sinensis]
Length=493

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479



>ref|XP_010436115.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Camelina sativa]
Length=487

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 188/214 (88%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + L+   + V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDLSSASRGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>ref|XP_006439417.1| hypothetical protein CICLE_v10019859mg [Citrus clementina]
 gb|ESR52657.1| hypothetical protein CICLE_v10019859mg [Citrus clementina]
Length=494

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479



>ref|XP_006391659.1| hypothetical protein EUTSA_v10023511mg [Eutrema salsugineum]
 gb|ESQ28945.1| hypothetical protein EUTSA_v10023511mg [Eutrema salsugineum]
Length=391

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  170  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGLKEEIGSASSGI  229

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  230  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNFGELARIWKGGCIIRAVFLD  289

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD +FAKE+++RQ+AWRRVV LA+ +GIS PGM  SLAYFDTYR
Sbjct  290  RIKKAYQRNPDLASLVVDPDFAKEMVQRQAAWRRVVGLAVAAGISTPGMCASLAYFDTYR  349

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PG++HTEW
Sbjct  350  RARLPANLVQAQRDLFGAHTYERIDRPGAYHTEW  383



>ref|XP_002886358.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62617.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>ref|XP_010473675.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Camelina sativa]
Length=487

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV K AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLKEAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>ref|XP_007040418.1| 6-phosphogluconate dehydrogenase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY24919.1| 6-phosphogluconate dehydrogenase family protein isoform 2 [Theobroma 
cacao]
Length=492

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA V K AG+ + +    Q +
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAGVLKEAGLKEEVGSLAQGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG+FHTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERTDRPGAFHTEW  480


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DGYLVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFRVKDELEDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  300



>ref|XP_010418473.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Camelina sativa]
Length=487

 Score =   342 bits (877),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV K AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLKEAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>ref|XP_003533072.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Glycine max]
Length=495

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 186/215 (87%), Gaps = 3/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL---TDQA  654
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLK+ER  AA V K AG+ D L   +   
Sbjct  266  KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKEERESAAAVLKEAGLSDELGRVSVSG  325

Query  653  VDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFL  474
            VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA+FL
Sbjct  326  VDKKRLIDDVRQALYASKICSYAQGMNLLRAKSNEKGWNLNLGELARIWKGGCIIRAVFL  385

Query  473  DRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTY  294
            DRIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTY
Sbjct  386  DRIKKAYQRNPNLASLIVDPEFAREMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTY  445

Query  293  RRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            RR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  446  RRARLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  480


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  +G+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDEDGEGFLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSSC  703
               E RE ++ 
Sbjct  300  ---EERESAAA  307



>gb|KDO76416.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=505

 Score =   342 bits (878),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479



>gb|KDO76417.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=505

 Score =   342 bits (878),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479



>gb|KEH21177.1| decarboxylating-like 6-phosphogluconate dehydrogenase [Medicago 
truncatula]
Length=495

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL---TDQA  654
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA V K AG+G+ +       
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAAVLKEAGLGEEVGGFVRSG  325

Query  653  VDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFL  474
            VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FL
Sbjct  326  VDKKRLIDDVRQALYASKICSYAQGMNLLRAKSDEKGWNLNFGELARIWKGGCIIRAVFL  385

Query  473  DRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTY  294
            DRIKKAY RNP+LASL+VD EFAKE+++RQ AWRRVV LAI++GIS PGM  SLAYFDTY
Sbjct  386  DRIKKAYQRNPNLASLIVDPEFAKEMVQRQGAWRRVVGLAISAGISTPGMCASLAYFDTY  445

Query  293  RRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            RR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  446  RRARLPANLVQAQRDLFGAHTYERLDRPGAFHTEW  480


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  DGYLVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDEGGDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSSC  703
               E RE ++ 
Sbjct  300  ---EERENAAA  307



>gb|KDO76415.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=503

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAAKVLKEAGLKDEVQNVGVHV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSNEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479



>ref|XP_002275970.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Vitis vinifera]
Length=494

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA V   AG+ D +      V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREAAAGVLSEAGLKDEVGFARSGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLIVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  300  ---EEREAAA  306



>emb|CAN63456.1| hypothetical protein VITISV_008240 [Vitis vinifera]
Length=494

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA V   AG+ D +      V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREAAAGVLSEAGLKDEVGFARSGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLIVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  479


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  300  ---EEREAAA  306



>ref|XP_006391656.1| hypothetical protein EUTSA_v10023427mg [Eutrema salsugineum]
 gb|ESQ28942.1| hypothetical protein EUTSA_v10023427mg [Eutrema salsugineum]
Length=487

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD +FAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPDFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERIDRPGAYHTEW  479



>ref|XP_008451978.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Cucumis melo]
Length=495

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLK+ER  AA+V K AG+ DI+      +
Sbjct  267  KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKEERESAAEVLKEAGMTDIVGSVRSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LI+DVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKKKLIEDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASLLVD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLLVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D  GS+HTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERVDRQGSYHTEW  480


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFKVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLK  300



>ref|XP_003525354.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Glycine max]
Length=495

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 3/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL---TDQA  654
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLK+ER  AA V K AG+ D L       
Sbjct  266  KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKEERESAAAVLKEAGLSDELGRVNVSG  325

Query  653  VDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFL  474
            VDKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA+FL
Sbjct  326  VDKKRLIDDVRQALYASKICSYAQGMNLLRAKSNEKGWNLNLGELARIWKGGCIIRAVFL  385

Query  473  DRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTY  294
            DRIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTY
Sbjct  386  DRIKKAYQRNPNLASLIVDPEFAREMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTY  445

Query  293  RRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            RR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  446  RRARLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  480


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  +G+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDEDGEGFLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSSC  703
               E RE ++ 
Sbjct  300  ---EERESAAA  307



>ref|XP_006286028.1| hypothetical protein CARUB_v10007559mg [Capsella rubella]
 gb|EOA18926.1| hypothetical protein CARUB_v10007559mg [Capsella rubella]
Length=476

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +    + V
Sbjct  255  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGV  314

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  315  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  374

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ AWRRVV LAI++GIS PGM +SLAYFDTYR
Sbjct  375  RIKKAYQRNPNLASLVVDPDFAKEMVQRQVAWRRVVGLAISAGISTPGMCSSLAYFDTYR  434

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  435  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  468


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  231  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  288



>ref|XP_007040417.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24918.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA V K AG+ + +    Q +
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAGVLKEAGLKEEVGSLAQGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG+FHTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERTDRPGAFHTEW  480


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DGYLVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFRVKDELEDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  300



>ref|XP_008805334.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 1, chloroplastic-like [Phoenix dactylifera]
Length=495

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 185/216 (86%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGD----ILTDQ  657
            +  GKWTVQQAAELSVAAPTIASSLDSR+LSGLK+ER  AA+V   AGIG      L  +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIASSLDSRYLSGLKEEREAAARVLDEAGIGGEVSGPLLGR  325

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             +DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA F
Sbjct  326  TIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSEEKGWNLNLGELARIWKGGCIIRARF  385

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY+RN  LA+L+VD EFA+E+++RQ AWRRVV LAI +GIS PGM +SLAYFDT
Sbjct  386  LDRIKKAYERNRRLANLIVDPEFAREMVQRQGAWRRVVGLAIEAGISTPGMCSSLAYFDT  445

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYER+D PGSFHTEW
Sbjct  446  YRRARLPANLVQAQRDYFGAHTYERVDRPGSFHTEW  481



>ref|NP_198982.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 ref|NP_851113.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 sp|Q9FFR3.1|6PGD2_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Arabidopsis thaliana]
 dbj|BAB11473.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AAM78095.1| AT5g41670/MBK23_20 [Arabidopsis thaliana]
 gb|AAN72272.1| At5g41670/MBK23_20 [Arabidopsis thaliana]
 gb|AED94705.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 gb|AED94706.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
Length=487

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +    + V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>gb|KFK36587.1| hypothetical protein AALP_AA4G143200 [Arabis alpina]
Length=488

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 182/214 (85%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDERV A KV + AG+ D +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERVNAEKVLREAGMKDEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS+E+ W L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKSWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ AWRRVV LA+ +GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQGAWRRVVGLAVAAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>emb|CDY39725.1| BnaA04g11280D [Brassica napus]
Length=487

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +    + +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+ WGL LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKEWGLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>ref|XP_006301732.1| hypothetical protein CARUB_v10022193mg [Capsella rubella]
 gb|EOA34630.1| hypothetical protein CARUB_v10022193mg [Capsella rubella]
Length=487

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGMKEEIGTASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDFGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>ref|XP_011022562.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Populus euphratica]
Length=494

