BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052M01

Length=912
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785963.1|  PREDICTED: uncharacterized protein LOC104234...    323   2e-100   Nicotiana sylvestris
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...    325   2e-100   Nicotiana sylvestris
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...    324   3e-100   Nicotiana sylvestris
ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...    321   5e-99    Nicotiana tomentosiformis
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...    321   5e-99    Nicotiana tomentosiformis
ref|XP_009614044.1|  PREDICTED: uncharacterized protein LOC104107...    320   5e-99    Nicotiana tomentosiformis
ref|XP_009614043.1|  PREDICTED: uncharacterized protein LOC104107...    319   9e-99    Nicotiana tomentosiformis
emb|CDP17325.1|  unnamed protein product                                318   2e-97    Coffea canephora [robusta coffee]
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like               315   9e-97    Solanum tuberosum [potatoes]
gb|KDO78075.1|  hypothetical protein CISIN_1g0026401mg                  295   8e-96    Citrus sinensis [apfelsine]
gb|KDO78070.1|  hypothetical protein CISIN_1g0026401mg                  296   2e-95    Citrus sinensis [apfelsine]
ref|XP_007025176.1|  Uncharacterized protein TCM_029557                 303   5e-92    
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...    302   1e-91    
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...    302   1e-91    Citrus sinensis [apfelsine]
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g             302   2e-91    
ref|XP_002317304.2|  kinase-related family protein                      301   3e-91    
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg             300   6e-91    
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg             300   7e-91    Citrus clementina [clementine]
emb|CBI30819.3|  unnamed protein product                                296   5e-90    Vitis vinifera
ref|XP_008225366.1|  PREDICTED: dentin sialophosphoprotein isofor...    297   7e-90    Prunus mume [ume]
ref|XP_008225365.1|  PREDICTED: dentin sialophosphoprotein isofor...    297   8e-90    Prunus mume [ume]
ref|XP_011005847.1|  PREDICTED: uncharacterized protein LOC105112...    297   1e-89    Populus euphratica
ref|XP_010655630.1|  PREDICTED: protein lingerer-like                   297   1e-89    Vitis vinifera
ref|XP_011005848.1|  PREDICTED: uncharacterized protein LOC105112...    296   1e-89    Populus euphratica
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...    296   2e-89    Populus euphratica
ref|XP_011005845.1|  PREDICTED: uncharacterized protein LOC105112...    296   2e-89    Populus euphratica
ref|XP_011005846.1|  PREDICTED: uncharacterized protein LOC105112...    296   2e-89    Populus euphratica
gb|KDP21205.1|  hypothetical protein JCGZ_21676                         296   2e-89    Jatropha curcas
ref|XP_011045309.1|  PREDICTED: uncharacterized protein LOC105140...    296   2e-89    Populus euphratica
ref|XP_011045308.1|  PREDICTED: uncharacterized protein LOC105140...    296   3e-89    Populus euphratica
gb|KHF99174.1|  hypothetical protein F383_17166                         295   4e-89    Gossypium arboreum [tree cotton]
gb|KJB69765.1|  hypothetical protein B456_011G041100                    293   2e-88    Gossypium raimondii
gb|KJB69763.1|  hypothetical protein B456_011G041100                    293   2e-88    Gossypium raimondii
gb|KHN48057.1|  hypothetical protein glysoja_015527                     291   5e-88    Glycine soja [wild soybean]
ref|XP_007214618.1|  hypothetical protein PRUPE_ppa001304mg             292   8e-88    Prunus persica
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351    290   2e-87    Solanum lycopersicum
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...    290   2e-87    
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...    290   2e-87    Sesamum indicum [beniseed]
ref|XP_006369885.1|  hypothetical protein POPTR_0001s34440g             290   4e-87    
gb|KHF99173.1|  hypothetical protein F383_17166                         286   2e-85    Gossypium arboreum [tree cotton]
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306    282   2e-84    Nicotiana sylvestris
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like             281   4e-84    Solanum tuberosum [potatoes]
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    281   4e-84    
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388    281   4e-84    Cucumis sativus [cucumbers]
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...    281   5e-84    Cucumis melo [Oriental melon]
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...    281   5e-84    Cucumis melo [Oriental melon]
gb|KGN49366.1|  hypothetical protein Csa_6G522110                       281   9e-84    Cucumis sativus [cucumbers]
ref|XP_011460396.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    280   2e-83    Fragaria vesca subsp. vesca
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...    277   1e-82    Nicotiana tomentosiformis
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...    277   2e-82    Nicotiana tomentosiformis
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g             277   2e-82    Phaseolus vulgaris [French bean]
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...    276   4e-82    Solanum lycopersicum
ref|XP_002519742.1|  conserved hypothetical protein                     276   6e-82    Ricinus communis
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...    276   6e-82    Solanum lycopersicum
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...    276   1e-81    Nelumbo nucifera [Indian lotus]
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...    276   1e-81    Nelumbo nucifera [Indian lotus]
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg                271   4e-80    Erythranthe guttata [common monkey flower]
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...    270   8e-80    Glycine max [soybeans]
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...    270   1e-79    Nelumbo nucifera [Indian lotus]
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...    270   1e-79    Nelumbo nucifera [Indian lotus]
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549    270   1e-79    
gb|KHG18569.1|  Protein translocase subunit SecA                        269   2e-79    Gossypium arboreum [tree cotton]
gb|KJB57294.1|  hypothetical protein B456_009G157400                    266   2e-79    Gossypium raimondii
gb|KJB57297.1|  hypothetical protein B456_009G157400                    266   6e-79    Gossypium raimondii
gb|KJB57295.1|  hypothetical protein B456_009G157400                    267   1e-78    Gossypium raimondii
ref|XP_008358625.1|  PREDICTED: cell wall protein RBR3-like             252   3e-78    
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                  263   5e-77    Medicago truncatula
ref|XP_008364176.1|  PREDICTED: uncharacterized protein LOC103427...    262   6e-77    
ref|XP_008364175.1|  PREDICTED: uncharacterized protein LOC103427...    262   6e-77    
ref|XP_008364174.1|  PREDICTED: uncharacterized protein LOC103427...    262   9e-77    
ref|XP_009353841.1|  PREDICTED: uncharacterized protein LOC103945...    261   3e-76    
ref|XP_009353840.1|  PREDICTED: uncharacterized protein LOC103945...    261   3e-76    Pyrus x bretschneideri [bai li]
ref|XP_009353842.1|  PREDICTED: uncharacterized protein LOC103945...    260   3e-76    Pyrus x bretschneideri [bai li]
ref|XP_009353839.1|  PREDICTED: uncharacterized protein LOC103945...    260   4e-76    
ref|XP_009353838.1|  PREDICTED: uncharacterized protein LOC103945...    260   4e-76    
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...    259   8e-76    Cicer arietinum [garbanzo]
ref|XP_008366008.1|  PREDICTED: protein lingerer-like                   256   1e-74    
ref|XP_010666705.1|  PREDICTED: uncharacterized protein LOC104883...    241   4e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666704.1|  PREDICTED: uncharacterized protein LOC104883...    241   6e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010056862.1|  PREDICTED: uncharacterized protein LOC104444...    240   8e-69    Eucalyptus grandis [rose gum]
ref|XP_010056860.1|  PREDICTED: uncharacterized protein LOC104444...    240   9e-69    Eucalyptus grandis [rose gum]
ref|XP_010056861.1|  PREDICTED: uncharacterized protein LOC104444...    240   1e-68    Eucalyptus grandis [rose gum]
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...    239   1e-68    
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...    239   1e-68    Cicer arietinum [garbanzo]
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...    239   1e-68    
gb|KHN14369.1|  hypothetical protein glysoja_012407                     239   2e-68    Glycine soja [wild soybean]
ref|XP_008797517.1|  PREDICTED: uncharacterized protein LOC103712...    234   4e-67    
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...    235   6e-67    Phoenix dactylifera
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593    233   3e-66    Elaeis guineensis
ref|XP_008349816.1|  PREDICTED: serine/threonine-protein kinase C...    216   2e-65    
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like               228   3e-64    Elaeis guineensis
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g             224   4e-63    Phaseolus vulgaris [French bean]
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614    224   6e-63    Tarenaya hassleriana [spider flower]
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...    222   2e-62    Glycine max [soybeans]
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...    222   2e-62    Glycine max [soybeans]
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    220   2e-61    
ref|XP_010538220.1|  PREDICTED: uncharacterized protein LOC104812...    216   3e-60    Tarenaya hassleriana [spider flower]
ref|XP_010538221.1|  PREDICTED: uncharacterized protein LOC104812...    215   8e-60    Tarenaya hassleriana [spider flower]
ref|XP_006415582.1|  hypothetical protein EUTSA_v10006794mg             208   2e-57    Eutrema salsugineum [saltwater cress]
ref|XP_006415581.1|  hypothetical protein EUTSA_v10006794mg             208   3e-57    Eutrema salsugineum [saltwater cress]
emb|CDX94662.1|  BnaC07g09960D                                          205   2e-56    
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...    205   2e-56    Tarenaya hassleriana [spider flower]
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...    202   3e-55    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU43283.1|  hypothetical protein MIMGU_mgv1a002920mg                200   3e-55    Erythranthe guttata [common monkey flower]
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...    202   4e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...    202   4e-55    
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...    202   4e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146             198   5e-54    
ref|XP_006306765.1|  hypothetical protein CARUB_v10008305mg             197   2e-53    Capsella rubella
ref|XP_006306766.1|  hypothetical protein CARUB_v10008305mg             197   2e-53    Capsella rubella
ref|NP_174230.2|  Kinase-related protein                                196   4e-53    Arabidopsis thaliana [mouse-ear cress]
gb|AAG51735.1|AC068667_14  unknown protein; 25451-20507                 196   5e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478296.1|  PREDICTED: probable serine/threonine-protein...    195   7e-53    
ref|XP_010499452.1|  PREDICTED: RNA polymerase II degradation fac...    195   9e-53    
ref|XP_010540528.1|  PREDICTED: uncharacterized protein LOC104814266    194   1e-52    Tarenaya hassleriana [spider flower]
ref|NP_174229.2|  uncharacterized protein                               194   2e-52    Arabidopsis thaliana [mouse-ear cress]
gb|AAG51729.1|AC068667_8  unknown protein; 16040-11188                  194   2e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460714.1|  PREDICTED: putative uncharacterized protein ...    194   2e-52    Camelina sativa [gold-of-pleasure]
emb|CDY15632.1|  BnaA07g08030D                                          194   2e-52    Brassica napus [oilseed rape]
ref|XP_010460715.1|  PREDICTED: putative uncharacterized protein ...    194   2e-52    
emb|CDX99817.1|  BnaC05g22390D                                          192   2e-52    
emb|CDY48333.1|  BnaA09g26880D                                          191   1e-51    Brassica napus [oilseed rape]
ref|XP_009102863.1|  PREDICTED: uncharacterized protein LOC103828...    190   1e-51    Brassica rapa
ref|XP_009102862.1|  PREDICTED: uncharacterized protein LOC103828...    191   2e-51    Brassica rapa
ref|XP_009102861.1|  PREDICTED: uncharacterized protein LOC103828...    191   2e-51    Brassica rapa
ref|XP_006646178.1|  PREDICTED: putative GPI-anchored protein PB1...    188   2e-50    
dbj|BAD72339.1|  TA9 protein-like                                       178   5e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115248.1|  PREDICTED: putative uncharacterized protein ...    184   5e-49    
ref|XP_009141365.1|  PREDICTED: RNA polymerase II degradation fac...    184   7e-49    Brassica rapa
gb|KJB57296.1|  hypothetical protein B456_009G157400                    181   3e-48    Gossypium raimondii
gb|AAL58943.1|AF462857_1  At1g29350/F15D2_27                            182   4e-48    Arabidopsis thaliana [mouse-ear cress]
emb|CDX90188.1|  BnaA08g17960D                                          179   2e-47    
ref|NP_001043788.1|  Os01g0663800                                       180   2e-47    
ref|XP_009109668.1|  PREDICTED: RNA polymerase II degradation fac...    179   3e-47    Brassica rapa
ref|XP_009109669.1|  PREDICTED: RNA polymerase II degradation fac...    179   3e-47    Brassica rapa
emb|CDY43334.1|  BnaC03g59060D                                          179   3e-47    Brassica napus [oilseed rape]
emb|CDY43685.1|  BnaA04g20060D                                          177   2e-46    Brassica napus [oilseed rape]
ref|XP_009395691.1|  PREDICTED: mucin-17-like                           177   2e-46    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC71225.1|  hypothetical protein OsI_03160                          176   4e-46    Oryza sativa Indica Group [Indian rice]
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756    175   2e-45    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22963.1|  hypothetical protein glysoja_030633                     175   3e-45    Glycine soja [wild soybean]
emb|CDY61562.1|  BnaCnng37970D                                          172   1e-44    Brassica napus [oilseed rape]
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...    171   3e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...    171   3e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006410569.1|  hypothetical protein EUTSA_v10016218mg             171   4e-44    
ref|XP_006410567.1|  hypothetical protein EUTSA_v10016218mg             171   4e-44    Eutrema salsugineum [saltwater cress]
gb|KFK36320.1|  hypothetical protein AALP_AA4G107400                    169   1e-43    Arabis alpina [alpine rockcress]
gb|EMT31975.1|  Retrovirus-related Pol polyprotein LINE-1               169   5e-43    
emb|CDJ26391.1|  unnamed protein product                                167   7e-43    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001130067.1|  uncharacterized protein LOC100191159               158   1e-42    
ref|XP_008648655.1|  PREDICTED: uncharacterized protein LOC103629266    159   1e-42    
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820          162   7e-41    Amborella trichopoda
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...    160   2e-40    Setaria italica
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...    160   2e-40    Setaria italica
ref|XP_010232108.1|  PREDICTED: uncharacterized protein LOC100846...    160   3e-40    Brachypodium distachyon [annual false brome]
ref|XP_003569505.1|  PREDICTED: uncharacterized protein LOC100846...    159   4e-40    Brachypodium distachyon [annual false brome]
ref|XP_004969440.1|  PREDICTED: putative GPI-anchored protein PB1...    159   6e-40    Setaria italica
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...    159   6e-40    
ref|XP_004969439.1|  PREDICTED: putative GPI-anchored protein PB1...    159   6e-40    Setaria italica
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...    159   7e-40    
gb|EMS47817.1|  hypothetical protein TRIUR3_20557                       159   1e-39    Triticum urartu
ref|XP_010413764.1|  PREDICTED: probable serine/threonine-protein...    157   4e-39    Camelina sativa [gold-of-pleasure]
ref|XP_010413763.1|  PREDICTED: alpha-protein kinase 1-like isofo...    156   6e-39    Camelina sativa [gold-of-pleasure]
ref|XP_008645740.1|  PREDICTED: uncharacterized protein LOC103627229    148   1e-38    
gb|AFW71654.1|  hypothetical protein ZEAMMB73_647126                    149   9e-38    
ref|XP_006654843.1|  PREDICTED: dentin sialophosphoprotein-like         151   4e-37    Oryza brachyantha
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916    150   1e-36    Brachypodium distachyon [annual false brome]
gb|ACF86865.1|  unknown                                                 147   2e-36    Zea mays [maize]
ref|XP_009132981.1|  PREDICTED: uncharacterized protein LOC103857526    148   4e-36    Brassica rapa
emb|CDX84653.1|  BnaA03g15770D                                          148   5e-36    
ref|NP_001141689.1|  uncharacterized protein LOC100273818               147   6e-36    Zea mays [maize]
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...    147   6e-36    Zea mays [maize]
ref|XP_002881327.1|  hypothetical protein ARALYDRAFT_321144             146   2e-35    Arabidopsis lyrata subsp. lyrata
ref|XP_002440322.1|  hypothetical protein SORBIDRAFT_09g029670          144   2e-35    
dbj|BAJ92311.1|  predicted protein                                      146   3e-35    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63247.1|  hypothetical protein TRIUR3_29233                       145   3e-35    Triticum urartu
dbj|BAJ85689.1|  predicted protein                                      144   9e-35    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008656717.1|  PREDICTED: uncharacterized protein LOC103636139    144   1e-34    
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like             142   3e-34    Prunus mume [ume]
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730          138   1e-32    
gb|EEC79757.1|  hypothetical protein OsI_21141                          137   2e-32    Oryza sativa Indica Group [Indian rice]
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...    136   6e-32    Zea mays [maize]
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...    136   6e-32    Zea mays [maize]
gb|AFW81250.1|  putative DUF1296 domain containing family protein       136   6e-32    
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg             136   6e-32    
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...    136   7e-32    Zea mays [maize]
ref|NP_001146586.1|  uncharacterized protein LOC100280182               135   8e-32    Zea mays [maize]
gb|AFW81248.1|  putative DUF1296 domain containing family protein       135   8e-32    
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...    135   8e-32    Zea mays [maize]
gb|AFW81251.1|  putative DUF1296 domain containing family protein       135   8e-32    
ref|NP_001056433.1|  Os05g0581800                                       133   8e-31    
gb|AAT44198.1|  unknown protein                                         133   9e-31    Oryza sativa Japonica Group [Japonica rice]
gb|EEE64826.1|  hypothetical protein OsJ_19683                          132   1e-30    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654800.1|  PREDICTED: uncharacterized protein LOC102700994    132   2e-30    Oryza brachyantha
emb|CBI20348.3|  unnamed protein product                                123   9e-30    Vitis vinifera
gb|EEC79711.1|  hypothetical protein OsI_21014                          129   2e-29    Oryza sativa Indica Group [Indian rice]
ref|NP_001056347.1|  Os05g0566900                                       129   2e-29    
ref|XP_004961107.1|  PREDICTED: uncharacterized protein LOC101764...    127   8e-29    Setaria italica
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...    127   8e-29    Setaria italica
ref|XP_010230981.1|  PREDICTED: uncharacterized protein LOC100825...    125   4e-28    
ref|XP_003567822.1|  PREDICTED: uncharacterized protein LOC100825...    125   5e-28    
ref|XP_006410568.1|  hypothetical protein EUTSA_v10016218mg             125   5e-28    
ref|XP_007048866.1|  Uncharacterized protein TCM_001879                 125   5e-28    
emb|CAN79286.1|  hypothetical protein VITISV_039797                     118   2e-27    Vitis vinifera
emb|CDY37665.1|  BnaA04g20030D                                          120   1e-26    Brassica napus [oilseed rape]
ref|NP_001266740.1|  uncharacterized protein LOC101027201               115   8e-26    
emb|CAE00871.1|  TA9 protein                                            110   1e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655403.1|  PREDICTED: uncharacterized protein LOC101027...    117   2e-25    
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...    117   2e-25    
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...    114   1e-24    Camelina sativa [gold-of-pleasure]
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...    114   1e-24    Camelina sativa [gold-of-pleasure]
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like             114   2e-24    
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...    113   3e-24    Camelina sativa [gold-of-pleasure]
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...    113   3e-24    Camelina sativa [gold-of-pleasure]
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...    113   3e-24    Fragaria vesca subsp. vesca
ref|XP_011467574.1|  PREDICTED: uncharacterized protein LOC101307...    113   4e-24    Fragaria vesca subsp. vesca
ref|XP_010559260.1|  PREDICTED: uncharacterized protein LOC104827...    112   1e-23    Tarenaya hassleriana [spider flower]
ref|XP_010559259.1|  PREDICTED: uncharacterized protein LOC104827...    111   1e-23    Tarenaya hassleriana [spider flower]
ref|XP_010559258.1|  PREDICTED: uncharacterized protein LOC104827...    111   1e-23    Tarenaya hassleriana [spider flower]
ref|XP_010559257.1|  PREDICTED: uncharacterized protein LOC104827...    111   1e-23    Tarenaya hassleriana [spider flower]
ref|XP_009356619.1|  PREDICTED: uncharacterized protein LOC103947...    111   1e-23    Pyrus x bretschneideri [bai li]
ref|XP_010102151.1|  hypothetical protein L484_021385                   111   1e-23    Morus notabilis
ref|XP_009356617.1|  PREDICTED: uncharacterized protein LOC103947...    111   2e-23    Pyrus x bretschneideri [bai li]
ref|XP_008380341.1|  PREDICTED: probable GPI-anchored adhesin-lik...    110   2e-23    
dbj|BAK03133.1|  predicted protein                                      109   3e-23    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434571.1|  PREDICTED: probable serine/threonine-protein...    110   3e-23    Camelina sativa [gold-of-pleasure]
ref|XP_010434569.1|  PREDICTED: probable serine/threonine-protein...    110   3e-23    Camelina sativa [gold-of-pleasure]
dbj|BAJ94362.1|  predicted protein                                      110   5e-23    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002870069.1|  predicted protein                                  108   1e-22    Arabidopsis lyrata subsp. lyrata
emb|CDY61669.1|  BnaC01g40800D                                          108   2e-22    Brassica napus [oilseed rape]
ref|XP_009356618.1|  PREDICTED: uncharacterized protein LOC103947...    107   3e-22    Pyrus x bretschneideri [bai li]
gb|EMS61509.1|  hypothetical protein TRIUR3_20581                       103   5e-21    Triticum urartu
ref|XP_006282485.1|  hypothetical protein CARUB_v10006235mg             100   7e-20    
ref|XP_009131438.1|  PREDICTED: flocculation protein FLO11            97.1    1e-18    Brassica rapa
emb|CDX78828.1|  BnaA01g08950D                                        96.3    2e-18    
gb|KFK28493.1|  hypothetical protein AALP_AA7G003100                  95.9    2e-18    Arabis alpina [alpine rockcress]
gb|KFK28492.1|  hypothetical protein AALP_AA7G003100                  95.9    2e-18    Arabis alpina [alpine rockcress]
emb|CAB53656.1|  hypothetical protein                                 94.7    4e-18    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193549.5|  uncharacterized protein                             94.7    5e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414144.1|  hypothetical protein EUTSA_v10027504mg           94.4    7e-18    
ref|XP_008362365.1|  PREDICTED: uncharacterized protein LOC103426056  91.3    7e-17    
ref|XP_008342489.1|  PREDICTED: uncharacterized protein LOC103405294  91.3    7e-17    
gb|KDP46910.1|  hypothetical protein JCGZ_10401                       91.3    7e-17    Jatropha curcas
emb|CDY11787.1|  BnaC03g57910D                                        87.0    1e-15    Brassica napus [oilseed rape]
ref|XP_009377414.1|  PREDICTED: uncharacterized protein LOC103966021  87.0    2e-15    Pyrus x bretschneideri [bai li]
gb|KDO60960.1|  hypothetical protein CISIN_1g0031902mg                86.3    3e-15    Citrus sinensis [apfelsine]
gb|KDO60959.1|  hypothetical protein CISIN_1g0031902mg                86.3    3e-15    Citrus sinensis [apfelsine]
ref|XP_006484854.1|  PREDICTED: uncharacterized protein LOC102628...  86.3    3e-15    Citrus sinensis [apfelsine]
gb|EMT27654.1|  hypothetical protein F775_52320                       85.9    3e-15    
ref|XP_006484855.1|  PREDICTED: uncharacterized protein LOC102628...  85.9    3e-15    
ref|XP_011026253.1|  PREDICTED: uncharacterized protein LOC105126...  84.7    1e-14    Populus euphratica
ref|XP_011026252.1|  PREDICTED: uncharacterized protein LOC105126...  84.7    1e-14    Populus euphratica
ref|XP_011026250.1|  PREDICTED: uncharacterized protein LOC105126...  84.7    1e-14    Populus euphratica
ref|XP_011026254.1|  PREDICTED: uncharacterized protein LOC105126...  84.3    1e-14    Populus euphratica
ref|XP_011026251.1|  PREDICTED: uncharacterized protein LOC105126...  84.3    1e-14    Populus euphratica
gb|AFW21569.1|  hypothetical protein ZEAMMB73_653125                  82.4    3e-14    
ref|XP_002300878.1|  hypothetical protein POPTR_0002s06020g           82.8    4e-14    
gb|EMT26879.1|  hypothetical protein F775_17961                       82.4    6e-14    
ref|XP_010469379.1|  PREDICTED: uncharacterized protein LOC104749442  66.6    6e-09    
gb|KJB69766.1|  hypothetical protein B456_011G041100                  65.5    2e-08    Gossypium raimondii
ref|XP_006405899.1|  hypothetical protein EUTSA_v10028301mg           64.3    4e-08    
gb|KJB75412.1|  hypothetical protein B456_012G040900                  63.9    6e-08    Gossypium raimondii
ref|XP_006405898.1|  hypothetical protein EUTSA_v10028089mg           62.8    1e-07    
gb|KHG01632.1|  Segment polarity dishevelled DVL-3                    62.4    2e-07    Gossypium arboreum [tree cotton]
ref|XP_008779718.1|  PREDICTED: uncharacterized protein LOC103699456  58.9    2e-07    
ref|XP_006447832.1|  hypothetical protein CICLE_v10014215mg           60.5    9e-07    Citrus clementina [clementine]
ref|XP_006447831.1|  hypothetical protein CICLE_v10014215mg           60.5    9e-07    Citrus clementina [clementine]
ref|XP_006437175.1|  hypothetical protein CICLE_v10033869mg           59.7    2e-06    
ref|XP_006389698.1|  hypothetical protein EUTSA_v10027613mg           56.2    2e-05    Eutrema salsugineum [saltwater cress]
ref|XP_010547195.1|  PREDICTED: uncharacterized protein LOC104819...  55.1    4e-05    Tarenaya hassleriana [spider flower]
ref|XP_010547193.1|  PREDICTED: uncharacterized protein LOC104819...  55.1    5e-05    Tarenaya hassleriana [spider flower]
ref|XP_010547194.1|  PREDICTED: uncharacterized protein LOC104819...  55.1    5e-05    Tarenaya hassleriana [spider flower]
ref|XP_001776008.1|  predicted protein                                55.1    6e-05    
ref|XP_006383650.1|  hypothetical protein POPTR_0005s22450g           52.4    2e-04    