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA++ K AG+ + +      V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESAAEILKEAGLEEEVGSVKSGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVRKALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRKALYASKICSYAQGMNLLRAKSVEKGWDLDFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG+FHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAFHTEW  479



>ref|XP_002304540.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE79519.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=492

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA++ K AG+ + +      V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESAAEILKEAGLEEEVGSVKSGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVRKALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRKALYASKICSYAQGMNLLRAKSVEKGWDLDFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG+FHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAFHTEW  479



>ref|XP_010441331.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Camelina sativa]
Length=487

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +    + V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPSLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>ref|XP_006360699.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Solanum tuberosum]
Length=495

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 187/216 (87%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAG----IGDILTDQ  657
            +  GKWTVQQAAELS+AAPTIA+SLDSR++SGLKDER +A+++F+  G    I   +   
Sbjct  271  KGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLKDEREEASEIFRKEGLKEEISSDINGS  330

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            ++DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGE+ARIWKGGCIIRA+F
Sbjct  331  SLDKKRLIDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNLGEMARIWKGGCIIRAVF  390

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY RNP+LA+L+VD EFA+E+++RQ+AWRRVV LA+  GISVPGMS SL YFDT
Sbjct  391  LDRIKKAYQRNPNLANLMVDPEFAREMVQRQAAWRRVVGLAVQKGISVPGMSASLQYFDT  450

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYER+D  G++HTEW
Sbjct  451  YRRSRLPANLVQAQRDYFGAHTYERVDKSGAYHTEW  486



>ref|NP_176601.1| 6-phosphogluconate dehydrogenase, decarboxylating 1 [Arabidopsis 
thaliana]
 sp|Q9SH69.1|6PGD1_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Arabidopsis thaliana]
 gb|AAF24560.1|AC007764_2 F22C12.5 [Arabidopsis thaliana]
 gb|AAO42814.1| At1g64190 [Arabidopsis thaliana]
 dbj|BAE99587.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AEE34207.1| 6-phosphogluconate dehydrogenase, decarboxylating 1 [Arabidopsis 
thaliana]
Length=487

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS+E+ W L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKSWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>emb|CDY44457.1| BnaCnng11100D [Brassica napus]
Length=487

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV K AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLKEAGLKEDIGSASHGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+ W L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKEWNLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>ref|XP_002868582.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44841.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AA+V + AG+ + +    + V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAARVLEDAGLKEDIGSASRGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>sp|Q94KU2.1|6PGD2_SPIOL RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic; Flags: Precursor [Spinacia oleracea]
 gb|AAK49897.1|AF295670_1 plastidic 6-phosphogluconate dehydrogenase [Spinacia oleracea]
Length=537

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AAK+ ++AG+ + +      V
Sbjct  308  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAKILEAAGMKEEVNAIRGGV  367

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E GW L LGELARIWKGGCIIRA+FLD
Sbjct  368  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSAEMGWDLNLGELARIWKGGCIIRAVFLD  427

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
             IK+AY RNP+LASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  428  SIKQAYQRNPNLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  487

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRDYFGAHTYER+D+PGS+HTEW
Sbjct  488  RARLPANLVQAQRDYFGAHTYERVDLPGSYHTEW  521


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KDD ADG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  284  DIFKVKDDLADGGLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  341

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  342  ---EERENAA  348



>ref|XP_008811378.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Phoenix dactylifera]
Length=496

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 187/216 (87%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD----Q  657
            +  GKWTVQQAAELSVAAPTIA+SLDSR+LSGLK+ER  AA+V   AGIG  ++     +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLKEEREAAARVLDQAGIGSEVSGSSLGR  325

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            +++KK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA F
Sbjct  326  SINKKRLIDDVRQALYASKICSYAQGMNLLRAKSEEKGWNLNLGELARIWKGGCIIRARF  385

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY+RN  LA+L+VD EFA+E+++RQ AWRRVV LAI +GIS PGM +SLAYFDT
Sbjct  386  LDRIKKAYERNRGLANLIVDPEFAREMVQRQGAWRRVVGLAIEAGISTPGMCSSLAYFDT  445

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYERID PGSFHTEW
Sbjct  446  YRRARLPANLVQAQRDYFGAHTYERIDHPGSFHTEW  481


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF + D+  +G LVDK+LDKTGMKGTG+       + S +   ++ S ++ +++G K  
Sbjct  242  DIFRVPDEHGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLK--  299

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  300  ---EEREAAA  306



>ref|XP_004503648.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Cicer arietinum]
Length=494

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDI--LTDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  A+ V K AG+ +        +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENASAVLKEAGLNEEAGFVKSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSDEKGWNLNLGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFAKE+++RQ AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLIVDPEFAKEMVQRQGAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERLDRPGAFHTEW  479


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KDD  DGYLVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDDIGDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSSC  703
               E RE +S 
Sbjct  300  ---EERENASA  307



>ref|XP_002509902.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF51289.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   340 bits (871),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA+V K AG+ + +      +
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESAAEVLKEAGLKEEVGTVKSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+ W L  GELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKRWNLNFGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  480


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  300



>gb|AFF18855.1| 6-phosphogluconate dehydrogenase, partial [Dimocarpus longan]
Length=191

 Score =   329 bits (843),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAA+LSVAAPTIASSLD+RFLSGLK+ERV+AAKVFKS G GDIL+DQAVDK
Sbjct  9    KGTGKWTVQQAADLSVAAPTIASSLDARFLSGLKEERVEAAKVFKSGGFGDILSDQAVDK  68

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNL+RAKS+E+GW L+LGELARIWKGGCIIRA+FLDRI
Sbjct  69   KKLIDDVRQALYASKICSYAQGMNLIRAKSVEKGWNLRLGELARIWKGGCIIRAVFLDRI  128

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN DLA+LLVD EFAKEII+RQSAWRRVVCLAINSGIS PGMS+SLAYFD+YRRE
Sbjct  129  KKAYDRNSDLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGISTPGMSSSLAYFDSYRRE  188

Query  284  NLP  276
             LP
Sbjct  189  RLP  191



>ref|XP_004168459.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
Length=495

 Score =   340 bits (871),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLKDER  AA+V K AG+ D +      +
Sbjct  267  KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKDERESAAEVLKEAGMTDSVGSVRSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LI+DVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  327  DKKKLIEDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNFGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASLLVD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLLVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D  GS+HTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERVDRQGSYHTEW  480


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFKVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLK  300



>ref|XP_009140108.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Brassica rapa]
Length=487

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AAKV + AG+ + +    + +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAKVLEEAGLKEDIGSASRGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+ WGL LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKEWGLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>ref|XP_010273961.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
 ref|XP_010273962.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
 ref|XP_010273963.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
Length=518

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAEL VAAPTIA+SLD R+LSGLK+ER  A+ V + AG+ + +      +
Sbjct  267  KGTGKWTVQQAAELMVAAPTIAASLDCRYLSGLKEEREAASDVLREAGMREDVGAVRSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLTLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP LASLLVD EFA+EI++RQ+AWRRVV LAI +GIS PGMS SL+YFDTYR
Sbjct  387  RIKKAYQRNPQLASLLVDPEFAREIVQRQAAWRRVVGLAIAAGISTPGMSASLSYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGSFHTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERIDRPGSFHTEW  480



>ref|XP_004149760.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 gb|KGN53379.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cucumis sativus]
Length=495

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELS+AAPTIA+SLD R+LSGLKDER  AA+V K AG+ D +      +
Sbjct  267  KGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLKDERESAAEVLKEAGMTDSVGSVRSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LI+DVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  327  DKKKLIEDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNFGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASLLVD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLLVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D  GS+HTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERVDRQGSYHTEW  480


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFKVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDCRYLSGLK  300



>ref|XP_006849590.1| hypothetical protein AMTR_s00024p00196750 [Amborella trichopoda]
 gb|ERN11171.1| hypothetical protein AMTR_s00024p00196750 [Amborella trichopoda]
Length=492

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVA+PTIA+SLD R+LSGLK+ER  A+K F   G+ ++L   AV+K
Sbjct  266  KGTGKWTVQQAAELSVASPTIAASLDCRYLSGLKEEREVASKAFSEFGLSEVLARPAVEK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LI+DVR+ALYASKICSYAQGMNLLRAKSIE+GWGL LGELARIWKGGCIIRA+FLDRI
Sbjct  326  KKLIEDVRQALYASKICSYAQGMNLLRAKSIEKGWGLNLGELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAY+RN  L +L+VD EFA+E+++RQ+AWRRVV LAI +GIS PGM+ SLAYFD+YRR 
Sbjct  386  KKAYERNLALPNLMVDPEFAREMVQRQAAWRRVVGLAIEAGISTPGMNASLAYFDSYRRG  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRD FGAHTYERID PGS+HTEW
Sbjct  446  RLPANLVQAQRDLFGAHTYERIDRPGSYHTEW  477



>ref|XP_010676957.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AAKV ++AG+ + +      V
Sbjct  353  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERENAAKVLEAAGMKEEVNAVRGGV  412

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  413  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSSEKGWDLNLGELARIWKGGCIIRAVFLD  472

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
             IKKAY RNP+LASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  473  TIKKAYQRNPNLASLIVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  532

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRDYFGAHTYER+D PGS+HTEW
Sbjct  533  RARLPANLVQAQRDYFGAHTYERVDRPGSYHTEW  566


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+ ADG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  329  DIFKVKDELADGGLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  386

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  387  ---EERENAA  393



>ref|XP_010905189.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Elaeis guineensis]
Length=496

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 187/216 (87%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD----Q  657
            +  GKWTVQQAAELSVAAPTIA+SLDSR+LSGLK+ER  AA+V   AGIG  ++     +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLKEEREAAARVLDQAGIGGEVSGASLGR  325

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            ++DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA F
Sbjct  326  SIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSEERGWNLNLGELARIWKGGCIIRARF  385

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY+RN  LA+L+VD EFA+E+++RQ AWRRVV +AI +GIS PGM +SLAYFDT
Sbjct  386  LDRIKKAYERNRVLANLIVDPEFAREMVQRQGAWRRVVGMAIEAGISTPGMCSSLAYFDT  445

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYER+D PGSFHTEW
Sbjct  446  YRRARLPANLVQAQRDYFGAHTYERVDRPGSFHTEW  481


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF + D+  DG LVDK+LDKTGMKGTG+       + S +   ++ S ++ +++G K  
Sbjct  242  DIFRVPDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLK--  299

Query  735  *WIEGREGSS  706
               E RE ++
Sbjct  300  ---EEREAAA  306



>ref|XP_010261979.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Nelumbo nucifera]
Length=495

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDI--LTDQAV  651
            +  GKWTVQQAAEL VAAPTIA+SLD R+LSGLK+ER  A++V K AG+ +        +
Sbjct  267  KGTGKWTVQQAAELMVAAPTIAASLDCRYLSGLKEEREAASEVLKEAGMREDAGTVRNGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP LA+LLVD EFA+EI++RQ+AWRRVV LAI +GIS PGMS SL+YFDTYR
Sbjct  387  RIKKAYQRNPHLANLLVDPEFAREIVQRQAAWRRVVGLAIAAGISTPGMSASLSYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PGS+HTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERIDRPGSYHTEW  480



>ref|XP_010430539.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Camelina sativa]
Length=487

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV K AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLKEAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSSEKGWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD +FAK +++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPDFAKGMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479



>gb|ACM68927.1| 6-phosphogluconate dehydrogenase [Cucumis sativus]
Length=495

 Score =   338 bits (866),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELS+ APTIA+SLD R+LSGLKDER  AA+V K AG+ D +      +
Sbjct  267  KGTGKWTVQQAAELSIVAPTIAASLDCRYLSGLKDERESAAEVLKEAGMTDSVGSVRSGI  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LI+DVR+ALYASKICSYAQGMNLLRAKS+E+GW L  GELARIWKGGCIIRA+FLD
Sbjct  327  DKKKLIEDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNFGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASLLVD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  387  RIKKAYQRNPNLASLLVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D  GS+HTEW
Sbjct  447  RARLPANLVQAQRDLFGAHTYERVDRQGSYHTEW  480



>ref|XP_002297992.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE82797.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=494

 Score =   337 bits (864),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA++ + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESAAEILEKAGLKEEMGSVKSEI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSVEKGWDLNLGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPSLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG+FHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAFHTEW  479


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD ADG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFKVKDDLADGDLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>ref|XP_010447780.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Camelina sativa]
Length=487

 Score =   337 bits (863),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +    + V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RN  LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNSSLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAYHTEW  479


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>ref|XP_011026944.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Populus euphratica]
Length=494

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD--QAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  AA++ + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESAAEILEKAGLKEEMGSIKSEI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLR+KS+E+GW L LGELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRSKSVEKGWDLNLGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPSLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D PG+FHTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRPGAFHTEW  479


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD ADG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFKVKDDLADGDLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>ref|XP_009112895.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Brassica rapa]
Length=487

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS+E+ W L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKSWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER D  G++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHTYERTDRSGAYHTEW  479



>ref|XP_010105006.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXC02963.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=495

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQ--AV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  A K  + AG+ + +      V
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEERESADKALREAGLKEEVGSAKIGV  326

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DK++LIDDVR+ALYASKICSYAQGMNLLRAKSIE+GW L LGELARIWKGGCIIRA+FLD
Sbjct  327  DKRRLIDDVRQALYASKICSYAQGMNLLRAKSIEKGWNLDLGELARIWKGGCIIRAVFLD  386

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+LASL VD EFAKE+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  387  RIKKAYRRNPNLASLFVDPEFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  446

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID PG FHTEW
Sbjct  447  RSRLPANLVQAQRDLFGAHTYERIDRPGLFHTEW  480


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KD+  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  243  DIFRVKDEHGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  300



>ref|XP_009392493.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=494

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIG--DILTDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER  A+K  + AGIG  D    +++
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREAASKALEQAGIGRGDFSVGRSI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DK++LIDDVR+ALYASKICSYAQGMNLL AKS E+GW L LGELARIWKGGCIIRA FLD
Sbjct  326  DKRRLIDDVRQALYASKICSYAQGMNLLGAKSAEKGWNLNLGELARIWKGGCIIRARFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY+RN  LA+L+VD EFA+E+++RQ+AWRRVV LAI +GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYERNLGLANLIVDPEFAREMVQRQAAWRRVVGLAIEAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRDYFGAHTYER+D PGSFHTEW
Sbjct  446  RARLPANLVQAQRDYFGAHTYERVDRPGSFHTEW  479


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 11/70 (16%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIFG+ D+   G LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K  
Sbjct  242  DIFGVHDEHGGGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK--  299

Query  735  *WIEGREGSS  706
               E RE +S
Sbjct  300  ---EEREAAS  306



>ref|XP_010917535.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Elaeis guineensis]
Length=496

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 184/216 (85%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGD----ILTDQ  657
            +  GKWTVQQAAELSVAAPTIA+SLDSR+LSGLK+ER  AA+V   AGIG         +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDSRYLSGLKEEREAAARVLDQAGIGGEGLGPSLGR  325

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            A+DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS E+GW L LGELARIWKGGCIIRA F
Sbjct  326  AIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSEEKGWNLNLGELARIWKGGCIIRARF  385

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAY+RN  LA+L+VD EFA+E+++RQ AWRRVV LAI +GIS PGM +SLAYFDT
Sbjct  386  LDRIKKAYERNRGLANLIVDPEFAREMVQRQGAWRRVVGLAIEAGISTPGMCSSLAYFDT  445

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRDYFGAHTYER+D  GSFHTEW
Sbjct  446  YRRARLPANLVQAQRDYFGAHTYERVDRSGSFHTEW  481



>ref|XP_007209994.1| hypothetical protein PRUPE_ppa005270mg [Prunus persica]
 gb|EMJ11193.1| hypothetical protein PRUPE_ppa005270mg [Prunus persica]
Length=469

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +A +  K AG  +++      +
Sbjct  241  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAEETLKQAGFKEVIGSVTSGI  300

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GWGL LGELARIWKGGCIIRA+FLD
Sbjct  301  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWGLNLGELARIWKGGCIIRAVFLD  360

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIK AY RN +L +L+VD +FAKE+++RQ+AWRRVV LA+++GIS PGM  SL+YFDTYR
Sbjct  361  RIKNAYQRNQNLPNLIVDPDFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLSYFDTYR  420

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  421  RGRLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  454


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF ++DD ADG+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  217  DIFKVRDDLADGFLVDKLLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  274



>emb|CDY25568.1| BnaC09g11930D [Brassica napus]
Length=487

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +      +
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLREAGLKEEIGSASSGI  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+L+DDVR+ALYASKICSYAQGMNLLRAKS+E+ W L  GELARIWKGGCIIRA+FLD
Sbjct  326  DKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEKSWNLNFGELARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNPDLASL+VD EFAKE+++RQ+AWRRVV LA+++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRVVGLAVSAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAH+YER D  G++HTEW
Sbjct  446  RARLPANLVQAQRDLFGAHSYERTDRSGAYHTEW  479