>ref|XP_009785963.1| PREDICTED: uncharacterized protein LOC104234138 isoform X3 [Nicotiana 
sylvestris]
Length=780

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAGNSTY QSLAAVLP
Sbjct  558  AVPQHLAVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGNSTYHQSLAAVLP  617

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD 
Sbjct  618  QYKNSVSVSSLPQSASVASGYGGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDT  677

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  678  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  737

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG LG     +Q QPK S QQLWQNSY
Sbjct  738  -PNFYHSQAGISLE--HQQQNPRDGSLGA----SQGQPKQSQQQLWQNSY  780



>ref|XP_009785957.1| PREDICTED: uncharacterized protein LOC104234138 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAGNSTY QSLAAVLP
Sbjct  619  AVPQHLAVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGNSTYHQSLAAVLP  678

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD 
Sbjct  679  QYKNSVSVSSLPQSASVASGYGGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDT  738

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  739  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  798

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG LG     +Q QPK S QQLWQNSY
Sbjct  799  -PNFYHSQAGISLE--HQQQNPRDGSLGA----SQGQPKQSQQQLWQNSY  841



>ref|XP_009785950.1| PREDICTED: uncharacterized protein LOC104234138 isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   324 bits (831),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAGNSTY QSLAAVLP
Sbjct  621  AVPQHLAVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGNSTYHQSLAAVLP  680

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT TIPG+FP+NP AAPS T+L  DD LSSQYKD 
Sbjct  681  QYKNSVSVSSLPQSASVASGYGGFGNTTTIPGNFPMNPPAAPSGTNLSYDDMLSSQYKDT  740

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  741  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  800

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG LG     +Q QPK S QQLWQNSY
Sbjct  801  -PNFYHSQAGISLE--HQQQNPRDGSLGA----SQGQPKQSQQQLWQNSY  843



>ref|XP_009614041.1| PREDICTED: uncharacterized protein LOC104107048 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  617  AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  676

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  677  QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  736

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  737  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  796

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  797  -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  839



>ref|XP_009614040.1| PREDICTED: uncharacterized protein LOC104107048 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  619  AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  678

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  679  QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  738

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  739  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  798

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  799  -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  841



>ref|XP_009614044.1| PREDICTED: uncharacterized protein LOC104107048 isoform X4 [Nicotiana 
tomentosiformis]
Length=783

 Score =   320 bits (819),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  561  AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  620

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  621  QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  680

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  681  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  740

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  741  -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  783



>ref|XP_009614043.1| PREDICTED: uncharacterized protein LOC104107048 isoform X3 [Nicotiana 
tomentosiformis]
Length=789

 Score =   319 bits (818),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 190/230 (83%), Gaps = 8/230 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPYSQPTLPLGPFAN+ISYPFM QSYTYMP  FQQPFAG+STY QSLAAVLP
Sbjct  567  AVPQHLTVHPYSQPTLPLGPFANMISYPFMPQSYTYMPSAFQQPFAGSSTYHQSLAAVLP  626

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA+V SGYG FGNT +IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  627  QYKNSVSVSSLPQSASVASGYGGFGNTASIPGNFPMNPAAAPSGTNLSYDDVLSSQYKDT  686

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQP QN+ SLGY
Sbjct  687  NHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQQSGGFRQAQQPMQNHGSLGY  746

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK S QQLWQNSY
Sbjct  747  -PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQSQQQLWQNSY  789



>emb|CDP17325.1| unnamed protein product [Coffea canephora]
Length=877

 Score =   318 bits (814),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 191/230 (83%), Gaps = 10/230 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA HPYSQPTLPLGPFAN+I YPF+ QSY YMP  FQQ FAGNSTY QSLAAVLP
Sbjct  657  ALPQHLAAHPYSQPTLPLGPFANMIGYPFLPQSYAYMP-SFQQAFAGNSTYHQSLAAVLP  715

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA V SGYGAFG++ T+PG+F +N  AAPS T+LG DD LS+QYKD+
Sbjct  716  QYKNSVSVSSLPQSAAVASGYGAFGSSTTVPGNFTMNQPAAPSGTNLGYDDVLSAQYKDS  775

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HL+SLQQ ++SGMWLHG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQNY SLGY
Sbjct  776  NHLISLQQSDSSGMWLHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQNYGSLGY  835

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTG+SLD  HQQQNPRDG L    G +Q QPK  SQQ+WQNSY
Sbjct  836  -PNFYHSQTGMSLD--HQQQNPRDGSL----GGSQGQPK-QSQQIWQNSY  877



>ref|XP_006355598.1| PREDICTED: signaling mucin HKR1-like [Solanum tuberosum]
Length=836

 Score =   315 bits (807),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            +PQHLAVHPY+QPTLPLGPF N+ISYPFM QSYTYMP  FQQPFAGNS Y QSLAAVLP 
Sbjct  614  VPQHLAVHPYNQPTLPLGPFGNMISYPFMPQSYTYMPSAFQQPFAGNSNYHQSLAAVLPQ  673

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKNSVSVSSLP  A+V S YG FGNT +IPG+FP+NPSAAPS T+L  DD LSSQYKD +
Sbjct  674  YKNSVSVSSLPQPASVASAYGGFGNTASIPGNFPMNPSAAPSGTNLSYDDMLSSQYKDTN  733

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
            HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQQ SGFRQ QQP QN+ SLGY 
Sbjct  734  HLMSLQQSENSAMWLHGPGSRTMSAVPANTYYAFQGQNQQSSGFRQAQQPLQNHGSLGY-  792

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  235
            PNFYHSQ GISL+  HQQQNPRD   G  GG +Q QPKP SQQLWQ
Sbjct  793  PNFYHSQAGISLE--HQQQNPRD---GSLGGGSQGQPKP-SQQLWQ  832



>gb|KDO78075.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=250

 Score =   295 bits (756),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 187/232 (81%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  736
            ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  27   ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  86

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  562
            P YKNSVSVSSLP SA V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  87   PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  145

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
            DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  146  DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  205

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  206  GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  250



>gb|KDO78070.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78071.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78072.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78073.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=304

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 187/232 (81%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  736
            ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  81   ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  140

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  562
            P YKNSVSVSSLP SA V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  141  PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  199

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
            DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  200  DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  259

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  260  GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  304



>ref|XP_007025176.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
 gb|EOY27798.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
Length=872

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 183/230 (80%), Gaps = 9/230 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHL +HP+SQPTLPLG FAN+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  651  ALPQHLPMHPFSQPTLPLGHFANMIGYPFLPQSYTYMPSAFQQAFAGNSTYPQSLAAVLP  710

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA V S YG FG++ +IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  711  QYKNSVSVSSLPQSAAVASAYG-FGSSTSIPGGLPLNPPTAPTGTTIGYDDVLSSQYKDS  769

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  770  NHLMSLQQNENSAMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPSQHFGALGY  829

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTG+S+D  HQQQNPRDG L       Q QP   +QQLWQNSY
Sbjct  830  -PNFYHSQTGVSMD--HQQQNPRDGSL----SGTQGQPSKQTQQLWQNSY  872



>ref|XP_006467531.1| PREDICTED: uncharacterized protein LOC102630898 isoform X2 [Citrus 
sinensis]
Length=854

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 187/232 (81%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  736
            ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  631  ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  690

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  562
            P YKNSVSVSSLP SA V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  691  PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  749

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
            DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  750  DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  809

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  810  GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  854



>ref|XP_006467530.1| PREDICTED: uncharacterized protein LOC102630898 isoform X1 [Citrus 
sinensis]
Length=869

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/232 (72%), Positives = 187/232 (81%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  736
            ALP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VL
Sbjct  646  ALPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVL  705

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYK  562
            P YKNSVSVSSLP SA V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYK
Sbjct  706  PQYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYK  764

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
            DN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  765  DNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGAL  824

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  825  GY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  869



>ref|XP_006377248.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
 gb|ERP55045.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
Length=894

 Score =   302 bits (773),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 185/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  671  ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQTFAGNNSYHQSLAAVLP  730

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FG++ +IP G+FPLN   AP+ T++G DD L SQYKD
Sbjct  731  QYKNSVSVSSLPQSAAVASGYG-FGSSTSIPAGNFPLNAPTAPAGTTIGYDDILGSQYKD  789

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HLMSLQQ ENS MWLHG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  790  ASHLMSLQQNENSAMWLHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  849

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  850  Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  894



>ref|XP_002317304.2| kinase-related family protein [Populus trichocarpa]
 gb|EEE97916.2| kinase-related family protein [Populus trichocarpa]
Length=909

 Score =   301 bits (772),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 185/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  686  ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQTFAGNNSYHQSLAAVLP  745

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FG++ +IP G+FPLN   AP+ T++G DD L SQYKD
Sbjct  746  QYKNSVSVSSLPQSAAVASGYG-FGSSTSIPAGNFPLNAPTAPAGTTIGYDDILGSQYKD  804

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HLMSLQQ ENS MWLHG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  805  ASHLMSLQQNENSAMWLHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  864

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  865  Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  909



>ref|XP_006449624.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62864.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=863

 Score =   300 bits (768),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 186/231 (81%), Gaps = 11/231 (5%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VLP  733
            LP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VLP
Sbjct  641  LPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVLP  700

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYKD
Sbjct  701  QYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKD  759

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            N+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  760  NNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  819

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  820  Y-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  863



>ref|XP_006449625.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62865.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=878

 Score =   300 bits (768),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 186/231 (81%), Gaps = 11/231 (5%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VLP  733
            LP HLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY QSLAA VLP
Sbjct  656  LPPHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQSLAAAVLP  715

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPG-SFPLN-PSAAPSTSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FGN+ +IPG +FPLN P+A   T++G DD L SQYKD
Sbjct  716  QYKNSVSVSSLPQSAAVASGYG-FGNSTSIPGGNFPLNTPTAPAGTTMGYDDVLGSQYKD  774

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            N+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  775  NNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQPSQHFGALG  834

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQLWQNSY
Sbjct  835  Y-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQLWQNSY  878



>emb|CBI30819.3| unnamed protein product [Vitis vinifera]
Length=799

 Score =   296 bits (759),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 184/232 (79%), Gaps = 10/232 (4%)
 Frame = -1

Query  912  ALPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQHL  VHPYSQP LPLG FAN+I YPF+ QSYTYMP  +QQ FAGNSTY QSLAAVL
Sbjct  575  ALPQHLPPVHPYSQPGLPLGHFANMIGYPFLPQSYTYMPSAYQQAFAGNSTYHQSLAAVL  634

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKD  559
            P YKNSVSVSSLP SA + SGYGAFG++ +IPG+F LN P+AA  T++G DD ++SQYKD
Sbjct  635  PQYKNSVSVSSLPQSAAIASGYGAFGSSTSIPGNFSLNPPTAAAGTTIGYDDVINSQYKD  694

Query  558  NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
             +HL+SLQQ  ENS MW+HG GSRTMSA PANTYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  695  GNHLISLQQQNENSAMWVHGPGSRTMSAVPANTYYSFQGQNQQPGGFRQGQQPSQHFGAL  754

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+WQN+Y
Sbjct  755  GY-PNFYHSQAGISLE--HQQQNPRDGSL----SGSQGQASKQSQQIWQNNY  799



>ref|XP_008225366.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Prunus mume]
Length=860

 Score =   297 bits (761),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 188/232 (81%), Gaps = 10/232 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  636  ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  695

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA +PSGYG FG++  IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  696  QYKNSVSVSSLPQSANIPSGYG-FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKD  754

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SL  382
            N HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +L
Sbjct  755  NSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGAL  814

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQQLWQN+Y
Sbjct  815  GYPPNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQQLWQNTY  860



>ref|XP_008225365.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Prunus mume]
Length=861

 Score =   297 bits (761),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 188/232 (81%), Gaps = 10/232 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  637  ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  696

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA +PSGYG FG++  IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  697  QYKNSVSVSSLPQSANIPSGYG-FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKD  755

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SL  382
            N HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +L
Sbjct  756  NSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGAL  815

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQQLWQN+Y
Sbjct  816  GYPPNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQQLWQNTY  861



>ref|XP_011005847.1| PREDICTED: uncharacterized protein LOC105112008 isoform X3 [Populus 
euphratica]
Length=869

 Score =   297 bits (760),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 186/231 (81%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  647  ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  706

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  707  QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  765

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  766  ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  825

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  826  Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  869



>ref|XP_010655630.1| PREDICTED: protein lingerer-like [Vitis vinifera]
Length=886

 Score =   297 bits (760),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 184/232 (79%), Gaps = 10/232 (4%)
 Frame = -1

Query  912  ALPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQHL  VHPYSQP LPLG FAN+I YPF+ QSYTYMP  +QQ FAGNSTY QSLAAVL
Sbjct  662  ALPQHLPPVHPYSQPGLPLGHFANMIGYPFLPQSYTYMPSAYQQAFAGNSTYHQSLAAVL  721

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKD  559
            P YKNSVSVSSLP SA + SGYGAFG++ +IPG+F LN P+AA  T++G DD ++SQYKD
Sbjct  722  PQYKNSVSVSSLPQSAAIASGYGAFGSSTSIPGNFSLNPPTAAAGTTIGYDDVINSQYKD  781

Query  558  NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
             +HL+SLQQ  ENS MW+HG GSRTMSA PANTYY+ Q QNQQP GFRQ QQPSQ++ +L
Sbjct  782  GNHLISLQQQNENSAMWVHGPGSRTMSAVPANTYYSFQGQNQQPGGFRQGQQPSQHFGAL  841

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+WQN+Y
Sbjct  842  GY-PNFYHSQAGISLE--HQQQNPRDGSL----SGSQGQASKQSQQIWQNNY  886



>ref|XP_011005848.1| PREDICTED: uncharacterized protein LOC105112008 isoform X4 [Populus 
euphratica]
Length=868

 Score =   296 bits (759),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 186/231 (81%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  646  ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  705

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  706  QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  764

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  765  ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  824

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  825  Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  868



>ref|XP_011045310.1| PREDICTED: uncharacterized protein LOC105140253 isoform X3 [Populus 
euphratica]
Length=841

 Score =   296 bits (757),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 184/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  618  ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQAFAGNNSYHQSLAAVLP  677

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FG++ ++P G+FPLN P+A   T+LG DD L SQYKD
Sbjct  678  QYKNSVSVSSLPQSAAVASGYG-FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKD  736

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  737  ASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALG  796

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  797  Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  841



>ref|XP_011005845.1| PREDICTED: uncharacterized protein LOC105112008 isoform X1 [Populus 
euphratica]
Length=875

 Score =   296 bits (759),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 186/231 (81%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  653  ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  712

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  713  QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  771

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  772  ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  831

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  832  Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  875



>ref|XP_011005846.1| PREDICTED: uncharacterized protein LOC105112008 isoform X2 [Populus 
euphratica]
Length=874

 Score =   296 bits (759),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 186/231 (81%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVH YSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F+GN+TY QSLAAVLP
Sbjct  652  ALPQHLAVHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAFQQTFSGNNTYHQSLAAVLP  711

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA VPSGYG +GN+ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  712  QYKNSVSVSSLPQSAAVPSGYG-YGNSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  770

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  771  ASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGVFRQSQQPSQHFGAPG  830

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  831  Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNSY  874



>gb|KDP21205.1| hypothetical protein JCGZ_21676 [Jatropha curcas]
Length=866

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 184/230 (80%), Gaps = 10/230 (4%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLAVHPYSQPTLPLGPF N+I YPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP 
Sbjct  645  LPQHLAVHPYSQPTLPLGPFTNMIGYPFLPQSYTYMPSAFQQTFAGNNTYHQSLAAVLPQ  704

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKDN  556
            YKNSVSVSSLP SA V S YG FG++ +IP G+FPLNP AAP  T+LG DD LSSQYKD 
Sbjct  705  YKNSVSVSSLPQSAAVASAYG-FGSSTSIPAGNFPLNPPAAPGGTTLGYDDVLSSQYKDG  763

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP GFRQ QQ SQ++ +LGY
Sbjct  764  NHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGGFRQGQQLSQHFGALGY  823

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PN+YHSQTGISL+  HQQQN RD  L    G +Q QP   +QQLWQNSY
Sbjct  824  -PNYYHSQTGISLE--HQQQNSRDASL----GGSQGQPSKQTQQLWQNSY  866



>ref|XP_011045309.1| PREDICTED: uncharacterized protein LOC105140253 isoform X2 [Populus 
euphratica]
Length=871

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 184/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  648  ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQAFAGNNSYHQSLAAVLP  707

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FG++ ++P G+FPLN P+A   T+LG DD L SQYKD
Sbjct  708  QYKNSVSVSSLPQSAAVASGYG-FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKD  766

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  767  ASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALG  826

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  827  Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  871



>ref|XP_011045308.1| PREDICTED: uncharacterized protein LOC105140253 isoform X1 [Populus 
euphratica]
Length=872

 Score =   296 bits (757),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 184/231 (80%), Gaps = 9/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPY QPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGN++Y QSLAAVLP
Sbjct  649  ALPQHLAVHPYQQPTLPLGHFANMISYPFMAQSYTYMPSAFQQAFAGNNSYHQSLAAVLP  708

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLN-PSAAPSTSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA V SGYG FG++ ++P G+FPLN P+A   T+LG DD L SQYKD
Sbjct  709  QYKNSVSVSSLPQSAAVASGYG-FGSSTSLPAGNFPLNAPTAPAGTTLGYDDILGSQYKD  767

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ++ +LG
Sbjct  768  ASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGGFRQGQQPSQHFGALG  827

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQLWQNSY
Sbjct  828  Y-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQLWQNSY  872



>gb|KHF99174.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=869

 Score =   295 bits (756),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 185/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GN+ Y QSLAA+LP
Sbjct  646  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNNNYPQSLAAMLP  705

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA +PSGYG FG++  IPG  PLNP  AP+ T++G +D LSSQYKDN
Sbjct  706  QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYEDVLSSQYKDN  764

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP-SQNYASLG  379
            +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQP SQ++ SLG
Sbjct  765  NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  824

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ-PKPSSQQLWQNSY  226
            Y PNFYHSQTG+SLD   QQQNPRDG L      +Q Q P   +QQLWQN+Y
Sbjct  825  Y-PNFYHSQTGVSLD--PQQQNPRDGSL----SGSQGQPPSKQTQQLWQNNY  869



>gb|KJB69765.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=867

 Score =   293 bits (751),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 183/232 (79%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+ QPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNS Y QSLAA+LP
Sbjct  644  ALPQHLAMHPFPQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNSNYPQSLAAMLP  703

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA +PSGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKDN
Sbjct  704  QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDVLSSQYKDN  762

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ-PSQNYASLG  379
            +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQ PSQ++ SLG
Sbjct  763  NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  822

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ-PKPSSQQLWQNSY  226
            Y PNFYHSQ G+SLD   QQQNPRDG L      +Q Q P   +QQLWQN+Y
Sbjct  823  Y-PNFYHSQMGVSLD--PQQQNPRDGSL----SGSQGQPPSKQTQQLWQNNY  867



>gb|KJB69763.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=869

 Score =   293 bits (751),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 183/232 (79%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+ QPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNS Y QSLAA+LP
Sbjct  646  ALPQHLAMHPFPQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNSNYPQSLAAMLP  705

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA +PSGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKDN
Sbjct  706  QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDVLSSQYKDN  764

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ-PSQNYASLG  379
            +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQ PSQ++ SLG
Sbjct  765  NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  824

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ-PKPSSQQLWQNSY  226
            Y PNFYHSQ G+SLD   QQQNPRDG L      +Q Q P   +QQLWQN+Y
Sbjct  825  Y-PNFYHSQMGVSLD--PQQQNPRDGSL----SGSQGQPPSKQTQQLWQNNY  869



>gb|KHN48057.1| hypothetical protein glysoja_015527 [Glycine soja]
Length=817

 Score =   291 bits (746),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 185/232 (80%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG FAN+I Y F+ QSYTYMP  FQQ F GNSTY QSLAA+LP
Sbjct  594  ALPQHLAVHPYSQPTLPLGHFANMIGYQFLPQSYTYMPSAFQQAFPGNSTYHQSLAAMLP  653

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA V SGYG FG++ +IP G++PLNP AAP ST++G DD ++SQYKD
Sbjct  654  QYKNSISVSSLPQSAAVASGYG-FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQYKD  712

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS-QNYASL  382
            N+H++SLQQ ENS MW+HG  SRTMSA PANTYY+ Q QNQQP GFRQ QQPS Q++ SL
Sbjct  713  NNHMISLQQNENSPMWVHGPSSRTMSAIPANTYYSFQGQNQQPGGFRQNQQPSQQHFGSL  772

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTGISL+  HQQQNPR+  L      +Q QP   S Q+WQNSY
Sbjct  773  GY-PNFYHSQTGISLE--HQQQNPREASL----AGSQTQPPKQSPQIWQNSY  817



>ref|XP_007214618.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
 gb|EMJ15817.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
Length=859

 Score =   292 bits (747),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 187/232 (81%), Gaps = 11/232 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  636  ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  695

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA +P GYG FG++  IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  696  QYKNSVSVSSLPQSANIPPGYG-FGSSTNIPGGNFPLNPPSAPTGTTIGYDDVINSQYKD  754

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYA-SL  382
            N HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +GFRQ QQPSQ +A +L
Sbjct  755  NSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAGFRQAQQPSQQFAGAL  814

Query  381  GYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQQLWQN+Y
Sbjct  815  GY-PNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQQLWQNTY  859



>ref|XP_004232971.1| PREDICTED: uncharacterized protein LOC101252351 [Solanum lycopersicum]
Length=833

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 179/226 (79%), Gaps = 11/226 (5%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            +PQHLAVHPY+QP  PLGPFAN+I YPF+ QSYTYMP  FQQPFAGNS Y QSLAAVLP 
Sbjct  614  VPQHLAVHPYNQP--PLGPFANMIGYPFLPQSYTYMPSAFQQPFAGNSNYHQSLAAVLPQ  671

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKNSVSVSSLP  A+V S YG FGNT +IPG+FP+NP AAPS T+L  DD LSSQYKD +
Sbjct  672  YKNSVSVSSLPQPASVASAYGGFGNTASIPGNFPMNPPAAPSGTNLSYDDVLSSQYKDTN  731

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
            HLMSLQQ ENS MW HG GSRTMSA PANTYY  Q QNQQ SGFRQ QQP QN+ SLGY 
Sbjct  732  HLMSLQQSENSAMW-HGPGSRTMSAVPANTYYGFQGQNQQSSGFRQAQQPLQNHGSLGY-  789

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  235
            PNFYHSQ GISL+  HQQQNPRD   G  GG +Q QPK   QQLWQ
Sbjct  790  PNFYHSQAGISLE--HQQQNPRD---GSLGGGSQGQPK-QFQQLWQ  829



>ref|XP_011096498.1| PREDICTED: uncharacterized protein LOC105175670 isoform X2 [Sesamum 
indicum]
Length=842

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 178/230 (77%), Gaps = 12/230 (5%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLAVHPYSQPTLPLGPF N+I YPF+ QSYTYMP  FQQ F+GNSTY QSLAA+LP 
Sbjct  623  LPQHLAVHPYSQPTLPLGPFTNMIGYPFLPQSYTYMPSAFQQTFSGNSTYHQSLAALLPQ  682

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKN+VS SSLP SA + SGYGAFGNT TIPG+FP+NP A PS T+L  DD L+SQYKD+ 
Sbjct  683  YKNNVSASSLPQSAAIASGYGAFGNTPTIPGNFPMNPPAGPSGTTLSYDDVLNSQYKDSS  742

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNYASLGY  376
            HL+SLQQ EN  +WLHG  SRTMSA PA+TYYN      Q   G RQ QQPSQNY SLGY
Sbjct  743  HLVSLQQNENPALWLHGANSRTMSAVPASTYYNYQGQNQQTGGGMRQAQQPSQNYGSLGY  802

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTGI+LD   QQQNPRD PL    G +Q QPK S  Q+WQNSY
Sbjct  803  -PNFYHSQTGIALD---QQQNPRDAPL----GGSQGQPKQS--QIWQNSY  842