>ref|XP_011462415.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Fragaria vesca subsp. vesca]
Length=494

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAG----IGDILTDQ  657
            +  GKWTVQQAAELSVAAPTIA+SLD RFLSGLK+ER  A +  K AG    IG++++  
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRFLSGLKEERESAEEALKEAGFKEEIGNVVS--  324

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             +DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+F
Sbjct  325  GIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSMEKGWNLNLGELARIWKGGCIIRAVF  384

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIK AY RN  L +L+VD +FAKE+++RQ+AWRRVV LA+ +GIS PGM  SL+YFDT
Sbjct  385  LDRIKNAYQRNQGLPNLIVDPDFAKEMVQRQAAWRRVVGLAVAAGISTPGMCASLSYFDT  444

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD FGAHTYER+D PGSFHTEW
Sbjct  445  YRRGRLPANLVQAQRDLFGAHTYERVDRPGSFHTEW  480


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD ADG+LVDK+LDKTGMKGTG+       + S +   ++ S +  F++G K
Sbjct  243  DIFKVKDDLADGFLVDKLLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRFLSGLK  300



>gb|AAM61057.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
Length=486

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 185/214 (86%), Gaps = 3/214 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLKDER  AAKV + AG+ + +    + V
Sbjct  266  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKDERENAAKVLEEAGLKEDIGSASRGV  325

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGE+ARIWKGGCIIRA+FLD
Sbjct  326  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWDLNLGEMARIWKGGCIIRAVFLD  385

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RN +LASL+VD +FAKE+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  386  RIKKAYQRNTNLASLVVDPDFAKEMVQRQAAWRRVVGLAISAGISTPGMCASLAYFDTYR  445

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANL QAQRD FGAHTYER D PG++HTEW
Sbjct  446  RARLPANL-QAQRDLFGAHTYERTDRPGAYHTEW  478


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF +KDD  DG LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G K
Sbjct  242  DIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLK  299



>gb|AAP33506.2| cytosolic 6-phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
Length=477

 Score =   330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL++AAPTIA+SLD R+LSGLKDERV AA V K+ G+   +L    VD
Sbjct  253  KGTGKWTVQQAAELAIAAPTIAASLDGRYLSGLKDERVAAAGVLKAEGMPSGLLETINVD  312

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  313  KKMLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRAKFLDR  372

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  373  IKKAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMSASLSYFDTYRC  432

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  433  SRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  465



>ref|XP_006663451.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like, partial [Oryza brachyantha]
Length=409

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V ++ G+   +L    VD
Sbjct  185  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAAGVLEAEGMPSGLLETINVD  244

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  245  KKVLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRAKFLDR  304

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  305  IKKAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMSASLSYFDTYRC  364

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYER+D PGSFHTEW
Sbjct  365  SRLPANLIQAQRDLFGAHTYERVDRPGSFHTEW  397



>gb|EMS56831.1| 6-phosphogluconate dehydrogenase, decarboxylating [Triticum urartu]
Length=359

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 179/213 (84%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIG-DILTDQAVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   +L    VD
Sbjct  139  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAASVLEEEGMPVGLLEKINVD  198

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALY+SK+CSYAQGMNLLRAKS+EQGW L L EL+RIWKGGCIIRA FLDR
Sbjct  199  KKVLVDRVRQALYSSKVCSYAQGMNLLRAKSVEQGWNLNLAELSRIWKGGCIIRARFLDR  258

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  259  IKKAYDRNPELANLIVDREFAREMVQRQGAWRWVVARAVEAGISTPGMSASLSYFDTYRC  318

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  319  NRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  351



>gb|EAY80943.1| hypothetical protein OsI_36123 [Oryza sativa Indica Group]
Length=363

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL++AAPTIA+SLD R+LSGLK+ERV AA V ++ G+   +L    VD
Sbjct  139  KGTGKWTVQQAAELAIAAPTIAASLDGRYLSGLKEERVAAAGVLEAEGMPSGLLETINVD  198

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  199  KKMLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRAKFLDR  258

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK AYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  259  IKNAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMSASLSYFDTYRC  318

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  319  SRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  351



>gb|EEE52109.1| hypothetical protein OsJ_33909 [Oryza sativa Japonica Group]
Length=477

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL++AAPTIA+SLD R+LSGLKDERV AA V ++ G+   +L    VD
Sbjct  253  KGTGKWTVQQAAELAIAAPTIAASLDGRYLSGLKDERVAAAGVLEAEGMPSGLLETINVD  312

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  313  KKMLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRAKFLDR  372

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  373  IKKAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMSASLSYFDTYRC  432

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  433  SRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  465



>ref|XP_007160132.1| hypothetical protein PHAVU_002G295300g [Phaseolus vulgaris]
 gb|ESW32126.1| hypothetical protein PHAVU_002G295300g [Phaseolus vulgaris]
Length=492

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTV+QAA+LS+AAPTIA SLD R+LSGLK+ER  AA V K AG+ D +    VDK
Sbjct  266  KGTGKWTVKQAADLSIAAPTIAGSLDCRYLSGLKEERENAATVLKKAGLSDGIDVSGVDK  325

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            K+LIDDVR+ALYASKICSYAQGMNLL+AKS E+GW L L ELARIWKGGCIIRA+FLDRI
Sbjct  326  KRLIDDVRQALYASKICSYAQGMNLLKAKSNEKGWNLNLAELARIWKGGCIIRAVFLDRI  385

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
             KAY RNPDLA+L+VD +FA E+++R+SAWRRVV LA+++GIS  GM  SL+YFD YRR 
Sbjct  386  NKAYRRNPDLANLIVDPDFAIEMVQRESAWRRVVNLAVSAGISTTGMGGSLSYFDNYRRG  445

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRD FGAHTYER+D PGSFHTEW
Sbjct  446  RLPANLVQAQRDLFGAHTYERVDRPGSFHTEW  477


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFKIP  736
            DIF +KD+  +G+LVDKVLDKTGMKGTG+       D S +   ++ S +  +++G K  
Sbjct  242  DIFKVKDEDGEGFLVDKVLDKTGMKGTGKWTVKQAADLSIAAPTIAGSLDCRYLSGLK--  299

Query  735  *WIEGREGSSC  703
               E RE ++ 
Sbjct  300  ---EERENAAT  307



>ref|NP_001067912.1| Os11g0484500 [Oryza sativa Japonica Group]
 sp|Q2R480.1|6PGD2_ORYSJ RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic; Short=OsG6PGH2; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABA93694.1| 6-phosphogluconate dehydrogenase, decarboxylating, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28275.1| Os11g0484500 [Oryza sativa Japonica Group]
Length=508

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL++AAPTIA+SLD R+LSGLKDERV AA V ++ G+   +L    VD
Sbjct  284  KGTGKWTVQQAAELAIAAPTIAASLDGRYLSGLKDERVAAAGVLEAEGMPSGLLETINVD  343

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  344  KKMLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRAKFLDR  403

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  404  IKKAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMSASLSYFDTYRC  463

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  464  SRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  496



>gb|EMT00678.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=426

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 179/213 (84%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIG-DILTDQAVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   +L    VD
Sbjct  139  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAASVLEEEGMPVGLLEKINVD  198

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALY+SK+CSYAQGMNLLRAKS+EQGW L L EL+RIWKGGCIIRA FLDR
Sbjct  199  KKVLVDRVRQALYSSKVCSYAQGMNLLRAKSVEQGWNLNLAELSRIWKGGCIIRARFLDR  258

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  259  IKKAYDRNPELANLIVDREFAREMVQRQGAWRWVVARAVEAGISTPGMSASLSYFDTYRC  318

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  319  NRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  351



>gb|AFW60760.1| putative 6-phosphogluconate dehydrogenase [Zea mays]
Length=507

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = -1

Query  848  RFWIKRA*RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GD  672
            R   K   +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   
Sbjct  275  RILDKTGMKGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAAGVLEEEGMPAG  334

Query  671  ILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCI  492
            +L    VDKK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCI
Sbjct  335  LLETVNVDKKVLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCI  394

Query  491  IRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSL  312
            IRA FLDRIK AYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGM+ SL
Sbjct  395  IRARFLDRIKSAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMTASL  454

Query  311  AYFDTYRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            +YFDTYR   LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  455  SYFDTYRSSRLPANLIQAQRDLFGAHTYERIDCPGSFHTEW  495



>ref|XP_002449496.1| hypothetical protein SORBIDRAFT_05g016740 [Sorghum bicolor]
 gb|EES08484.1| hypothetical protein SORBIDRAFT_05g016740 [Sorghum bicolor]
Length=504