>ref|XP_011096496.1| PREDICTED: uncharacterized protein LOC105175670 isoform X1 [Sesamum 
indicum]
Length=843

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 178/230 (77%), Gaps = 12/230 (5%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLAVHPYSQPTLPLGPF N+I YPF+ QSYTYMP  FQQ F+GNSTY QSLAA+LP 
Sbjct  624  LPQHLAVHPYSQPTLPLGPFTNMIGYPFLPQSYTYMPSAFQQTFSGNSTYHQSLAALLPQ  683

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKN+VS SSLP SA + SGYGAFGNT TIPG+FP+NP A PS T+L  DD L+SQYKD+ 
Sbjct  684  YKNNVSASSLPQSAAIASGYGAFGNTPTIPGNFPMNPPAGPSGTTLSYDDVLNSQYKDSS  743

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNYASLGY  376
            HL+SLQQ EN  +WLHG  SRTMSA PA+TYYN      Q   G RQ QQPSQNY SLGY
Sbjct  744  HLVSLQQNENPALWLHGANSRTMSAVPASTYYNYQGQNQQTGGGMRQAQQPSQNYGSLGY  803

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTGI+LD   QQQNPRD PL    G +Q QPK S  Q+WQNSY
Sbjct  804  -PNFYHSQTGIALD---QQQNPRDAPL----GGSQGQPKQS--QIWQNSY  843



>ref|XP_006369885.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
 gb|ERP66454.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
Length=867

 Score =   290 bits (742),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 185/231 (80%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+H YSQPTLPLG FAN+ISYPF+ QSYTYMP  +QQ F+GN+TY QSLAAVLP
Sbjct  645  ALPQHLAMHSYSQPTLPLGHFANMISYPFLAQSYTYMPSAYQQTFSGNNTYHQSLAAVLP  704

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA VPSGYG +G++ +IP G+FPLN  AAP+ T++G DD LSSQYKD
Sbjct  705  QYKNSVSVSSLPQSAAVPSGYG-YGSSTSIPTGNFPLNAPAAPAGTTIGYDDVLSSQYKD  763

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
              HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  FRQ QQPSQ++ + G
Sbjct  764  ASHLISLQQNENSAMWMHGPGSRTMSAVPASTYYNFQGQNQQPGVFRQGQQPSQHFGAPG  823

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQLWQN Y
Sbjct  824  Y-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQLWQNGY  867



>gb|KHF99173.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=891

 Score =   286 bits (732),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 6/208 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GN+ Y QSLAA+LP
Sbjct  646  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFTGNNNYPQSLAAMLP  705

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA +PSGYG FG++  IPG  PLNP  AP+ T++G +D LSSQYKDN
Sbjct  706  QYKNSVSVSSLPQSAAIPSGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYEDVLSSQYKDN  764

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP-SQNYASLG  379
            +HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  GFRQ QQP SQ++ SLG
Sbjct  765  NHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGGFRQGQQPPSQHFGSLG  824

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPL  295
            Y PNFYHSQTG+SLD   QQQNPRDG L
Sbjct  825  Y-PNFYHSQTGVSLD--PQQQNPRDGSL  849



>ref|XP_009790935.1| PREDICTED: uncharacterized protein LOC104238306 [Nicotiana sylvestris]
Length=852

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 178/231 (77%), Gaps = 6/231 (3%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPY+Q T+PLGPFAN+ISYPFMHQ+Y +MP  FQQ F GNSTY QSLAA+LP
Sbjct  626  AVPQHLTVHPYAQQTVPLGPFANMISYPFMHQNYPFMPSAFQQAFPGNSTYHQSLAAMLP  685

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNS SV SLP SA++PSGYGAFGNT  IPG+F +NP+AAPS T+L  DD LSSQYKD 
Sbjct  686  QYKNSASVDSLPQSASIPSGYGAFGNTTAIPGNFTINPAAAPSGTNLSYDDVLSSQYKDT  745

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLG  379
            +HLMSLQQ ENS +W HG GSRTMSA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SL 
Sbjct  746  NHLMSLQQSENSALWHHGLGSRTMSAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLA  805

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              P+FY+SQ GISLD   QQQN RD         +Q QPK S QQ+WQN Y
Sbjct  806  GYPHFYNSQAGISLD-QQQQQNLRDA---ASLAGSQGQPKQSQQQIWQNGY  852



>ref|XP_006356118.1| PREDICTED: cell wall protein AWA1-like [Solanum tuberosum]
Length=845

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 177/229 (77%), Gaps = 6/229 (3%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            +PQHL VH YSQ  +P+ PF N+ISYPF+HQ+Y+YMP  FQQ + GNS+Y QSLAA+LP 
Sbjct  622  VPQHLTVHQYSQQAVPIAPFGNMISYPFVHQNYSYMPSAFQQAYPGNSSYHQSLAAMLPQ  681

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKN+VS SSLP SA +PSGYGAFGNT  IPG+FP+NP AAPS T+L  DD LS+Q+KD +
Sbjct  682  YKNTVSASSLPQSAAIPSGYGAFGNTTNIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTN  741

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
            HLMSLQQ ENS +WLHG GSRTMSA PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  
Sbjct  742  HLMSLQQNENSALWLHGPGSRTMSAVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGY  801

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            P+FY+SQ GISLD   QQQN RDG L      +Q QPK S QQLWQN Y
Sbjct  802  PHFYNSQAGISLD-QQQQQNLRDGSL----SGSQGQPKQSQQQLWQNGY  845



>ref|XP_004162612.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224560 
[Cucumis sativus]
Length=844

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 182/231 (79%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  622  AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  681

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  682  QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  740

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  741  SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  800

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  801  Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  844



>ref|XP_004134562.1| PREDICTED: uncharacterized protein LOC101211388 [Cucumis sativus]
Length=845

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 182/231 (79%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  623  AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  682

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  683  QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  741

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  742  SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  801

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  802  Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  845



>ref|XP_008439673.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=846

 Score =   281 bits (720),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 182/231 (79%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  624  AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  683

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  684  QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  742

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  743  SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  802

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  803  Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  846



>ref|XP_008439672.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=847

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 182/231 (79%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  625  AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  684

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  685  QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  743

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  744  SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  803

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  804  Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  847



>gb|KGN49366.1| hypothetical protein Csa_6G522110 [Cucumis sativus]
Length=905

 Score =   281 bits (720),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 182/231 (79%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP GFQQ FAGNSTY Q+LAAVLP
Sbjct  683  AVPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSGFQQAFAGNSTYHQALAAVLP  742

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA + SGYG FG++ +IP G+FPLNP  AP+ +S+G +D +SSQYKD
Sbjct  743  QYKNSISVSSLPQSAAIASGYG-FGSSTSIPGGNFPLNPPTAPAGSSIGYEDAISSQYKD  801

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            ++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SGFRQ QQPSQ Y +LG
Sbjct  802  SNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSGFRQAQQPSQQYGALG  861

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ+WQNSY
Sbjct  862  Y-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQIWQNSY  905



>ref|XP_011460396.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101310004 
[Fragaria vesca subsp. vesca]
Length=841

 Score =   280 bits (716),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 184/233 (79%), Gaps = 12/233 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHL +HPYSQP+LPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  617  ALPQHL-MHPYSQPSLPLGHFSNMIGYPFLPQSYTYMPSAFQQAFAGNSTYHQSLAAVLP  675

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA VPSGYG FG++ +IP G+FPLNP +AP+ T++G DD +SSQYKD
Sbjct  676  QYKNSVSVSSLPQSANVPSGYG-FGSSTSIPGGNFPLNPPSAPTGTTIGYDDVISSQYKD  734

Query  558  NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
            ++HLMSLQQ  +NSGMW+HG GSR M A PA+ YY+ Q QNQQ +GFRQ QQPSQ +A  
Sbjct  735  SNHLMSLQQQNDNSGMWVHGPGSRAMPAVPASNYYSFQGQNQQHAGFRQTQQPSQQFAGA  794

Query  381  GYN-PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              N PNFYHSQTG+SLD  HQQQ+ RD  L    G +Q QP   SQQLWQNSY
Sbjct  795  ALNYPNFYHSQTGMSLD--HQQQSSRDASL----GGSQGQPSKQSQQLWQNSY  841



>ref|XP_009618328.1| PREDICTED: uncharacterized protein LOC104110515 isoform X2 [Nicotiana 
tomentosiformis]
Length=845

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPY+QPT+PLGPFAN+ISYPFMHQ+Y YMP  FQQ F GNSTY QSLAA+LP
Sbjct  619  AVPQHLTVHPYAQPTVPLGPFANMISYPFMHQNYPYMPSAFQQAFPGNSTYHQSLAAMLP  678

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNS SV SLP SA++PSGYGAFGNT  IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  679  QYKNSASVDSLPQSASIPSGYGAFGNTTAIPGNFPINPAAAPSGTNLSYDDVLSSQYKDT  738

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLG  379
            +HLMSLQQ ENS +W HG GSRT+SA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SLG
Sbjct  739  NHLMSLQQSENSALWHHGLGSRTISAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLG  798

Query  378  YNPNFYHSQTGIS  340
              P+FY+SQ GIS
Sbjct  799  GYPHFYNSQAGIS  811



>ref|XP_009618326.1| PREDICTED: uncharacterized protein LOC104110515 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQHL VHPY+QPT+PLGPFAN+ISYPFMHQ+Y YMP  FQQ F GNSTY QSLAA+LP
Sbjct  626  AVPQHLTVHPYAQPTVPLGPFANMISYPFMHQNYPYMPSAFQQAFPGNSTYHQSLAAMLP  685

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNS SV SLP SA++PSGYGAFGNT  IPG+FP+NP+AAPS T+L  DD LSSQYKD 
Sbjct  686  QYKNSASVDSLPQSASIPSGYGAFGNTTAIPGNFPINPAAAPSGTNLSYDDVLSSQYKDT  745

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-GFRQVQQPSQNYASLG  379
            +HLMSLQQ ENS +W HG GSRT+SA PANTYY  Q QNQQ + GFRQ QQPSQ+Y SLG
Sbjct  746  NHLMSLQQSENSALWHHGLGSRTISAVPANTYYGFQGQNQQTAGGFRQGQQPSQSYGSLG  805

Query  378  YNPNFYHSQTGIS  340
              P+FY+SQ GIS
Sbjct  806  GYPHFYNSQAGIS  818



>ref|XP_007159534.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
 gb|ESW31528.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
Length=847

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 183/229 (80%), Gaps = 11/229 (5%)
 Frame = -1

Query  903  QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  724
            QHLA+HPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAA+LP YK
Sbjct  627  QHLALHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQAFAGNNTYHQSLAAMLPQYK  686

Query  723  NSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKDNHH  550
            NS+SVSSLP SA V SGYG FG++ +IP G++PLNP AAP ST++G DD ++SQYKDN+H
Sbjct  687  NSISVSSLPQSAAVASGYG-FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQYKDNNH  745

Query  549  LMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV-QQPSQNYASLGYN  373
            ++SLQQ ENS MW+HG  SRTMSA P +TYY+ Q QNQQ  GFRQ  QQPSQ++ SLGY 
Sbjct  746  MISLQQNENSPMWVHGPSSRTMSAVPPSTYYSFQGQNQQAGGFRQSPQQPSQHFGSLGY-  804

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PNFYHSQ+G+SL+  H QQNPR+  L    G +Q QP   + Q+WQNSY
Sbjct  805  PNFYHSQSGVSLE--HPQQNPREATL----GGSQSQPPKQTPQIWQNSY  847



>ref|XP_010317412.1| PREDICTED: uncharacterized protein LOC101266097 isoform X2 [Solanum 
lycopersicum]
Length=822

 Score =   276 bits (705),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 177/229 (77%), Gaps = 6/229 (3%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            +PQHL VH YSQ  +P+ P+ N+ISYPF+ Q+Y+Y+P  FQQ + GNS+Y QSLAA+LP 
Sbjct  599  VPQHLTVHQYSQQAVPIAPYGNMISYPFVPQNYSYIPSAFQQAYPGNSSYHQSLAAMLPQ  658

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKN+VS SSLP SAT+PSGYGAFGNT +IPG+FP+NP AAPS T+L  DD LS+Q+KD +
Sbjct  659  YKNTVSASSLPQSATIPSGYGAFGNTTSIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTN  718

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
            HLMSLQQ ENS +WLHGHGSRTM   PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  
Sbjct  719  HLMSLQQNENSALWLHGHGSRTMPTVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGY  778

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            P+FY+SQ GISLD   QQ+N RDG L      +Q QPK S QQLWQN Y
Sbjct  779  PHFYNSQAGISLD-QQQQENLRDGSL----SGSQGQPKQSQQQLWQNGY  822



>ref|XP_002519742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42715.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 178/230 (77%), Gaps = 18/230 (8%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            AL QHLAVHPYSQPTLPLGPFAN+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  637  ALQQHLAVHPYSQPTLPLGPFANMIGYPFLPQSYTYMPSAFQQTFAGNSTYHQSLAAVLP  696

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNH  553
             YKNSVSV+SLP SA V S YG FG++ ++P         A  T++G DDGLSSQYKD +
Sbjct  697  QYKNSVSVTSLPQSAAVASAYG-FGSSTSVP---------AGGTTIGYDDGLSSQYKDGN  746

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS-QNYASLGY  376
            HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP+G+RQ QQ S Q++ +LGY
Sbjct  747  HLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPAGYRQGQQLSQQHFGALGY  806

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PN+YHSQTGISL+   QQQN R+G L    G +Q QP   +QQLWQNSY
Sbjct  807  -PNYYHSQTGISLE--LQQQNSREGSL----GGSQGQPSKQTQQLWQNSY  849



>ref|XP_004234052.1| PREDICTED: uncharacterized protein LOC101266097 isoform X1 [Solanum 
lycopersicum]
Length=843

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 177/229 (77%), Gaps = 6/229 (3%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            +PQHL VH YSQ  +P+ P+ N+ISYPF+ Q+Y+Y+P  FQQ + GNS+Y QSLAA+LP 
Sbjct  620  VPQHLTVHQYSQQAVPIAPYGNMISYPFVPQNYSYIPSAFQQAYPGNSSYHQSLAAMLPQ  679

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKN+VS SSLP SAT+PSGYGAFGNT +IPG+FP+NP AAPS T+L  DD LS+Q+KD +
Sbjct  680  YKNTVSASSLPQSATIPSGYGAFGNTTSIPGNFPINPPAAPSGTNLSYDDVLSAQFKDTN  739

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
            HLMSLQQ ENS +WLHGHGSRTM   PANTYY  Q QNQQ  GFRQ QQPSQ+Y SLG  
Sbjct  740  HLMSLQQNENSALWLHGHGSRTMPTVPANTYYGFQGQNQQTGGFRQGQQPSQSYGSLGGY  799

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            P+FY+SQ GISLD   QQ+N RDG L      +Q QPK S QQLWQN Y
Sbjct  800  PHFYNSQAGISLD-QQQQENLRDGSL----SGSQGQPKQSQQQLWQNGY  843



>ref|XP_010275810.1| PREDICTED: uncharacterized protein LOC104610735 isoform X2 [Nelumbo 
nucifera]
Length=889

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 177/238 (74%), Gaps = 16/238 (7%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
            ALPQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP  FQQ +AGNS Y QS AAV  
Sbjct  659  ALPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSAFQQAYAGNSAYHQSPAAVHS  718

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDG  580
                  LP YKNSVSVSSLP SA V SGYG FGN+  IPG+FPLNPS+ P ST++G DD 
Sbjct  719  AGVKYTLPQYKNSVSVSSLPQSAAVASGYGGFGNSTNIPGNFPLNPSSTPASTTIGYDDV  778

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            +SSQYKD +  + LQQ ENSGMW+HG GSRTMSA P +TYY+ Q Q+QQ  GFRQ QQPS
Sbjct  779  ISSQYKDGNQFIPLQQNENSGMWVHGLGSRTMSALPGSTYYSFQGQSQQHGGFRQGQQPS  838

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q+Y +LGY PNFY SQTG+S    H QQNP DG LGG  G +  Q    S Q+WQ++Y
Sbjct  839  QHYGALGY-PNFYQSQTGVS--QEHPQQNPNDGTLGGSQGASAKQ----SHQIWQHNY  889



>ref|XP_010275801.1| PREDICTED: uncharacterized protein LOC104610735 isoform X1 [Nelumbo 
nucifera]
Length=907

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 177/238 (74%), Gaps = 16/238 (7%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
            ALPQHLAVHPYSQPTLPLG FAN+I YPF+ QSYTYMP  FQQ +AGNS Y QS AAV  
Sbjct  677  ALPQHLAVHPYSQPTLPLGHFANMIGYPFLPQSYTYMPSAFQQAYAGNSAYHQSPAAVHS  736

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDG  580
                  LP YKNSVSVSSLP SA V SGYG FGN+  IPG+FPLNPS+ P ST++G DD 
Sbjct  737  AGVKYTLPQYKNSVSVSSLPQSAAVASGYGGFGNSTNIPGNFPLNPSSTPASTTIGYDDV  796

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            +SSQYKD +  + LQQ ENSGMW+HG GSRTMSA P +TYY+ Q Q+QQ  GFRQ QQPS
Sbjct  797  ISSQYKDGNQFIPLQQNENSGMWVHGLGSRTMSALPGSTYYSFQGQSQQHGGFRQGQQPS  856

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q+Y +LGY PNFY SQTG+S    H QQNP DG LGG  G +  Q    S Q+WQ++Y
Sbjct  857  QHYGALGY-PNFYQSQTGVS--QEHPQQNPNDGTLGGSQGASAKQ----SHQIWQHNY  907



>gb|EYU28172.1| hypothetical protein MIMGU_mgv1a001362mg [Erythranthe guttata]
Length=833

 Score =   271 bits (692),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 181/238 (76%), Gaps = 17/238 (7%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLAVHPYSQ TLPLGPF N+I YPF+ QSYTY+P  FQQ FAGNSTY QSLAA+LP 
Sbjct  603  LPQHLAVHPYSQHTLPLGPFTNMIGYPFLPQSYTYVPSAFQQTFAGNSTYHQSLAALLPQ  662

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YKNS+S  SLP SA +PSGYGAFGNT T+PG+F +NP AAP+  +L  DD LSSQYKDN 
Sbjct  663  YKNSISAGSLPQSAAIPSGYGAFGNTTTVPGNFQMNPPAAPTGATLSYDDVLSSQYKDNS  722

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
            HL+SLQQ ENS MWLHG  SRTMSA PA+TYYN Q Q+QQ  GFRQ QQPSQNY +LGY 
Sbjct  723  HLVSLQQNENSAMWLHGPNSRTMSAVPASTYYNYQGQSQQGGGFRQGQQPSQNYGALGY-  781

Query  372  PNFYHSQTGISLD---------HHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PNFYHSQTG+SLD            QQQN RDG L    G AQ QPK S  Q+WQN+Y
Sbjct  782  PNFYHSQTGMSLDQQQQQQQQQQQQQQQNARDGSL----GGAQGQPKQS--QIWQNNY  833



>ref|XP_006580202.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=845

 Score =   270 bits (690),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 186/235 (79%), Gaps = 14/235 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNSTY QSLAA+LP
Sbjct  619  ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQAFPGNSTYHQSLAAMLP  678

Query  732  NYKNSVSVSSLPHSATVP---SGYGAFGNTGTIPG-SFPLNPSAAP-STSLGIDDGLSSQ  568
             YKNS+SVSSLP SA      SGYG FG++ +IPG ++PLNP AAP ST++G DD ++SQ
Sbjct  679  QYKNSISVSSLPQSAAAAAVASGYG-FGSSTSIPGGNYPLNPPAAPTSTTIGYDDVINSQ  737

Query  567  YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ-NY  391
            +K+N+H++SLQQ ENS MW+HG  SRTMSA P +TYY+ Q QNQQP GFRQ QQPSQ ++
Sbjct  738  FKENNHIISLQQNENSPMWVHGPSSRTMSAVPPSTYYSFQGQNQQPGGFRQSQQPSQQHF  797

Query  390  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             SLGY PNFYHSQTGISL+  HQQQNPR+  L      +Q QP   SQQ+WQNSY
Sbjct  798  GSLGY-PNFYHSQTGISLE--HQQQNPREASL----AGSQSQPPKQSQQIWQNSY  845



>ref|XP_010243690.1| PREDICTED: uncharacterized protein LOC104587685 isoform X2 [Nelumbo 
nucifera]
Length=855

 Score =   270 bits (690),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 171/237 (72%), Gaps = 16/237 (7%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQHL VHPYSQP LPLG FANII YPF+ QSYTYMP  +QQ +AGN+ YQQS AAV   
Sbjct  626  LPQHLTVHPYSQPALPLGHFANIIGYPFLPQSYTYMPSAYQQAYAGNNAYQQSPAAVHNT  685

Query  738  -----LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGL  577
                 LP YKNSVS SSLPHS  V SGYG FGN+  IPGSFPLNPS+ P ST++G DD +
Sbjct  686  GVKYTLPQYKNSVSASSLPHSTAVASGYGGFGNSTNIPGSFPLNPSSTPASTTIGYDDVI  745

Query  576  SSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ  397
            SSQYKD +H + LQQ +NS MW+HG GSRTMSA PA+TYY+ Q Q+QQ  GFRQ QQPSQ
Sbjct  746  SSQYKDGNHFIPLQQNDNSAMWVHGPGSRTMSALPASTYYSFQGQSQQHGGFRQAQQPSQ  805

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +Y +LGY PNFY SQ  +S    H QQNP DG L      +Q  P   S Q+WQ++Y
Sbjct  806  HYGALGY-PNFYQSQPRVS--QEHPQQNPNDGTL----AGSQGVPTKQSHQIWQHNY  855



>ref|XP_010243689.1| PREDICTED: uncharacterized protein LOC104587685 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   270 bits (690),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 171/237 (72%), Gaps = 16/237 (7%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQHL VHPYSQP LPLG FANII YPF+ QSYTYMP  +QQ +AGN+ YQQS AAV   
Sbjct  646  LPQHLTVHPYSQPALPLGHFANIIGYPFLPQSYTYMPSAYQQAYAGNNAYQQSPAAVHNT  705

Query  738  -----LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGL  577
                 LP YKNSVS SSLPHS  V SGYG FGN+  IPGSFPLNPS+ P ST++G DD +
Sbjct  706  GVKYTLPQYKNSVSASSLPHSTAVASGYGGFGNSTNIPGSFPLNPSSTPASTTIGYDDVI  765

Query  576  SSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ  397
            SSQYKD +H + LQQ +NS MW+HG GSRTMSA PA+TYY+ Q Q+QQ  GFRQ QQPSQ
Sbjct  766  SSQYKDGNHFIPLQQNDNSAMWVHGPGSRTMSALPASTYYSFQGQSQQHGGFRQAQQPSQ  825

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +Y +LGY PNFY SQ  +S    H QQNP DG L      +Q  P   S Q+WQ++Y
Sbjct  826  HYGALGY-PNFYQSQPRVS--QEHPQQNPNDGTL----AGSQGVPTKQSHQIWQHNY  875



>ref|XP_011085623.1| PREDICTED: uncharacterized protein LOC105167549 [Sesamum indicum]
Length=848

 Score =   270 bits (689),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 180/229 (79%), Gaps = 11/229 (5%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLAVHPYSQPTLPLGPFAN+I YPF+ QSYTYMP  FQQ FAG+STY QSLAAVLP 
Sbjct  630  LPQHLAVHPYSQPTLPLGPFANMIGYPFLPQSYTYMPSAFQQSFAGSSTYHQSLAAVLPQ  689

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            YK+SVSVSSLP SA V SGYGAFG+T TI G++P+NP AAPS T+L  DD LSSQYKD+ 
Sbjct  690  YKSSVSVSSLPQSAAVASGYGAFGSTATIAGNYPMNPPAAPSGTTLSYDDVLSSQYKDSS  749

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYN  373
             L+SLQQ ENS MWLHG  SRTM A PA+TYYN Q QNQQP GFRQ QQ SQ+Y S GY 
Sbjct  750  QLLSLQQNENSAMWLHGPNSRTMPAVPASTYYNYQGQNQQPGGFRQGQQQSQSYGSPGY-  808

Query  372  PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PNFYHSQTGI LD   QQQNPRDG +      +Q QPK S  Q+W NSY
Sbjct  809  PNFYHSQTGILLD---QQQNPRDGSI----AGSQGQPKQS--QIWPNSY  848



>gb|KHG18569.1| Protein translocase subunit SecA [Gossypium arboreum]
Length=851

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 179/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGNS Y QSLAAVLP
Sbjct  630  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQGFAGNSNYPQSLAAVLP  689

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  690  QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  748

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ + +LGY
Sbjct  749  NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQQFGALGY  808

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  809  -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  851



>gb|KJB57294.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=722

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 180/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  501  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  560

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  561  QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  619

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  620  NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY  679

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  680  -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  722



>gb|KJB57297.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57298.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=761

 Score =   266 bits (680),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 180/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  540  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  599

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  600  QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  658

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  659  NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY  718

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  719  -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  761



>gb|KJB57295.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57300.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=869

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 180/230 (78%), Gaps = 9/230 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  648  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  707

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  708  QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  766

Query  555  HHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY  376
            +HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  GFRQ QQPSQ++ +LGY
Sbjct  767  NHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGGFRQGQQPSQHFGALGY  826

Query  375  NPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQLWQN+Y
Sbjct  827  -PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQLWQNNY  869



>ref|XP_008358625.1| PREDICTED: cell wall protein RBR3-like [Malus domestica]
Length=312

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 185/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  82   ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  141

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F ++ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  142  QYKNSVSASSLPQSANIPPGYG-FSSSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  200

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q  QPSQ Y
Sbjct  201  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPQPSQQY  260

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
            A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQN+Y
Sbjct  261  AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNNY  312



>ref|XP_003629905.1| hypothetical protein MTR_8g088190 [Medicago truncatula]
 gb|AET04381.1| plant/F15D2-27 protein [Medicago truncatula]
Length=865

 Score =   263 bits (671),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 181/233 (78%), Gaps = 15/233 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            +LPQHLAVHPYSQ    LGPFAN+ISYPFM QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  644  SLPQHLAVHPYSQ----LGPFANMISYPFMPQSYTYMPSAFQQAFAGNSTYHQSLAAVLP  699

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA +PSGYG FG++ +IP G++PLNPSAAP ST++G DD ++SQYKD
Sbjct  700  QYKNSISVSSLPQSAAIPSGYG-FGSSTSIPGGNYPLNPSAAPTSTTIGYDDVINSQYKD  758

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQN-QQPSGFRQVQQPS-QNYAS  385
            N+H++SLQQ EN+ MW+ G GSRTMS  P+ TYY+ Q QN QQP  FRQ QQPS Q++A 
Sbjct  759  NNHMISLQQNENNPMWVQGPGSRTMSVPPS-TYYSFQGQNQQQPGAFRQSQQPSQQHFAP  817

Query  384  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             GY  NFYHSQ+GISL+  HQQQNPRD  L G       Q   S QQLWQNSY
Sbjct  818  HGYPNNFYHSQSGISLE--HQQQNPRDASLAGSQSQPPKQ---SQQQLWQNSY  865



>ref|XP_008364176.1| PREDICTED: uncharacterized protein LOC103427870 isoform X3 [Malus 
domestica]
Length=856

 Score =   262 bits (670),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 184/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627  ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA +P GYG F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  687  QYKNSVSVSSLPQSANIPPGYG-FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKD  745

Query  558  NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA  388
            N HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA
Sbjct  746  NSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYA  805

Query  387  -SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  226
             +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  806  GTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  856



>ref|XP_008364175.1| PREDICTED: uncharacterized protein LOC103427870 isoform X2 [Malus 
domestica]
Length=857

 Score =   262 bits (670),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 184/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  628  ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  687

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA +P GYG F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  688  QYKNSVSVSSLPQSANIPPGYG-FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKD  746

Query  558  NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA  388
            N HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA
Sbjct  747  NSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYA  806

Query  387  -SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  226
             +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  807  GTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  857



>ref|XP_008364174.1| PREDICTED: uncharacterized protein LOC103427870 isoform X1 [Malus 
domestica]
Length=857

 Score =   262 bits (669),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627  ALPQHLAVHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVSVSSLP SA +P GYG F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKD
Sbjct  687  QYKNSVSVSSLPQSANIPPGYG-FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKD  745

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  746  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQY  805

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  226
            A +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  806  AGTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  857



>ref|XP_009353841.1| PREDICTED: uncharacterized protein LOC103945058 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009360834.1| PREDICTED: uncharacterized protein LOC103951238 isoform X3 [Pyrus 
x bretschneideri]
Length=856

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 184/236 (78%), Gaps = 13/236 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627  ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  687  QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  745

Query  558  NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA  388
            N HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA
Sbjct  746  NSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQYA  805

Query  387  -SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
             +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  806  GALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353840.1| PREDICTED: uncharacterized protein LOC103945058 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009360833.1| PREDICTED: uncharacterized protein LOC103951238 isoform X2 [Pyrus 
x bretschneideri]
Length=856

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  626  ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  685

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  686  QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  744

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  745  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  804

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
            A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  805  AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353842.1| PREDICTED: uncharacterized protein LOC103945058 isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009360836.1| PREDICTED: uncharacterized protein LOC103951238 isoform X4 [Pyrus 
x bretschneideri]
Length=855

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  625  ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  684

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  685  QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  743

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  744  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  803

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
            A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  804  AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  855



>ref|XP_009353839.1| PREDICTED: uncharacterized protein LOC103945058 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360832.1| PREDICTED: uncharacterized protein LOC103951238 isoform X1 [Pyrus 
x bretschneideri]
Length=856

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  626  ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  685

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  686  QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  744

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  745  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  804

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
            A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  805  AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  856



>ref|XP_009353838.1| PREDICTED: uncharacterized protein LOC103945058 isoform X1 [Pyrus 
x bretschneideri]
Length=857

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 184/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  627  ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  686

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F N+ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  687  QYKNSVSASSLPQSANIPPGYG-FSNSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  745

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ Y
Sbjct  746  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPPPSQQY  805

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
            A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQNSY
Sbjct  806  AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNSY  857



>ref|XP_004504230.1| PREDICTED: serine/threonine-protein kinase pakD-like [Cicer arietinum]
Length=861

 Score =   259 bits (663),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 178/231 (77%), Gaps = 10/231 (4%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            +LPQHLAVHPYSQPTLPLG FAN+ISYPFM QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  639  SLPQHLAVHPYSQPTLPLGHFANMISYPFMPQSYTYMPSAFQQAFAGNSTYHQSLAAVLP  698

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAP-STSLGIDDGLSSQYKD  559
             YKNS+SVSSLP SA +PSGYG FG++ +IP G++PLNPSA P ST++G DD +SSQYK+
Sbjct  699  QYKNSISVSSLPQSAAIPSGYG-FGSSTSIPGGNYPLNPSAPPTSTAIGYDDVISSQYKE  757

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            N+H++SLQQ ENS MW+ G GSRTMS  P+  Y       QQ  GFRQ QQPSQ++   G
Sbjct  758  NNHMISLQQNENSPMWVQGPGSRTMSVPPSTYYSFQGQNQQQAGGFRQNQQPSQHFGPHG  817

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y PN+YHSQ+GISL+  HQQQNPRD  L      +Q Q    SQQLWQNSY
Sbjct  818  Y-PNYYHSQSGISLE--HQQQNPRDASL----AGSQQQNPKQSQQLWQNSY  861



>ref|XP_008366008.1| PREDICTED: protein lingerer-like [Malus domestica]
Length=856

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 185/237 (78%), Gaps = 14/237 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HPYSQPTLPLG F+N+I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP
Sbjct  626  ALPQHLAMHPYSQPTLPLGHFSNMIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLP  685

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKNSVS SSLP SA +P GYG F ++ +IP G+FPLNPS+AP+ T++G DD ++SQ+KD
Sbjct  686  QYKNSVSASSLPQSANIPPGYG-FSSSASIPGGNFPLNPSSAPTGTTIGYDDVVNSQFKD  744

Query  558  NHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNY  391
            N HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +GFR  Q  QPSQ Y
Sbjct  745  NSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHTGFRQAQQPQPSQQY  804

Query  390  A-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ-LWQNSY  226
            A +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP   SQQ LWQN+Y
Sbjct  805  AGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSKQSQQHLWQNNY  856



>ref|XP_010666705.1| PREDICTED: uncharacterized protein LOC104883839 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=847

 Score =   241 bits (614),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 171/235 (73%), Gaps = 21/235 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFA--NIISYPFMHQSYTYMPPGFQQPFA-GNSTYQQSLAA  742
            AL QHL VHPYSQ ++P+G FA  N+I YPF+ Q+YTYMP  FQQ FA GNSTY QSLAA
Sbjct  628  ALQQHL-VHPYSQHSVPMGHFAAANMIGYPFLPQNYTYMPSAFQQAFAAGNSTYPQSLAA  686

Query  741  -VLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQ  568
             VLP YKNSVSVSSLP +A VPSGYGAFGN+ +IP +FPLNP +AP+ TS+  DD LSSQ
Sbjct  687  AVLPQYKNSVSVSSLPQAAAVPSGYGAFGNSNSIPNNFPLNPPSAPAGTSVNYDDLLSSQ  746