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   +L    VD
Sbjct  280  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAAGVLEEEGMPAGLLETINVD  339

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  340  KKVLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRARFLDR  399

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AYDRNP+LA+L+VD +FA+E+++RQ+AWR VV  A+ +GIS PGM+ SL+YFDTYR 
Sbjct  400  IKRAYDRNPELANLIVDRDFAREMVQRQNAWRWVVARAVEAGISTPGMTASLSYFDTYRS  459

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  460  SRLPANLIQAQRDLFGAHTYERIDCPGSFHTEW  492



>ref|XP_004979278.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Setaria italica]
Length=504

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   +L    VD
Sbjct  280  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAAGVLEEEGMPAGLLEKINVD  339

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNL+RAKS+E+GW L L ELARIWKGGCIIRA FLDR
Sbjct  340  KKVLVDRVRQALYASKICSYAQGMNLIRAKSVEKGWNLNLAELARIWKGGCIIRARFLDR  399

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AYDRNP+LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGM+ SL+YFDTYR 
Sbjct  400  IKRAYDRNPELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMTASLSYFDTYRS  459

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  460  SRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  492



>ref|XP_003557402.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Brachypodium distachyon]
Length=501

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 179/213 (84%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GDILTDQAVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   +L    VD
Sbjct  281  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAASVLEEEGMPAGLLEKINVD  340

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D VR+ALYASKICSYAQGMNLLRAKS+E+GW L L EL+RIWKGGCIIRA FLDR
Sbjct  341  KKMLVDRVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLAELSRIWKGGCIIRARFLDR  400

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRN +LA+L+VD EFA+E+++RQSAWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  401  IKKAYDRNSELANLIVDREFAREMVQRQSAWRWVVARAVEAGISTPGMSASLSYFDTYRC  460

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  461  NRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  493



>dbj|BAK00156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 180/213 (85%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQ-AVD  648
            +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV A+ V    G+   L ++  V+
Sbjct  281  KGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAASSVLAEEGMPTGLLEKINVN  340

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK L+D+VR+ALY+SK+CSYAQGMNLLRAKS+E+GW L L EL+RIWKGGCIIRA FLDR
Sbjct  341  KKVLVDNVRQALYSSKVCSYAQGMNLLRAKSVEKGWNLNLAELSRIWKGGCIIRARFLDR  400

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IKKAYDRNP+LA+L+VD EFA+E+++RQ AWR VV  A+ +GIS PGMS SL+YFDTYR 
Sbjct  401  IKKAYDRNPELANLIVDREFAREMVQRQGAWRWVVARAVEAGISTPGMSASLSYFDTYRC  460

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  461  NRLPANLIQAQRDLFGAHTYERIDRPGSFHTEW  493



>gb|EPS67575.1| hypothetical protein M569_07199, partial [Genlisea aurea]
Length=485

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFK-SAGIGDILTDQAVD  648
            +  GKWTVQ+AAELSVAAPTIA+SLD R++SGLK++R +AAK+F+  A   +  T   VD
Sbjct  264  KGTGKWTVQEAAELSVAAPTIAASLDIRYISGLKEQRQRAAKIFRRGASSKEDDTINKVD  323

Query  647  KKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDR  468
            KK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+FLDR
Sbjct  324  KKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNLGELARIWKGGCIIRAVFLDR  383

Query  467  IKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRR  288
            IK+AY RNP + +LL+D +F++E+I+R+++WRRVV LA+   ISVPGMS SL YFD Y +
Sbjct  384  IKQAYQRNPGIENLLIDPDFSQEMIQREASWRRVVGLALQKRISVPGMSASLQYFDAYSQ  443

Query  287  ENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            + LPANLVQAQRDYFGAHTYERID+PG++HTEW
Sbjct  444  DRLPANLVQAQRDYFGAHTYERIDLPGAYHTEW  476



>ref|XP_007513389.1| 6-phosphogluconate dehydrogenase [Bathycoccus prasinos]
 emb|CCO15914.1| 6-phosphogluconate dehydrogenase [Bathycoccus prasinos]
Length=518

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 177/215 (82%), Gaps = 3/215 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD---QA  654
            +  GKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERV A  VFKS G+    +      
Sbjct  288  KGTGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVAAEAVFKSKGLAPADSKGPAPG  347

Query  653  VDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFL  474
            +DKKQLIDDVRKALYASK+ SYAQGMNL+RAKS EQ WGL LGE+ARIWKGGCIIRA FL
Sbjct  348  IDKKQLIDDVRKALYASKVTSYAQGMNLIRAKSNEQEWGLNLGEMARIWKGGCIIRAAFL  407

Query  473  DRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTY  294
            DRIK+AYD++ +L SLLVD EFA E+++++ AWRRV+  A+N+G+S P MS+SL YFDTY
Sbjct  408  DRIKQAYDKDANLPSLLVDGEFASELVDKEQAWRRVIVAAVNAGVSTPSMSSSLNYFDTY  467

Query  293  RRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            RR   PANLVQAQRD+FG+HTYER+DM G  HT W
Sbjct  468  RRGRCPANLVQAQRDFFGSHTYERMDMEGWHHTLW  502



>ref|XP_002502811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64069.1| predicted protein [Micromonas sp. RCC299]
Length=500

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 177/216 (82%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI----GDILTDQ  657
            +  GKWTVQQAAELSVA PT+ASSLD+RF+SG+KDERV A   + SAG+     ++    
Sbjct  269  KGTGKWTVQQAAELSVAIPTVASSLDARFISGVKDERVAAQATYMSAGLEPADAEVAALT  328

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
              +K+QL+DDVR ALYASKICSYAQGMNL+RAKS EQGW L LGE+ARIWKGGCIIRA F
Sbjct  329  PEEKQQLVDDVRAALYASKICSYAQGMNLIRAKSNEQGWNLDLGEMARIWKGGCIIRARF  388

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAYDR+ DL SLLVD EFAKE++ER  AWRRVV  AIN+G++ P MS+SLAYFD+
Sbjct  389  LDRIKKAYDRDADLPSLLVDGEFAKELVERNDAWRRVVTSAINAGVATPSMSSSLAYFDS  448

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD+FG+HTYER+DM G  HT W
Sbjct  449  YRRGRLPANLVQAQRDFFGSHTYERVDMDGWHHTVW  484



>ref|NP_001241786.1| 6-phosphogluconate dehydrogenase, decarboxylating [Zea mays]
 gb|ACG41643.1| 6-phosphogluconate dehydrogenase, decarboxylating [Zea mays]
Length=507

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 179/221 (81%), Gaps = 1/221 (0%)
 Frame = -1

Query  848  RFWIKRA*RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGI-GD  672
            R   K   +  GKWTVQQAAEL+VAAPTIA+SLD R+LSGLKDERV AA V +  G+   
Sbjct  275  RILDKTGMKGTGKWTVQQAAELAVAAPTIAASLDGRYLSGLKDERVAAAGVLEEEGMPAG  334

Query  671  ILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCI  492
            +L    VDKK L+D VR+ALYASKICSYAQGMNLLRAKS+E+G  L L ELARIWKGGCI
Sbjct  335  LLETVNVDKKVLVDRVRQALYASKICSYAQGMNLLRAKSVEKGXNLNLAELARIWKGGCI  394

Query  491  IRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSL  312
            IRA FLDRIK AYDRN +LA+L+VD EFA+E+++RQ+AWR VV  A+ +GIS PGM+ SL
Sbjct  395  IRARFLDRIKSAYDRNRELANLIVDREFAREMVQRQNAWRWVVARAVEAGISTPGMTASL  454

Query  311  AYFDTYRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            +YFDTYR   LPANL+QAQRD FGAHTYERID PGSFHTEW
Sbjct  455  SYFDTYRSSRLPANLIQAQRDLFGAHTYERIDCPGSFHTEW  495



>ref|XP_008238987.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Prunus mume]
Length=495

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAG----IGDILTDQ  657
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +A +  K AG    IG + +  
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAEEALKQAGFKEEIGSVTS--  324

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             +DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GWGL LGELARIWKGGCIIRA+F
Sbjct  325  GIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWGLNLGELARIWKGGCIIRAVF  384

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIK AY RN  L +L+VD +FAKE+++RQ+AWRRVV LA+ +GIS PGM  SL+YFDT
Sbjct  385  LDRIKNAYQRNQSLPNLIVDPDFAKEMVQRQAAWRRVVGLAVAAGISTPGMCASLSYFDT  444

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  445  YRRGRLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  480



>gb|AIU64845.1| 6-phosphogluconate dehydrogenase [Prunus sibirica]
Length=495

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAG----IGDILTDQ  657
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +A +  K AG    IG + +  
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAEEALKQAGFKEEIGSVTS--  324

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             +DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GWGL LGELARIWKGGCIIRA+F
Sbjct  325  GIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWGLNLGELARIWKGGCIIRAVF  384

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIK AY RN  L +L+VD +FAKE+++R +AWRRVV LA+++GIS PGM  SL+YFDT
Sbjct  385  LDRIKNAYQRNQSLPNLIVDPDFAKEMVQRHAAWRRVVGLAVSAGISTPGMCASLSYFDT  444

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  445  YRRGRLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  480


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 6/56 (11%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTG  748
            DIF ++DD ADG+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G
Sbjct  243  DIFKVRDDLADGFLVDKLLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSG  298



>ref|XP_009334464.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Pyrus x bretschneideri]
Length=495

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 182/216 (84%), Gaps = 6/216 (3%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAG----IGDILTDQ  657
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +A +  K AG    IG + +  
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAEEALKQAGFKEEIGSVTS--  324

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             +DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+F
Sbjct  325  GIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVF  384

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIK AY RN  L +L+VD +FAKE+++RQ+AWRRVV LA+ +GIS PGM  SL+YFDT
Sbjct  385  LDRIKNAYQRNQSLPNLIVDPDFAKEMVQRQAAWRRVVGLAVAAGISTPGMCASLSYFDT  444

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  445  YRRGRLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  480


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 6/56 (11%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTG  748
            DIF +KDD ADG+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G
Sbjct  243  DIFRVKDDLADGFLVDKLLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSG  298



>ref|XP_001418779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97072.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=507

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELS+AAPTIASSLD+R LSGLKDERV A   +   G+         DK
Sbjct  280  KGTGKWTVQQAAELSIAAPTIASSLDARCLSGLKDERVNAEAFYAKLGLAPAGAMGPADK  339

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLI+DVR ALYASK+ SYAQGMNL+RAKS EQGW L LGE+ARIWKGGCIIRA FLDRI
Sbjct  340  KQLINDVRYALYASKVTSYAQGMNLIRAKSNEQGWNLNLGEMARIWKGGCIIRAGFLDRI  399

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDR+  L SLLVDE+FAKE+IER+++WRRVV  AIN+G+SVP MS SLAYFDTYRR 
Sbjct  400  KNAYDRDSKLPSLLVDEQFAKEMIEREASWRRVVTAAINAGVSVPSMSGSLAYFDTYRRA  459

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              PANLVQAQRD+FG+HTYER DM G +HT W
Sbjct  460  RSPANLVQAQRDFFGSHTYERTDMEGWYHTLW  491



>ref|XP_009336262.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336264.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic isoform X2 [Pyrus x bretschneideri]
Length=495

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 182/216 (84%), Gaps = 6/216 (3%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAG----IGDILTDQ  657
            +  GKWTVQQAAELSVAAPTIA+SLD R+LSGLK+ER +A +  K AG    IG + +  
Sbjct  267  KGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKEEREKAEEALKLAGFKEEIGSVTS--  324

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
             +DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L LGELARIWKGGCIIRA+F
Sbjct  325  GIDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEKGWNLNLGELARIWKGGCIIRAVF  384

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIK AY RN  L +L+VD +FAKE+++RQ+AWRRVV LA+ +GIS PGM  SL+YFDT
Sbjct  385  LDRIKNAYQRNQSLPNLIVDPDFAKEMVQRQAAWRRVVGLAVAAGISTPGMCASLSYFDT  444

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD FGAHTYER+D PG+FHTEW
Sbjct  445  YRRGRLPANLVQAQRDLFGAHTYERVDRPGAFHTEW  480


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 6/56 (11%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTG  748
            DIF +KDD ADG+LVDK+LDKTGMKGTG+       + S +   ++ S +  +++G
Sbjct  243  DIFRVKDDLADGFLVDKLLDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSG  298



>gb|EMS64512.1| 6-phosphogluconate dehydrogenase, decarboxylating [Triticum urartu]
Length=737

 Score =   315 bits (808),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 168/185 (91%), Gaps = 4/185 (2%)
 Frame = -1

Query  740  FLSGLKDERVQAAKVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRA  561
            FLSGLKDERV A+K+F+    GD  + + VDK QLI+DVRKALYASKICSYAQGMN+++A
Sbjct  550  FLSGLKDERVAASKIFQ----GDYSSGETVDKAQLIEDVRKALYASKICSYAQGMNIIKA  605

Query  560  KSIEQGWGLKLGELARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQS  381
            KS E+GWGL LGELARIWKGGCIIRA FLDRIKKAYDRN +LA+LL+D EFA+EI++RQ+
Sbjct  606  KSTEKGWGLNLGELARIWKGGCIIRASFLDRIKKAYDRNGELANLLIDPEFAQEIMDRQA  665

Query  380  AWRRVVCLAINSGISVPGMSTSLAYFDTYRRENLPANLVQAQRDYFGAHTYERIDMPGSF  201
            AWRRVVCLAIN+G+S PGMSTSLAYFD+YRR+ LPANLVQAQRDYFGAHTYER+DMPGSF
Sbjct  666  AWRRVVCLAINNGVSTPGMSTSLAYFDSYRRDRLPANLVQAQRDYFGAHTYERVDMPGSF  725

Query  200  HTEWF  186
            HTEW+
Sbjct  726  HTEWY  730


 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 161/180 (89%), Gaps = 4/180 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPTI +SLDSRFLSGLKDERV A+K+F+    GD  + + VDK
Sbjct  243  KGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDERVAASKIFQ----GDYSSGETVDK  298

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVRKALYASKICSYAQGMN+++AKS E+GWGL LGELARIWKGGCIIRA FLDRI
Sbjct  299  AQLIEDVRKALYASKICSYAQGMNIIKAKSTEKGWGLNLGELARIWKGGCIIRASFLDRI  358

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            KKAYDRN +LA+LL+D EFA+EI++RQ+AWRRVVCLAIN+G+S PGMSTSLAYFD+YRR+
Sbjct  359  KKAYDRNGELANLLIDPEFAQEIMDRQAAWRRVVCLAINNGVSTPGMSTSLAYFDSYRRD  418


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  897  DIFGIKDDKADGYLVDKVLDKTGMKGTGQ------VDCSASCRALSCSTNNSFVTGFK  742
            DIF IKDD+ +GYLVDKVLDKTGMKGTG+       + S +   +  S ++ F++G K
Sbjct  219  DIFSIKDDQGEGYLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLK  276



>ref|XP_003060927.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54577.1| predicted protein [Micromonas pusilla CCMP1545]
Length=500

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 174/216 (81%), Gaps = 4/216 (2%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTD----Q  657
            +  GKWTVQQAAELSVA PTIASSLD+RF+SG+KDERV A   +K+AG+           
Sbjct  269  KGTGKWTVQQAAELSVAIPTIASSLDARFISGVKDERVAAEACYKTAGLAAADAATPKLS  328

Query  656  AVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIF  477
            A +KKQL+DDVR ALYASKICSYAQGMNL+RAKS EQ WGL LGE+ARIWKGGCIIRA F
Sbjct  329  AEEKKQLVDDVRAALYASKICSYAQGMNLIRAKSTEQEWGLDLGEMARIWKGGCIIRARF  388

Query  476  LDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDT  297
            LDRIKKAYD++ +L SLLVD EFA E++ER  +WRRVV  AIN+G++ P MS SLAYFD+
Sbjct  389  LDRIKKAYDKDANLPSLLVDGEFAAELVERNESWRRVVTAAINAGVATPSMSGSLAYFDS  448

Query  296  YRRENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            YRR  LPANLVQAQRD+FG+HTYER DM G  HT W
Sbjct  449  YRRGRLPANLVQAQRDFFGSHTYERTDMEGWHHTVW  484



>emb|CEF98862.1| 6-phosphogluconate dehydrogenase,decarboxylating [Ostreococcus 
tauri]
Length=538

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 169/212 (80%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPT+ASSLD+RFLSGLKDERV A   +   G+       A DK
Sbjct  311  KGTGKWTVQQAAELSVAAPTVASSLDARFLSGLKDERVAAEAFYAKLGLAPATAMGAADK  370

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLI DVR ALYASK+ SYAQGMNL+RAKS EQGW L LGE+ARIWKGGCIIRA FLDRI
Sbjct  371  KQLIKDVRYALYASKVMSYAQGMNLIRAKSNEQGWDLDLGEMARIWKGGCIIRAGFLDRI  430