Query  567  YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNY  391
            YKD  HL+SLQQ         G GSRT+S  P +TYYN  Q QNQQP+GFRQ QQPSQ+Y
Sbjct  747  YKDASHLLSLQQ---------GAGSRTLSGVPGSTYYNSFQGQNQQPAGFRQSQQPSQHY  797

Query  390  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              L   PNFYHSQ+G+SLD H QQQ  RDG L      +Q Q    +QQLWQNSY
Sbjct  798  GQLSGYPNFYHSQSGLSLD-HQQQQMSRDGSL----SGSQGQQPKQTQQLWQNSY  847



>ref|XP_010666704.1| PREDICTED: uncharacterized protein LOC104883839 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=858

 Score =   241 bits (614),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 171/235 (73%), Gaps = 21/235 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFA--NIISYPFMHQSYTYMPPGFQQPFA-GNSTYQQSLAA  742
            AL QHL VHPYSQ ++P+G FA  N+I YPF+ Q+YTYMP  FQQ FA GNSTY QSLAA
Sbjct  639  ALQQHL-VHPYSQHSVPMGHFAAANMIGYPFLPQNYTYMPSAFQQAFAAGNSTYPQSLAA  697

Query  741  -VLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQ  568
             VLP YKNSVSVSSLP +A VPSGYGAFGN+ +IP +FPLNP +AP+ TS+  DD LSSQ
Sbjct  698  AVLPQYKNSVSVSSLPQAAAVPSGYGAFGNSNSIPNNFPLNPPSAPAGTSVNYDDLLSSQ  757

Query  567  YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPSGFRQVQQPSQNY  391
            YKD  HL+SLQQ         G GSRT+S  P +TYYN  Q QNQQP+GFRQ QQPSQ+Y
Sbjct  758  YKDASHLLSLQQ---------GAGSRTLSGVPGSTYYNSFQGQNQQPAGFRQSQQPSQHY  808

Query  390  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              L   PNFYHSQ+G+SLD H QQQ  RDG L      +Q Q    +QQLWQNSY
Sbjct  809  GQLSGYPNFYHSQSGLSLD-HQQQQMSRDGSL----SGSQGQQPKQTQQLWQNSY  858



>ref|XP_010056862.1| PREDICTED: uncharacterized protein LOC104444809 isoform X3 [Eucalyptus 
grandis]
Length=833

 Score =   240 bits (612),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 169/233 (73%), Gaps = 12/233 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAVL  736
            ALPQHLA+HPYSQPTLPLGPFAN++SYPF+ QSY+Y+PP  FQQ F GNSTY QSLAA+L
Sbjct  609  ALPQHLAMHPYSQPTLPLGPFANMVSYPFLPQSYSYVPPSAFQQTFTGNSTYHQSLAALL  668

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKD  559
            P YKNS+S SSLP S  +PSGYG  G+TG   G+F LNP +AP +T+LG DD LSSQYKD
Sbjct  669  PQYKNSLSSSSLPQSGAIPSGYGFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKD  728

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYAS  385
             + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ S
Sbjct  729  ANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGS  788

Query  384  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            L Y PNFY S  GISL+  HQQQ  RD  LGG            S Q+WQN+Y
Sbjct  789  LNY-PNFYQS-AGISLE--HQQQIARDSSLGGSQSQQAK----QSAQIWQNTY  833



>ref|XP_010056860.1| PREDICTED: uncharacterized protein LOC104444809 isoform X1 [Eucalyptus 
grandis]
 gb|KCW73755.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=859

 Score =   240 bits (612),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 171/233 (73%), Gaps = 12/233 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAVL  736
            ALPQHLA+HPYSQPTLPLGPFAN++SYPF+ QSY+Y+PP  FQQ F GNSTY QSLAA+L
Sbjct  635  ALPQHLAMHPYSQPTLPLGPFANMVSYPFLPQSYSYVPPSAFQQTFTGNSTYHQSLAALL  694

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKD  559
            P YKNS+S SSLP S  +PSGYG  G+TG   G+F LNP +AP +T+LG DD LSSQYKD
Sbjct  695  PQYKNSLSSSSLPQSGAIPSGYGFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKD  754

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYAS  385
             + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ S
Sbjct  755  ANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGS  814

Query  384  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            L Y PNFY S  GISL+  HQQQ  RD  L    G +Q Q    S Q+WQN+Y
Sbjct  815  LNY-PNFYQS-AGISLE--HQQQIARDSSL----GGSQSQQAKQSAQIWQNTY  859



>ref|XP_010056861.1| PREDICTED: uncharacterized protein LOC104444809 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73756.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=857

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 171/233 (73%), Gaps = 12/233 (5%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAVL  736
            ALPQHLA+HPYSQPTLPLGPFAN++SYPF+ QSY+Y+PP  FQQ F GNSTY QSLAA+L
Sbjct  633  ALPQHLAMHPYSQPTLPLGPFANMVSYPFLPQSYSYVPPSAFQQTFTGNSTYHQSLAALL  692

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAP-STSLGIDDGLSSQYKD  559
            P YKNS+S SSLP S  +PSGYG  G+TG   G+F LNP +AP +T+LG DD LSSQYKD
Sbjct  693  PQYKNSLSSSSLPQSGAIPSGYGFNGSTGIPGGNFSLNPPSAPATTTLGYDDALSSQYKD  752

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYAS  385
             + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+G R  Q QQPSQ++ S
Sbjct  753  ANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPTGIRQGQGQQPSQHFGS  812

Query  384  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            L Y PNFY S  GISL+  HQQQ  RD  L    G +Q Q    S Q+WQN+Y
Sbjct  813  LNY-PNFYQS-AGISLE--HQQQIARDSSL----GGSQSQQAKQSAQIWQNTY  857



>ref|XP_006597650.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=800

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 180/236 (76%), Gaps = 15/236 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP
Sbjct  573  ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLP  632

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKN+VS SSLP SA +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KD
Sbjct  633  QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKD  691

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQN  394
            N+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ         +Q QQPSQ+
Sbjct  692  NNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQH  751

Query  393  YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +  LGY PNFY SQTGISL+  HQ QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  752  FGPLGY-PNFYQSQTGISLE--HQPQNPREASL----GGPQSQPSKQSQQIWQNSY  800



>ref|XP_004486425.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=831

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 159/199 (80%), Gaps = 5/199 (3%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLA+HPYSQPTLPLG FAN+ISYP + QSY YMP  FQQ FAGN+ Y QSLAA+LP 
Sbjct  609  LPQHLAMHPYSQPTLPLGHFANMISYPLLPQSYAYMPSAFQQTFAGNNAYHQSLAALLPQ  668

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIP--GSFPLN-PSAAPSTSLGIDDGLSSQYKD  559
            YK+SVSVS++P SA +P GYG F ++ +IP  GSF LN P+AA  T++G ++ ++SQ KD
Sbjct  669  YKSSVSVSNVPPSANIPPGYG-FNSSTSIPGGGSFSLNPPAAATGTTIGYENVINSQLKD  727

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            N H++SLQQ ENS +WL G GSRTM A P + YY++Q QNQQPSGF+Q QQP+Q++ SLG
Sbjct  728  NSHMISLQQNENSPIWLQGPGSRTMPAVPPSAYYSLQGQNQQPSGFQQRQQPTQHFGSLG  787

Query  378  YNPNFYHSQTGISLDHHHQ  322
            + PNFY SQ+GISL+H HQ
Sbjct  788  H-PNFYQSQSGISLEHQHQ  805



>ref|XP_006597649.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=832

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 180/236 (76%), Gaps = 15/236 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP
Sbjct  605  ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLP  664

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKN+VS SSLP SA +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KD
Sbjct  665  QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKD  723

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQN  394
            N+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ         +Q QQPSQ+
Sbjct  724  NNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQH  783

Query  393  YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +  LGY PNFY SQTGISL+  HQ QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  784  FGPLGY-PNFYQSQTGISLE--HQPQNPREASL----GGPQSQPSKQSQQIWQNSY  832



>gb|KHN14369.1| hypothetical protein glysoja_012407 [Glycine soja]
Length=831

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 180/236 (76%), Gaps = 15/236 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLAVHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP
Sbjct  604  ALPQHLAVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLP  663

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKN+VS SSLP SA +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KD
Sbjct  664  QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDLINSQFKD  722

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-----PSGFRQVQQPSQN  394
            N+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ         +Q QQPSQ+
Sbjct  723  NNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRQQQQQQPSQH  782

Query  393  YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +  LGY PNFY SQTGISL+  HQ QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  783  FGPLGY-PNFYQSQTGISLE--HQPQNPREASL----GGPQSQPSKQSQQIWQNSY  831



>ref|XP_008797517.1| PREDICTED: uncharacterized protein LOC103712704 isoform X2 [Phoenix 
dactylifera]
Length=733

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 168/239 (70%), Gaps = 20/239 (8%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  739
             LPQHL VH Y+QPTLPLG FAN+ISY F+ QSYTY+P   FQQP+ GN  + QS AAV 
Sbjct  505  VLPQHLPVHHYAQPTLPLGHFANMISYQFLPQSYTYLPSAAFQQPYTGNGPFHQSPAAVP  564

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDD  583
                   LP YK+SVS++SLP SA V SGYG FG++  IPGSF  NP SA+ ST++G D+
Sbjct  565  GAGIKYPLPQYKSSVSMTSLPQSAAVVSGYGGFGSSTNIPGSFTRNPTSASASTTIGFDE  624

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+YN Q Q+Q  SGFRQ QQP
Sbjct  625  SLSSQYKEANHYMPLQQTDNPAMWVHGAGSRTMSALPASTFYNFQGQSQH-SGFRQGQQP  683

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ + + GY PNFYHSQ G+S +H   QQNP +G L      +Q  P   S Q+WQ+SY
Sbjct  684  SQ-FGAPGY-PNFYHSQAGVSQEH---QQNPGEGNL----NGSQATPSQPSHQIWQHSY  733



>ref|XP_008797516.1| PREDICTED: uncharacterized protein LOC103712704 isoform X1 [Phoenix 
dactylifera]
Length=893

 Score =   235 bits (600),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 168/239 (70%), Gaps = 20/239 (8%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  739
             LPQHL VH Y+QPTLPLG FAN+ISY F+ QSYTY+P   FQQP+ GN  + QS AAV 
Sbjct  665  VLPQHLPVHHYAQPTLPLGHFANMISYQFLPQSYTYLPSAAFQQPYTGNGPFHQSPAAVP  724

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDD  583
                   LP YK+SVS++SLP SA V SGYG FG++  IPGSF  NP SA+ ST++G D+
Sbjct  725  GAGIKYPLPQYKSSVSMTSLPQSAAVVSGYGGFGSSTNIPGSFTRNPTSASASTTIGFDE  784

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+YN Q Q+Q  SGFRQ QQP
Sbjct  785  SLSSQYKEANHYMPLQQTDNPAMWVHGAGSRTMSALPASTFYNFQGQSQH-SGFRQGQQP  843

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ + + GY PNFYHSQ G+S +H   QQNP +G L      +Q  P   S Q+WQ+SY
Sbjct  844  SQ-FGAPGY-PNFYHSQAGVSQEH---QQNPGEGNL----NGSQATPSQPSHQIWQHSY  893



>ref|XP_010926244.1| PREDICTED: uncharacterized protein LOC105048593 [Elaeis guineensis]
Length=886

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 168/239 (70%), Gaps = 20/239 (8%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  739
             +PQ L VH Y+QPTLPLG FAN+ISY F+ QSYTY+P   FQQP+ GN  + QS AAV 
Sbjct  658  VVPQQLPVHHYAQPTLPLGHFANMISYQFLPQSYTYLPSAAFQQPYTGNGPFHQSPAAVP  717

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDD  583
                   LP YK+SVSV+SLP SA V SGYG FG++  IPGSF  NP SA+ ST++G D+
Sbjct  718  SAGIKYTLPQYKSSVSVTSLPQSAAVVSGYGGFGSSTNIPGSFTRNPTSASASTTIGFDE  777

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+Y+ Q Q+Q  SGFRQ QQP
Sbjct  778  SLSSQYKEANHYMPLQQNDNPAMWVHGAGSRTMSALPASTFYSFQGQSQH-SGFRQSQQP  836

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ + +LGY PNFYHSQ GIS +H   QQNP +G L      +Q  P   S Q+WQ+SY
Sbjct  837  SQ-FGALGY-PNFYHSQAGISQEH---QQNPGEGNL----NGSQATPSQPSHQIWQHSY  886



>ref|XP_008349816.1| PREDICTED: serine/threonine-protein kinase CBK1-like [Malus domestica]
Length=208

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 162/214 (76%), Gaps = 14/214 (7%)
 Frame = -1

Query  843  IISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVSVSSLPHSATVPSGYGA  664
            +I YPF+ QSYTYMP  FQQ FAGNSTY QSLAAVLP YKNSVSVSSLP SA +P GYG 
Sbjct  1    MIGYPFLPQSYTYMPSAFQQQFAGNSTYHQSLAAVLPQYKNSVSVSSLPQSANIPPGYG-  59

Query  663  FGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHG  496
            F ++ +IP G+FPLNP +AP+ T++G DD ++SQYKDN HL+SLQQ   +NSGMW+HG G
Sbjct  60   FSSSTSIPGGNFPLNPPSAPTGTTMGYDDVVNSQYKDNSHLISLQQQQNDNSGMWVHGPG  119

Query  495  SRTMSAAPANTYYNIQAQNQQPSGFR--QVQQPSQNYA-SLGYNPNFYHSQTGISLDHHH  325
            SR MSA PA+ YY+ Q QNQQ +GFR  Q   PSQ YA +LGY PNFYHSQTG+SL+ H 
Sbjct  120  SRAMSAVPASNYYSFQGQNQQHAGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQ  177

Query  324  QQQNPRDGPLggggGNAQVQP-KPSSQQLWQNSY  226
            QQQ+ RD  LG   G    QP K S QQLWQNSY
Sbjct  178  QQQSSRDASLGXSQGG---QPSKQSQQQLWQNSY  208



>ref|XP_010924304.1| PREDICTED: signaling mucin HKR1-like [Elaeis guineensis]
Length=887

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 167/238 (70%), Gaps = 20/238 (8%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV--  739
            LPQHL VH Y+QPTLPL  FAN+IS+PF+ QSYTY+P   FQQP+  N  + QS A +  
Sbjct  660  LPQHLPVHHYTQPTLPLSHFANMISFPFLPQSYTYLPSAAFQQPYTSNGPFHQSPAPIPN  719

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPS-AAPSTSLGIDDG  580
                  LP YK+SVSV+SLP SA+V S YG FG++  +PGSF LNP+ A+ ST++G+++ 
Sbjct  720  AGIKYTLPQYKSSVSVTSLPQSASVASAYGGFGSSANLPGSFTLNPTTASASTTIGLEEA  779

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+Y+ Q QNQ  SGFRQ QQPS
Sbjct  780  LSSQYKEANHYMPLQQADNPAMWVHGAGSRTMSALPASTFYSFQGQNQH-SGFRQGQQPS  838

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q + +LGY PNFY SQ G+S +H   QQNP +G L      +Q  P   S Q+WQ+ Y
Sbjct  839  Q-FGALGY-PNFYPSQGGVSQEH---QQNPSEGNLSV----SQAAPSQPSHQMWQHGY  887



>ref|XP_007147529.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
 gb|ESW19523.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
Length=843

 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 176/239 (74%), Gaps = 17/239 (7%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHL VHPYSQPTLPLG FAN+ISYPF+ QSYTYMP  FQQ F GNSTY QSLAA+LP
Sbjct  612  ALPQHLPVHPYSQPTLPLGHFANMISYPFLPQSYTYMPSAFQQTFPGNSTYHQSLAAMLP  671

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKD  559
             YKN+VS SSLP SA +P GYG FG++ +IP G+F L+P AAP+ T++G +D ++SQ+KD
Sbjct  672  QYKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLSPPAAPTGTTIGYEDLINSQFKD  730

Query  558  NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQ--------NQQPSGFRQVQQP  403
            ++H++SLQQ +NS MW+ G G RTMSA P + YY++Q Q         Q+    +Q QQP
Sbjct  731  SNHMISLQQNDNSPMWVQGPGPRTMSAVPPSNYYSMQGQSQQQAGGFRQRQQQQQQQQQP  790

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ++ SLGY PNFY SQ+GISL+  HQ QNPR+  LGG       Q   S QQLWQNSY
Sbjct  791  SQHFGSLGY-PNFYQSQSGISLE--HQPQNPREASLGGPQSQPSKQ---SQQQLWQNSY  843



>ref|XP_010549430.1| PREDICTED: uncharacterized protein LOC104820614 [Tarenaya hassleriana]
Length=826

 Score =   224 bits (570),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 172/245 (70%), Gaps = 30/245 (12%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ LA+HPYSQPTLPL  F N++ YP + QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  596  ALPQQLAMHPYSQPTLPLTHFPNMMGYPLLPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  655

Query  732  NYKNSVSVSSLPHSAT--VPSGYGAFGNTGTI-PGSFPLN-PSAAPS-TSLGIDDGLSSQ  568
             YKNSV+ SSLP +AT   PS YG FGN+  I  G++PLN P+A P+ T+LG  D LSSQ
Sbjct  656  QYKNSVAASSLPQTATGAAPSAYG-FGNSSNIGTGNYPLNQPTAPPTGTTLGYGDVLSSQ  714

Query  567  YKDNHHLMSLQQV---ENSGMWLHGHGSRTMSAAPANTYYNIQA--QNQQP-----SGF-  421
            YK+ +HL+SLQQ    ENS MW+HGHG++TM A P NTYYN+QA   NQQ      SG+ 
Sbjct  715  YKEINHLLSLQQQQQNENSAMWVHGHGAQTMPAIPTNTYYNLQAAHHNQQASSSSSSGYH  774

Query  420  RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQL  241
            R   QP  +Y SLGY PNFY SQTG+SL+   QQQNPRDG           Q +P S+Q+
Sbjct  775  RHAHQP--DYGSLGY-PNFYQSQTGMSLE-QQQQQNPRDGG---------SQGQPPSKQI  821

Query  240  WQNSY  226
            WQNSY
Sbjct  822  WQNSY  826



>ref|XP_003534759.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=838

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 173/239 (72%), Gaps = 20/239 (8%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  727
            PQHLA+HPYSQP+LPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP Y
Sbjct  608  PQHLAMHPYSQPSLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLPQY  667

Query  726  KNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            KN+VS SSLP SA +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KDN+
Sbjct  668  KNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDVINSQFKDNN  726

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQ----------AQNQQPSGFRQVQQP  403
            H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q           Q  Q    +Q Q P
Sbjct  727  HMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRHQQQQQQQQQPP  786

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             Q++  LGY PNFY SQTGISL+   Q QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  787  LQHFGPLGY-PNFYQSQTGISLE--QQPQNPREASL----GGPQSQPSKQSQQIWQNSY  838



>ref|XP_006586817.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=837

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 173/239 (72%), Gaps = 20/239 (8%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  727
            PQHLA+HPYSQP+LPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP Y
Sbjct  607  PQHLAMHPYSQPSLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLPQY  666

Query  726  KNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDNH  553
            KN+VS SSLP SA +P GYG FG++ +IP G+F LNP AAP+ T++G +D ++SQ+KDN+
Sbjct  667  KNNVSASSLPQSAAIPPGYG-FGSSTSIPGGNFSLNPPAAPTGTTIGYEDVINSQFKDNN  725

Query  552  HLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQ----------AQNQQPSGFRQVQQP  403
            H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q           Q  Q    +Q Q P
Sbjct  726  HMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPGGFRQRHQQQQQQQQQPP  785

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             Q++  LGY PNFY SQTGISL+   Q QNPR+  L    G  Q QP   SQQ+WQNSY
Sbjct  786  LQHFGPLGY-PNFYQSQTGISLE--QQPQNPREASL----GGPQSQPSKQSQQIWQNSY  837



>ref|XP_008800693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103714980 
[Phoenix dactylifera]
Length=885

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 163/239 (68%), Gaps = 20/239 (8%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMP-PGFQQPFAGNSTYQQSLAAV-  739
            ALPQHL VH Y+QP LP   FAN+IS+PF+ QSYTY+P   FQQP+ GN  + QS A + 
Sbjct  657  ALPQHLPVHHYTQPALPSSHFANMISFPFLPQSYTYLPSAAFQQPYTGNGPFHQSPATIP  716

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  583
                   LP YK+S+SV+SLP SA V S YG FG++  IPGSF L+P+  + ST++G+++
Sbjct  717  SAGIKYTLPQYKSSISVTSLPQSAAVASAYGGFGSSANIPGSFTLDPTTVSASTTIGLEE  776

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             LSSQYK+ +H M LQQ +N+ MW+HG GSRTMSA PA+T+Y+ Q QNQ  SGFRQ QQP
Sbjct  777  ALSSQYKEANHYMPLQQADNTAMWVHGAGSRTMSALPASTFYSFQGQNQH-SGFRQGQQP  835

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ +   GY PNFY SQ G+       QQNP +G L      +Q  P  +S Q+WQ+SY
Sbjct  836  SQ-FGPPGY-PNFYPSQAGVP---QELQQNPSEGNLNV----SQAAPSQASHQMWQHSY  885



>ref|XP_010538220.1| PREDICTED: uncharacterized protein LOC104812645 isoform X1 [Tarenaya 
hassleriana]
Length=818

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 162/237 (68%), Gaps = 24/237 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAG-NSTYQQSLAAVL  736
            ALPQ L +HPY+QP+LPL  F N+I YP + QSY Y+P  F Q FAG NS+Y QSLAA+ 
Sbjct  595  ALPQQLPMHPYAQPSLPLTHFPNMIGYPLLPQSYPYIPSAFMQAFAGNNSSYHQSLAALH  654

Query  735  PNYKNSVSVSSLPH-SATVPSGYGAFGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQY  565
            P YKNSVS SSLP   A   S YG FGN+  +  G++PLN SA P+ TSLG ++ LSSQY
Sbjct  655  PQYKNSVSTSSLPQPGAASASAYG-FGNSSNVGAGNYPLNQSAGPTGTSLGYEEALSSQY  713

Query  564  KDNHHLMSLQ--QVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ-QPSQ  397
            K+++H++SLQ  Q ENS MWLH GHGSRTMS  P N YYN+Q Q Q P  FR  Q Q SQ
Sbjct  714  KESNHMLSLQQHQQENSPMWLHNGHGSRTMSTVPTNGYYNLQPQQQGPE-FRHSQPQASQ  772

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +Y SLGY PNFYH QTGIS++ HH  QNPRDG              PS QQ+WQN Y
Sbjct  773  HYGSLGY-PNFYHPQTGISIE-HHPPQNPRDG------------GPPSKQQIWQNPY  815



>ref|XP_010538221.1| PREDICTED: uncharacterized protein LOC104812645 isoform X2 [Tarenaya 
hassleriana]
Length=817

 Score =   215 bits (547),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 162/236 (69%), Gaps = 23/236 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAG-NSTYQQSLAAVL  736
            ALPQ L +HPY+QP+LPL  F N+I YP + QSY Y+P  F Q FAG NS+Y QSLAA+ 
Sbjct  595  ALPQQLPMHPYAQPSLPLTHFPNMIGYPLLPQSYPYIPSAFMQAFAGNNSSYHQSLAALH  654

Query  735  PNYKNSVSVSSLPH-SATVPSGYGAFGNTGTI-PGSFPLNPSAAPS-TSLGIDDGLSSQY  565
            P YKNSVS SSLP   A   S YG FGN+  +  G++PLN SA P+ TSLG ++ LSSQY
Sbjct  655  PQYKNSVSTSSLPQPGAASASAYG-FGNSSNVGAGNYPLNQSAGPTGTSLGYEEALSSQY  713

Query  564  KDNHHLMSLQQ-VENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ-QPSQN  394
            K+++H++SLQQ  +NS MWLH GHGSRTMS  P N YYN+Q Q Q P  FR  Q Q SQ+
Sbjct  714  KESNHMLSLQQHQQNSPMWLHNGHGSRTMSTVPTNGYYNLQPQQQGPE-FRHSQPQASQH  772

Query  393  YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Y SLGY PNFYH QTGIS++ HH  QNPRDG              PS QQ+WQN Y
Sbjct  773  YGSLGY-PNFYHPQTGISIE-HHPPQNPRDG------------GPPSKQQIWQNPY  814



>ref|XP_006415582.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33935.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=836

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 167/254 (66%), Gaps = 38/254 (15%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPT+PL  FAN+I YP M Q+Y YMP  FQQ +AGNS+Y Q LAA+LP
Sbjct  596  ALPQQLPMHPYSQPTMPLAHFANMIGYPLMPQNYPYMPSAFQQTYAGNSSYHQQLAALLP  655

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKD  559
             YK ++S S+LP SA+ P+    FGN+  +   G+FPLN  +AP+   G +D LSSQYK+
Sbjct  656  QYKTNLSPSNLPQSASAPASAYGFGNSTNVGSTGNFPLNQQSAPT---GYEDVLSSQYKE  712

Query  558  NHHLMSLQQV----------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  427
            ++HL++LQQ                 ENS MW HGHGSRTMS  PANTYYN+QAQ QQ  
Sbjct  713  SNHLLALQQQQQQQQQQQLLLQQQQNENSAMWHHGHGSRTMSGIPANTYYNLQAQQQQQQ  772

Query  426  ------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-  268
                  G+RQ QQ  Q+Y S GY PNFY SQT +SLD   QQQNPRDG        AQV 
Sbjct  773  PQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLD--RQQQNPRDG------AGAQVG  822

Query  267  QPKPSSQQLWQNSY  226
            QP   +QQLWQNSY
Sbjct  823  QPSNQTQQLWQNSY  836



>ref|XP_006415581.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33934.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=838

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 167/254 (66%), Gaps = 38/254 (15%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPT+PL  FAN+I YP M Q+Y YMP  FQQ +AGNS+Y Q LAA+LP
Sbjct  598  ALPQQLPMHPYSQPTMPLAHFANMIGYPLMPQNYPYMPSAFQQTYAGNSSYHQQLAALLP  657

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYKD  559
             YK ++S S+LP SA+ P+    FGN+  +   G+FPLN  +AP+   G +D LSSQYK+
Sbjct  658  QYKTNLSPSNLPQSASAPASAYGFGNSTNVGSTGNFPLNQQSAPT---GYEDVLSSQYKE  714

Query  558  NHHLMSLQQV----------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  427
            ++HL++LQQ                 ENS MW HGHGSRTMS  PANTYYN+QAQ QQ  
Sbjct  715  SNHLLALQQQQQQQQQQQLLLQQQQNENSAMWHHGHGSRTMSGIPANTYYNLQAQQQQQQ  774

Query  426  ------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-  268
                  G+RQ QQ  Q+Y S GY PNFY SQT +SLD   QQQNPRDG        AQV 
Sbjct  775  PQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLD--RQQQNPRDG------AGAQVG  824

Query  267  QPKPSSQQLWQNSY  226
            QP   +QQLWQNSY
Sbjct  825  QPSNQTQQLWQNSY  838



>emb|CDX94662.1| BnaC07g09960D [Brassica napus]
Length=805

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 159/238 (67%), Gaps = 27/238 (11%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  727
            PQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP Y
Sbjct  584  PQQLPMHPYSQPTMPLAHFANMLGYPLMPQNYPYMPSAFPQTFAGNSLYQQQLAALLPQY  643

Query  726  KNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNP-SAAPSTSLGIDDGLSSQYKDNHH  550
            K ++S S+LPHSAT         N G+  G+FPLN  S  P T++G +D LSSQYK++ H
Sbjct  644  KTNLSPSNLPHSATAL-------NVGSA-GNFPLNQHSTPPGTTMGYEDVLSSQYKESSH  695

Query  549  LMSLQQV----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GFRQVQQPS  400
            L++LQQ     ENS MW HGHGSRTMS  PANTYYN+QAQ Q         G+RQ QQ  
Sbjct  696  LLALQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQQAQQAAGGYRQAQQ-Q  754

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q+Y S GY PN+Y SQT +S+D   QQQNPRDG     G  A  QP   +QQLWQNSY
Sbjct  755  QHYGSQGY-PNYYQSQTEMSVD--RQQQNPRDG----AGAQAGSQPSNQTQQLWQNSY  805



>ref|XP_010539204.1| PREDICTED: putative uncharacterized protein DDB_G0277255 [Tarenaya 
hassleriana]
Length=790

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 156/233 (67%), Gaps = 26/233 (11%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            AL QHLA+HPYSQPTLPLG + N+ISYPF+ QSY YMP GFQQ      TY QSLAA+LP
Sbjct  580  ALAQHLAMHPYSQPTLPLGHYTNMISYPFLPQSYPYMPSGFQQ------TYPQSLAAMLP  633

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPSTSLGID--DGLSSQYK  562
             YK+    S+LP SA VPS YG FG +  +P G+FPLN S+  +T++G D  D LSSQ+K
Sbjct  634  QYKS----SNLPQSAAVPSAYG-FGASSNVPGGNFPLNQSSTGNTTMGYDNNDVLSSQFK  688

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-PSGFRQVQQPSQNYAS  385
            D++H  S+QQ E+S  WL G  SR +S  P +TYY+   QNQQ P GFR  QQPSQ +  
Sbjct  689  DSNHFASIQQNESSQAWLQGQNSRVVSVVPGSTYYSFPGQNQQPPGGFR--QQPSQQH--  744

Query  384  LGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             GY   +Y SQ G+S++H+H  QNPRD  +      AQ      +QQLWQNSY
Sbjct  745  FGYMSPYY-SQAGMSMEHNHHHQNPRDTSV------AQTHASKQAQQLWQNSY  790



>ref|XP_009410966.1| PREDICTED: uncharacterized protein LOC103992822 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=830

 Score =   202 bits (513),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 153/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
            ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  605  ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  663

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  580
                   P +K+S+S +SLP ++ + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  664  VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  723

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  724  LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  782

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  783  Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  830



>gb|EYU43283.1| hypothetical protein MIMGU_mgv1a002920mg [Erythranthe guttata]
Length=625

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 166/245 (68%), Gaps = 34/245 (14%)
 Frame = -1

Query  912  ALPQHLAVHP-YSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQ +A+HP YSQ  LP+G F N+I YPF+ QSYTYMP  FQQ  AG+S Y QSLAA+L
Sbjct  399  ALPQQVALHPQYSQTNLPMGQFPNMIGYPFLPQSYTYMPSAFQQSLAGSSAYHQSLAALL  458

Query  735  PNYK-NSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNP-SAAP--STSLGIDDGLSSQ  568
            P YK ++ S+SSLP SA   SGYG FGN  +IPG++ +NP SAAP   ++L  DD L++Q
Sbjct  459  PQYKSSASSISSLPQSA---SGYGGFGNNTSIPGNYQMNPQSAAPLSESALSYDDVLNAQ  515

Query  567  YKDNHHLMSL-QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQ--NQQPSGFR-------  418
            YK+  HL+SL QQ ENS +WL GH SRTMS  PA+T YN+QAQ  NQQ  GFR       
Sbjct  516  YKERSHLLSLQQQSENSPVWLQGHNSRTMSGVPASTLYNLQAQQTNQQLGGFRQGQAPHQ  575

Query  417  -QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQL  241
             Q QQ SQNY     NPN+YHSQTG+SLD   Q QNPRD         +Q QPK S  Q+
Sbjct  576  QQQQQQSQNYG----NPNYYHSQTGMSLD---QLQNPRD------VSGSQGQPKQS--QM  620

Query  240  WQNSY  226
            W N+Y
Sbjct  621  WPNNY  625



>ref|XP_009410962.1| PREDICTED: uncharacterized protein LOC103992822 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 153/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
            ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  658  ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  716

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  580
                   P +K+S+S +SLP ++ + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  717  VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  776

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  777  LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  835

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  836  Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  883



>ref|XP_009410964.1| PREDICTED: uncharacterized protein LOC103992822 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 153/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
            ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  653  ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  711

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  580
                   P +K+S+S +SLP ++ + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  712  VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  771

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  772  LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  830

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  831  Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  878



>ref|XP_009410965.1| PREDICTED: uncharacterized protein LOC103992822 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 153/238 (64%), Gaps = 21/238 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
            ALPQHL VH YSQP LPLG FAN+ISYPF+  SYTY+P   QQ FA NS + QS AAV  
Sbjct  647  ALPQHLPVHHYSQPALPLGHFANMISYPFLPHSYTYLP-SIQQAFAANSPFHQSPAAVPS  705

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  580
                   P +K+S+S +SLP ++ + S YG  G++  IPG+F LN  +A+ ST++G D+ 
Sbjct  706  VGMKYSQPQFKSSLSATSLPQASAIASAYGGLGSSANIPGAFILNHTTASASTTIGFDEA  765

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  SG R  QQ S
Sbjct  766  LSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-SGIRPSQQTS  824

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + Q+WQ+ Y
Sbjct  825  Q-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPANQIWQHGY  872



>ref|XP_002893558.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69817.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
Length=841

 Score =   198 bits (504),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 162/257 (63%), Gaps = 37/257 (14%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGN+ Y Q LAA+LP
Sbjct  594  ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNNAYHQQLAALLP  652

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   G+FPLN  +AP+ T+LG +D LSSQYK
Sbjct  653  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSTGNFPLNQQSAPTGTTLGYEDVLSSQYK  712