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDR+  L SLL+DE+FAKE+IER+ AWRRVV  AI +G++VP MS SLAYFD YRR 
Sbjct  431  KSAYDRDAKLPSLLMDEQFAKEVIEREGAWRRVVTSAIAAGVAVPSMSGSLAYFDAYRRA  490

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              PANLVQ QRD+FG+HTYER DM G +HT W
Sbjct  491  RSPANLVQGQRDFFGSHTYERTDMEGWYHTLW  522



>ref|XP_010533610.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 2, chloroplastic [Tarenaya hassleriana]
Length=481

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 173/214 (81%), Gaps = 15/214 (7%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDIL--TDQAV  651
            +  GKWTVQ AAELSV              SGLK+ER  AAKV   AG+ + +    + +
Sbjct  266  KGTGKWTVQPAAELSVX-------------SGLKEERENAAKVLIEAGLKEEIGSASRGI  312

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKICSYAQGMNLLRAKS+E+GW L +GELARIWKGGCIIRA+FLD
Sbjct  313  DKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEKGWNLNMGELARIWKGGCIIRAVFLD  372

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIKKAY RNP+L SL+VD +FA+E+++RQ+AWRRVV LAI++GIS PGM  SLAYFDTYR
Sbjct  373  RIKKAYQRNPNLPSLVVDPDFAREMVQRQAAWRRVVGLAISTGISTPGMCASLAYFDTYR  432

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAHTYERID+PGS+HTEW
Sbjct  433  RARLPANLVQAQRDLFGAHTYERIDLPGSYHTEW  466



>ref|XP_003080519.1| 6-phosphogluconate dehydrogenase (ISS) [Ostreococcus tauri]
Length=702

 Score =   310 bits (793),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 169/212 (80%), Gaps = 0/212 (0%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAELSVAAPT+ASSLD+RFLSGLKDERV A   +   G+       A DK
Sbjct  475  KGTGKWTVQQAAELSVAAPTVASSLDARFLSGLKDERVAAEAFYAKLGLAPATAMGAADK  534

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
            KQLI DVR ALYASK+ SYAQGMNL+RAKS EQGW L LGE+ARIWKGGCIIRA FLDRI
Sbjct  535  KQLIKDVRYALYASKVMSYAQGMNLIRAKSNEQGWDLDLGEMARIWKGGCIIRAGFLDRI  594

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            K AYDR+  L SLL+DE+FAKE+IER+ AWRRVV  AI +G++VP MS SLAYFD YRR 
Sbjct  595  KSAYDRDAKLPSLLMDEQFAKEVIEREGAWRRVVTSAIAAGVAVPSMSGSLAYFDAYRRA  654

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
              PANLVQ QRD+FG+HTYER DM G +HT W
Sbjct  655  RSPANLVQGQRDFFGSHTYERTDMEGWYHTLW  686



>gb|ABY87054.1| phosphogluconate dehydrogenase [Glycyrrhiza lepidota]
Length=152

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G GDILTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS+E+GW LKLGE
Sbjct  1    KVFKSGGFGDILTDQPVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSVEKGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAINSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ISTPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>gb|ABY87053.1| phosphogluconate dehydrogenase [Sutherlandia frutescens]
Length=152

 Score =   282 bits (721),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKSAG+GD LTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGE
Sbjct  1    KVFKSAGVGDFLTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            I++PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ITIPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>gb|ABY87039.1| phosphogluconate dehydrogenase [Robinia neomexicana]
Length=152

 Score =   281 bits (720),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G GDI+TDQ VDKK+LIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW LKLGE
Sbjct  1    KVFKSGGFGDIITDQPVDKKKLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIKKAYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKKAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAINSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            +S PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  VSTPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>gb|ABY87059.1| phosphogluconate dehydrogenase [Caragana arborescens]
Length=152

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G GDILTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGE
Sbjct  1    KVFKSGGFGDILTDQPVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            I++PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ITIPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>gb|ABY87047.1| phosphogluconate dehydrogenase [Astragalus canadensis]
 gb|ABY87049.1| phosphogluconate dehydrogenase [Colutea arborescens]
Length=152

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKSAG+GD +TDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGE
Sbjct  1    KVFKSAGVGDFVTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            I++PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ITIPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>gb|ABY87060.1| phosphogluconate dehydrogenase [Alhagi maurorum]
Length=152

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G GDILTDQ VDK+QLIDDVRKALYASKICSYAQGMNL+RAKS E+GW L LGE
Sbjct  1    KVFKSGGFGDILTDQPVDKQQLIDDVRKALYASKICSYAQGMNLIRAKSAEKGWDLTLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS+PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ISIPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>ref|XP_002953515.1| hypothetical protein VOLCADRAFT_109207 [Volvox carteri f. nagariensis]
 gb|EFJ45488.1| hypothetical protein VOLCADRAFT_109207 [Volvox carteri f. nagariensis]
Length=566

 Score =   293 bits (750),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 169/212 (80%), Gaps = 2/212 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAEL+VAAPT+AS+LD+R+LS LK ERV A+KVF S      +    VDK
Sbjct  340  KGTGKWTVQQAAELAVAAPTMASALDARYLSALKAERVAASKVFASCAQPGAVPR--VDK  397

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QL+ DVR ALYASKICSYAQGMN+++AKS+E+ W + LG LARIWKGGCIIRA FLDRI
Sbjct  398  AQLVADVRAALYASKICSYAQGMNIIKAKSVEKNWNIDLGGLARIWKGGCIIRAQFLDRI  457

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            ++AY+RN +L SLLVD EFAKE+   + AWRRV  LA+  G+ +P M++SL+YFDTYRRE
Sbjct  458  RQAYERNSELPSLLVDPEFAKELAAAEGAWRRVAALAVTHGVPIPSMTSSLSYFDTYRRE  517

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRD+FG+HTY+R D  G +HT W
Sbjct  518  KLPANLVQAQRDFFGSHTYQRFDKEGWYHTVW  549



>gb|ABY87050.1| phosphogluconate dehydrogenase [Vicia faba]
Length=152

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G  DILTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS+E+GWGL+LGE
Sbjct  1    KVFKSGGFSDILTDQHVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSVEKGWGLELGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRN +LA+LLVD EFAKEII+RQSAWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNANLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS+PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ISIPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>ref|XP_001696881.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
 gb|AAL76323.1|AF394513_1 6-phosphogluconate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP00573.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
Length=490

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 168/212 (79%), Gaps = 2/212 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAEL+VAAPT+AS+LD+R++S LK ERV A+K F S      +    VDK
Sbjct  264  KGTGKWTVQQAAELAVAAPTMASALDARYMSALKSERVAASKSFTSCVTPGPVA--GVDK  321

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR ALYASKICSYAQGMN+++AKS+E  W + LG LARIWKGGCIIRA FLDRI
Sbjct  322  AQLINDVRAALYASKICSYAQGMNIIKAKSVEMKWNVDLGGLARIWKGGCIIRAQFLDRI  381

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            + AY+RNP+L SLLVD +FAKE+   +++WRRV  L+I  G+ +P M++SL YFDTYRRE
Sbjct  382  RVAYERNPELPSLLVDPDFAKELTAAEASWRRVAALSITHGVPIPSMTSSLGYFDTYRRE  441

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRD+FG+HTY+R D  G +HT W
Sbjct  442  RLPANLVQAQRDFFGSHTYQRFDKEGWYHTVW  473



>gb|ABY87061.1| phosphogluconate dehydrogenase [Sesbania herbacea]
Length=151

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKS G GDILTDQ VDK+QLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGEL
Sbjct  1    VFKSGGFGDILTDQPVDKQQLIDDVRKALYAAKICSYAQGMNLIRAKSTEKGWDLKLGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            S PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  STPGMSASLAYFDTYRRERLPANLVQAQRDY  151



>ref|XP_001696880.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
 gb|EDP00572.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
Length=566

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 168/212 (79%), Gaps = 2/212 (1%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAVDK  645
            +  GKWTVQQAAEL+VAAPT+AS+LD+R++S LK ERV A+K F S      +    VDK
Sbjct  340  KGTGKWTVQQAAELAVAAPTMASALDARYMSALKSERVAASKSFTSCVTPGPVA--GVDK  397

Query  644  KQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLDRI  465
             QLI+DVR ALYASKICSYAQGMN+++AKS+E  W + LG LARIWKGGCIIRA FLDRI
Sbjct  398  AQLINDVRAALYASKICSYAQGMNIIKAKSVEMKWNVDLGGLARIWKGGCIIRAQFLDRI  457

Query  464  KKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYRRE  285
            + AY+RNP+L SLLVD +FAKE+   +++WRRV  L+I  G+ +P M++SL YFDTYRRE
Sbjct  458  RVAYERNPELPSLLVDPDFAKELTAAEASWRRVAALSITHGVPIPSMTSSLGYFDTYRRE  517

Query  284  NLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
             LPANLVQAQRD+FG+HTY+R D  G +HT W
Sbjct  518  RLPANLVQAQRDFFGSHTYQRFDKEGWYHTVW  549



>gb|ABY87044.1| phosphogluconate dehydrogenase [Sesbania vesicaria]
 gb|ABY87045.1| phosphogluconate dehydrogenase [Sesbania vesicaria]
 gb|ABY87046.1| phosphogluconate dehydrogenase, partial [Sesbania vesicaria]
 gb|ABY87062.1| phosphogluconate dehydrogenase, partial [Sesbania vesicaria]
Length=152

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G GDILTDQ VDK+QLIDDVRKALYA+KICSYAQGMNL+RAKS E+ W LKLGE
Sbjct  1    KVFKSGGFGDILTDQPVDKQQLIDDVRKALYAAKICSYAQGMNLIRAKSTEKDWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS PGMS SLAYFDTYRRE+LPANLVQAQRDY
Sbjct  121  ISTPGMSASLAYFDTYRRESLPANLVQAQRDY  152



>gb|AEJ36088.1| phosphogluconate dehydrogenase, partial [Astragalus alpinus]
Length=150

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKSAG+GD +TDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGEL
Sbjct  1    VFKSAGVGDFVTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            +VPGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  TVPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|AEJ36087.1| phosphogluconate dehydrogenase, partial [Astragalus nothoxys]
Length=150

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKSAG+GD +TDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGEL
Sbjct  1    VFKSAGVGDFVTDQXVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            ++PGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  TIPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|ABY87063.1| phosphogluconate dehydrogenase [Cicer pinnatifidum]
Length=152

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G+GDILT + VDKK+L+DDVRKALYA+KICSYAQGMNL+RAKS EQGW LKLGE
Sbjct  1    KVFKSGGLGDILTGEPVDKKKLVDDVRKALYAAKICSYAQGMNLIRAKSAEQGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQ++WRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQTSWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS+PGMS SLAYFDTYRRE+LPANLVQAQRDY
Sbjct  121  ISIPGMSASLAYFDTYRRESLPANLVQAQRDY  152



>gb|AEJ36089.1| phosphogluconate dehydrogenase, partial [Astragalus americanus]
Length=150

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKSAG+GD +TDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGEL
Sbjct  1    VFKSAGVGDFVTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            ++PGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  TIPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|ABY87057.1| phosphogluconate dehydrogenase [Olneya tesota]
Length=152

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G GDI+TDQ VDKK+LIDDVRKALYA+KICSYAQGMNL+RAKSIE+GW L LGE
Sbjct  1    KVFKSGGFGDIITDQPVDKKKLIDDVRKALYAAKICSYAQGMNLIRAKSIEKGWDLTLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIKKAYDRN +LA+LLVD EFAKEII+RQSAWRRVVCLAINSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKKAYDRNANLANLLVDPEFAKEIIDRQSAWRRVVCLAINSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ISTPGMSASLAYFDTYRRERLPANLVQAQRDY  152



>gb|AEJ36078.1| phosphogluconate dehydrogenase, partial [Sesbania tomentosa]
Length=150

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKS+G GDILTDQ VDK+QLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGEL
Sbjct  1    VFKSSGFGDILTDQPVDKQQLIDDVRKALYAAKICSYAQGMNLIRAKSTEKGWDLKLGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            S PGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  STPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|AEJ36097.1| phosphogluconate dehydrogenase, partial [Trigonella foenum-graecum]
 gb|AEJ36098.1| phosphogluconate dehydrogenase, partial [Trigonella kotschyi]
Length=150

 Score =   276 bits (707),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKS G GDILTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW L+LGEL
Sbjct  1    VFKSGGFGDILTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLELGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEIIERQ+AWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIERQTAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            S+PGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  SIPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|ABY87058.1| phosphogluconate dehydrogenase [Galega orientalis]
Length=152

 Score =   276 bits (707),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS GIGDI+TDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGE
Sbjct  1    KVFKSGGIGDIVTDQPVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLKLGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRN +LA+LLVD EFAKEII+RQ+AWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNSNLANLLVDPEFAKEIIDRQTAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS+PGMS SLAYFDTYRR +LPANLVQAQRDY
Sbjct  121  ISIPGMSASLAYFDTYRRASLPANLVQAQRDY  152



>ref|XP_006441889.1| hypothetical protein CICLE_v10023851mg [Citrus clementina]
 gb|ESR55129.1| hypothetical protein CICLE_v10023851mg [Citrus clementina]
Length=438

 Score =   286 bits (733),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 165/214 (77%), Gaps = 17/214 (8%)
 Frame = -1

Query  824  RALGKWTVQQAAELSVAAPTIASSLDSRFLSGLKDERVQAAKVFKSAGIGDILTDQAV--  651
            +  GKWT+QQAAEL VAA TIA+SLD R+LSGLK+ER +AAKV K AG+ D + +  V  
Sbjct  225  KGTGKWTIQQAAELLVAALTIAASLDCRYLSGLKEERQEAAKVLKEAGLKDEVQNVGVHV  284

Query  650  DKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGELARIWKGGCIIRAIFLD  471
            DKK+LIDDVR+ALYASKIC                   L  GELARIWKGGCIIRA+FLD
Sbjct  285  DKKRLIDDVRQALYASKICKRMD---------------LNFGELARIWKGGCIIRAVFLD  329

Query  470  RIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGISVPGMSTSLAYFDTYR  291
            RIK AY RNP+LASL+VD EFA+E+++RQ+AWRRVV LAI++GIS PGM  SL+YFDTYR
Sbjct  330  RIKNAYQRNPNLASLVVDPEFAREMVQRQAAWRRVVGLAISAGISTPGMCASLSYFDTYR  389

Query  290  RENLPANLVQAQRDYFGAHTYERIDMPGSFHTEW  189
            R  LPANLVQAQRD FGAH  ERID PGSFHTEW
Sbjct  390  RARLPANLVQAQRDLFGAHANERIDRPGSFHTEW  423



>gb|AEJ36072.1| phosphogluconate dehydrogenase, partial [Sesbania punicea]
Length=150

 Score =   276 bits (706),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKS G GDILTDQ VDK+QLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW LKLGEL
Sbjct  1    VFKSGGFGDILTDQPVDKQQLIDDVRKALYAAKICSYAQGMNLIRAKSTEKGWDLKLGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQSAWRRVVCLAINSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQSAWRRVVCLAINSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            S PGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  STPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|AEJ36094.1| phosphogluconate dehydrogenase, partial [Medicago lanigera]
Length=150

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  698  VFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGEL  519
            VFKS G GDILTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GW L LGEL
Sbjct  1    VFKSGGFGDILTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSAEKGWDLALGEL  60

Query  518  ARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSGI  339
            ARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEIIERQ+AWRRVVCLA+NSGI
Sbjct  61   ARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIERQTAWRRVVCLAVNSGI  120

Query  338  SVPGMSTSLAYFDTYRRENLPANLVQAQRD  249
            S+PGMS SLAYFDTYRRE LPANLVQAQRD
Sbjct  121  SIPGMSASLAYFDTYRRERLPANLVQAQRD  150



>gb|ABY87048.1| phosphogluconate dehydrogenase [Pisum sativum]
Length=152

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -1

Query  701  KVFKSAGIGDILTDQAVDKKQLIDDVRKALYASKICSYAQGMNLLRAKSIEQGWGLKLGE  522
            KVFKS G+ + LTDQ VDKKQLIDDVRKALYA+KICSYAQGMNL+RAKS E+GWGL+LGE
Sbjct  1    KVFKSGGLSENLTDQQVDKKQLIDDVRKALYAAKICSYAQGMNLIRAKSTEKGWGLELGE  60

Query  521  LARIWKGGCIIRAIFLDRIKKAYDRNPDLASLLVDEEFAKEIIERQSAWRRVVCLAINSG  342
            LARIWKGGCIIRAIFLDRIK+AYDRNP+LA+LLVD EFAKEII+RQ AWRRVVCLA+NSG
Sbjct  61   LARIWKGGCIIRAIFLDRIKQAYDRNPNLANLLVDPEFAKEIIDRQPAWRRVVCLAVNSG  120

Query  341  ISVPGMSTSLAYFDTYRRENLPANLVQAQRDY  246
            IS+PGMS SLAYFDTYRRE LPANLVQAQRDY
Sbjct  121  ISIPGMSASLAYFDTYRRERLPANLVQAQRDY  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2061751161600