Query  561  DNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---  427
            +N HL++LQQ             ENS MW HGHGSRTMS  P NTYYN+QAQ Q      
Sbjct  713  EN-HLLALQQQQQQQQQQQQQQNENSAMWHHGHGSRTMSGVPTNTYYNLQAQQQLQLQQQ  771

Query  426  ----------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGN  277
                      G+RQ QQ  Q+Y S GY PN+Y SQT +SLD   QQQNPRDG  G   G 
Sbjct  772  QQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLD--RQQQNPRDGGTGSQAGQ  827

Query  276  AQVQPKPSSQQLWQNSY  226
               Q +   QQLWQNSY
Sbjct  828  PSNQTQ---QQLWQNSY  841



>ref|XP_006306765.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39663.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=832

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 162/258 (63%), Gaps = 38/258 (15%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSL-AAVL  736
            ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q L A++L
Sbjct  584  ALPQQLPMHPYSQPTLPLTHYANMISYPIMPQNYPYMPSAFQQTF-GNSSYHQQLSASLL  642

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQY  565
            P YK +VS  +LP SAT P+    FGN+      G+FP N  +AP+ T+LG +D LSSQY
Sbjct  643  PQYKTNVSPGNLPQSATAPASAYGFGNSTNAGSAGNFPPNQQSAPTGTTLGYEDVLSSQY  702

Query  564  KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---------  427
            K+++HL++LQQ      ENS MW HGHGSRTMS  PANTYYN+QAQ Q            
Sbjct  703  KESNHLLALQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLHQQQLQQQQLQ  762

Query  426  -----------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggG  280
                       G+RQ QQ   +Y S GY PNFY SQT +SL+   QQQNPRDG     G 
Sbjct  763  QQQQQTQQAAGGYRQAQQQQHHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGGGSQAG-  818

Query  279  NAQVQPKPSSQQLWQNSY  226
                Q    +QQLWQNSY
Sbjct  819  ----QQSNQTQQLWQNSY  832



>ref|XP_006306766.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39664.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=840

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 162/258 (63%), Gaps = 38/258 (15%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSL-AAVL  736
            ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q L A++L
Sbjct  592  ALPQQLPMHPYSQPTLPLTHYANMISYPIMPQNYPYMPSAFQQTF-GNSSYHQQLSASLL  650

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQY  565
            P YK +VS  +LP SAT P+    FGN+      G+FP N  +AP+ T+LG +D LSSQY
Sbjct  651  PQYKTNVSPGNLPQSATAPASAYGFGNSTNAGSAGNFPPNQQSAPTGTTLGYEDVLSSQY  710

Query  564  KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---------  427
            K+++HL++LQQ      ENS MW HGHGSRTMS  PANTYYN+QAQ Q            
Sbjct  711  KESNHLLALQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLHQQQLQQQQLQ  770

Query  426  -----------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggG  280
                       G+RQ QQ   +Y S GY PNFY SQT +SL+   QQQNPRDG     G 
Sbjct  771  QQQQQTQQAAGGYRQAQQQQHHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGGGSQAG-  826

Query  279  NAQVQPKPSSQQLWQNSY  226
                Q    +QQLWQNSY
Sbjct  827  ----QQSNQTQQLWQNSY  840



>ref|NP_174230.2| Kinase-related protein [Arabidopsis thaliana]
 gb|AAL36210.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20314.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31077.1| Kinase-related protein [Arabidopsis thaliana]
Length=831

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 158/256 (62%), Gaps = 37/256 (14%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  586  ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  644

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   G+FPLN  SA   T+LG DD LSSQYK
Sbjct  645  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYK  704

Query  561  DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  427
            +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  705  EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  763

Query  426  ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  274
                     G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G  A
Sbjct  764  QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQA  815

Query  273  QVQPKPSSQQLWQNSY  226
                  S QQLWQNSY
Sbjct  816  GQPSNQSQQQLWQNSY  831



>gb|AAG51735.1|AC068667_14 unknown protein; 25451-20507 [Arabidopsis thaliana]
Length=858

 Score =   196 bits (497),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 158/256 (62%), Gaps = 37/256 (14%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  613  ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  671

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   G+FPLN  SA   T+LG DD LSSQYK
Sbjct  672  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYK  731

Query  561  DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  427
            +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  732  EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  790

Query  426  ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  274
                     G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G  A
Sbjct  791  QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDG----AGSQA  842

Query  273  QVQPKPSSQQLWQNSY  226
                  S QQLWQNSY
Sbjct  843  GQPSNQSQQQLWQNSY  858



>ref|XP_010478296.1| PREDICTED: probable serine/threonine-protein kinase yakA [Camelina 
sativa]
Length=845

 Score =   195 bits (496),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 165/263 (63%), Gaps = 42/263 (16%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  591  ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  649

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   GSFP+N  +AP+ T+LG +D LSSQYK
Sbjct  650  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGSFPVNQQSAPTGTALGYEDVLSSQYK  709

Query  561  DNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---  427
            +++HL++LQQ             ENS MW HGHGSRTMS  PANTYYN+QAQ Q      
Sbjct  710  ESNHLLALQQQQQQQQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQ  769

Query  426  ----------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  295
                            G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQNPRDG  
Sbjct  770  LQQQQQQQQQNQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDGAG  825

Query  294  ggggGNAQVQPKPSSQQLWQNSY  226
               GG    Q   + QQLWQNSY
Sbjct  826  SQAGGQQSNQ---TQQQLWQNSY  845



>ref|XP_010499452.1| PREDICTED: RNA polymerase II degradation factor 1-like [Camelina 
sativa]
Length=842

 Score =   195 bits (495),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 164/261 (63%), Gaps = 41/261 (16%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  591  ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  649

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +    SFPLN  +AP+ T+LG +D LSSQYK
Sbjct  650  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAASFPLNQQSAPTGTTLGYEDVLSSQYK  709

Query  561  DNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS---  427
            +++HL++LQQ             ENS MW HGHGSRTMS  PANTYYN+QAQ Q      
Sbjct  710  ESNHLLALQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQLHQQ  769

Query  426  --------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  289
                          G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQ+PRDG    
Sbjct  770  LQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQSPRDG----  821

Query  288  ggGNAQVQPKPSSQQLWQNSY  226
             G  A  Q   + QQLWQNSY
Sbjct  822  AGSQAGQQSNQTQQQLWQNSY  842



>ref|XP_010540528.1| PREDICTED: uncharacterized protein LOC104814266 [Tarenaya hassleriana]
Length=832

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 161/244 (66%), Gaps = 29/244 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQ LA+HPYSQPTLPL  F N++ YP + QSY YMP  FQQ FAGNS+Y QSLAA+LP 
Sbjct  602  LPQQLAMHPYSQPTLPLTHFPNMMGYPLLPQSYPYMPSAFQQAFAGNSSYHQSLAALLPQ  661

Query  729  YKNSVSVSSLPHSAT--VPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYK  562
            YKN +S SSLP SAT    S YG FGN+  +  G++PLN  AAPS T+LG +D LSSQYK
Sbjct  662  YKNHISASSLPQSATGGAASAYG-FGNSSNVGIGNYPLNQPAAPSGTTLGYEDVLSSQYK  720

Query  561  DNHHLMSLQQV-----ENSGMWL-HGHGSRTMSAAPANTYYN---IQAQNQQPSGFR--Q  415
            +++HL+SLQQ      ENSGMW+ HG  SRTM A P+NTYYN    Q   Q  SG+R   
Sbjct  721  ESNHLLSLQQQQQQQNENSGMWIHHGSASRTMPAVPSNTYYNHLQAQQNQQASSGYRQAA  780

Query  414  VQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLW  238
             QQ   +Y SLGY PNFY SQTG+      +QQN   GP        Q QP K + QQ+W
Sbjct  781  SQQQQHHYGSLGY-PNFYQSQTGMMA---MEQQNRDGGP--------QGQPSKQNQQQMW  828

Query  237  QNSY  226
             NSY
Sbjct  829  PNSY  832



>ref|NP_174229.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31075.1| uncharacterized protein AT1G29350 [Arabidopsis thaliana]
Length=831

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 159/257 (62%), Gaps = 39/257 (15%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  586  ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  644

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   G+FPLN  SA   T+LG +D LSSQYK
Sbjct  645  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYK  704

Query  561  DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  427
            +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  705  EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  763

Query  426  ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  274
                     G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G   
Sbjct  764  QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDGAGSQAG---  816

Query  273  QVQP-KPSSQQLWQNSY  226
              QP   S QQLWQNSY
Sbjct  817  --QPSNQSQQQLWQNSY  831



>gb|AAG51729.1|AC068667_8 unknown protein; 16040-11188 [Arabidopsis thaliana]
Length=858

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 159/257 (62%), Gaps = 39/257 (15%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  613  ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  671

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   G+FPLN  SA   T+LG +D LSSQYK
Sbjct  672  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYK  731

Query  561  DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  427
            +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  732  EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  790

Query  426  ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  274
                     G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPRDG     G   
Sbjct  791  QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPRDGAGSQAG---  843

Query  273  QVQP-KPSSQQLWQNSY  226
              QP   S QQLWQNSY
Sbjct  844  --QPSNQSQQQLWQNSY  858



>ref|XP_010460714.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X1 [Camelina sativa]
Length=843

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 163/262 (62%), Gaps = 42/262 (16%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  591  ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  649

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +    SFPLN  +AP+ T+L  +D LSSQYK
Sbjct  650  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAASFPLNQQSAPTGTTLDYEDVLSSQYK  709

Query  561  DNHHLMSLQQV---------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  427
            +++HL++LQQ                ENS MW HGHGSRTMS  PANTYYN+QAQ Q   
Sbjct  710  ESNHLLALQQQQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQL  769

Query  426  ---------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLg  292
                           G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQNPRDG   
Sbjct  770  HQQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG---  822

Query  291  gggGNAQVQPKPSSQQLWQNSY  226
              G  A  Q   + QQLWQNSY
Sbjct  823  -AGSQAGQQSNQTQQQLWQNSY  843



>emb|CDY15632.1| BnaA07g08030D [Brassica napus]
Length=786

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 156/232 (67%), Gaps = 26/232 (11%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  578  ALPQQLPMHPYSQPTIPLAHFANMLGYPLMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  637

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  556
             YK ++S S+LPHSAT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  638  QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  686

Query  555  HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ     +  Q  Q+Y S G
Sbjct  687  NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ---QLRQAQQQQHYGSHG  743

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  226
            Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  744  Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  786



>ref|XP_010460715.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X2 [Camelina sativa]
Length=842

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 163/262 (62%), Gaps = 42/262 (16%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPTLPL  +AN+ISYP M Q+Y YMP  FQQ F GNS+Y Q  A++LP
Sbjct  590  ALPQQLPMHPYSQPTLPLTHYANMISYPVMPQNYPYMPSAFQQTF-GNSSYHQLAASLLP  648

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPS-TSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +    SFPLN  +AP+ T+L  +D LSSQYK
Sbjct  649  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAASFPLNQQSAPTGTTLDYEDVLSSQYK  708

Query  561  DNHHLMSLQQV---------------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  427
            +++HL++LQQ                ENS MW HGHGSRTMS  PANTYYN+QAQ Q   
Sbjct  709  ESNHLLALQQQQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQLQL  768

Query  426  ---------------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLg  292
                           G+RQ QQ  Q+Y S GY PNFY SQT +SL+   QQQNPRDG   
Sbjct  769  HQQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG---  821

Query  291  gggGNAQVQPKPSSQQLWQNSY  226
              G  A  Q   + QQLWQNSY
Sbjct  822  -AGSQAGQQSNQTQQQLWQNSY  842



>emb|CDX99817.1| BnaC05g22390D [Brassica napus]
Length=620

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 155/243 (64%), Gaps = 34/243 (14%)
 Frame = -1

Query  912  ALPQH-LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTY-QQSLAAV  739
            ALPQ  L +HPYSQPT+PL  FAN+ISYP M Q+Y YMP  FQQ FA NS+Y QQ LAA+
Sbjct  398  ALPQQQLPMHPYSQPTMPLAHFANMISYPMMPQNYPYMPSAFQQAFASNSSYHQQQLAAL  457

Query  738  LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQY  565
            LP YK ++S S+LP S T P+    FGN+ ++   G+FPLN  +AP+   G +D LSSQY
Sbjct  458  LPQYKANLSPSNLPQSGTAPASAYGFGNSTSVGSAGNFPLNQQSAPT---GYEDVLSSQY  514

Query  564  KDNHHLMSLQQV---------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
            K+N HL++LQQ          +NS MW HGHGSRTMS  PAN YYN+Q Q       +  
Sbjct  515  KENSHLLALQQQQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYYNLQQQQ------QLQ  568

Query  411  QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQLWQ  235
            Q   Q Y S GY PNFY SQT +S  H  QQQNPRDG        A  QP   + QQLWQ
Sbjct  569  QAQQQQYGSHGY-PNFYQSQTEMS--HERQQQNPRDG--------AGAQPSNQTQQQLWQ  617

Query  234  NSY  226
            NSY
Sbjct  618  NSY  620



>emb|CDY48333.1| BnaA09g26880D [Brassica napus]
Length=823

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 159/246 (65%), Gaps = 32/246 (13%)
 Frame = -1

Query  912  ALPQH-LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTY-QQSLAAV  739
            ALPQ  L +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ FAGNS+Y QQ LAA+
Sbjct  593  ALPQQQLPMHPYSQPTMPLAHFANMISYPMIPQNYPYMPSAFQQAFAGNSSYHQQQLAAL  652

Query  738  LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQY  565
            LP YK ++S S+LP S T P+    FGN+  +   G+FPLN  +AP+   G +D LSSQY
Sbjct  653  LPQYKANLSPSTLPQSGTAPASPYGFGNSTNVGSAGNFPLNQQSAPT---GYEDVLSSQY  709

Query  564  KDNHHLMSLQQV------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GF  421
            K+N HL++LQQ       +NS MW HGHGSRTMS  PAN YYN+Q Q Q         G+
Sbjct  710  KENSHLLALQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYYNLQQQQQLQQAQQAAGGY  769

Query  420  RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQ  244
            RQ QQ  Q Y S GY PNFY SQT +S  H  QQQNPRD         A  QP   + QQ
Sbjct  770  RQAQQ-QQQYGSHGY-PNFYQSQTEMS--HERQQQNPRDA--------AGAQPSNQTQQQ  817

Query  243  LWQNSY  226
            LWQNSY
Sbjct  818  LWQNSY  823



>ref|XP_009102863.1| PREDICTED: uncharacterized protein LOC103828968 isoform X3 [Brassica 
rapa]
Length=639

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 154/232 (66%), Gaps = 26/232 (11%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  431  ALPQQLPMHPYSQPTIPLAHFANMLGYPPMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  490

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  556
             YK ++S S+LPHSAT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  491  QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  539

Query  555  HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ        +  Q  Q+Y S G
Sbjct  540  NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQ---QQQLRQAQQQQHYGSHG  596

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  226
            Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  597  Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  639



>ref|XP_009102862.1| PREDICTED: uncharacterized protein LOC103828968 isoform X2 [Brassica 
rapa]
Length=782

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 156/232 (67%), Gaps = 26/232 (11%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  574  ALPQQLPMHPYSQPTIPLAHFANMLGYPPMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  633

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  556
             YK ++S S+LPHSAT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  634  QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  682

Query  555  HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ     +  Q  Q+Y S G
Sbjct  683  NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ---QLRQAQQQQHYGSHG  739

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  226
            Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  740  Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  782



>ref|XP_009102861.1| PREDICTED: uncharacterized protein LOC103828968 isoform X1 [Brassica 
rapa]
Length=783

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 156/232 (67%), Gaps = 26/232 (11%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQPT+PL  FAN++ YP M Q+Y YMP  F Q FAGNS YQQ LAA+LP
Sbjct  575  ALPQQLPMHPYSQPTIPLAHFANMLGYPPMPQNYPYMPSAFPQTFAGNSLYQQQLAALLP  634

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDGLSSQYKDN  556
             YK ++S S+LPHSAT         N G+  G+FPLN  SA P T++G +D   +QYK++
Sbjct  635  QYKTNLSPSNLPHSATAL-------NVGSA-GNFPLNQQSAPPGTTMGYED---AQYKES  683

Query  555  HHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLG  379
            +HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ     +  Q  Q+Y S G
Sbjct  684  NHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ---QLRQAQQQQHYGSHG  740

Query  378  YNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKPSSQQLWQNSY  226
            Y PN+Y SQT +S  H  QQQNPRDG        AQ  QP   +QQLWQNSY
Sbjct  741  Y-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSNQTQQLWQNSY  783



>ref|XP_006646178.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like, partial 
[Oryza brachyantha]
Length=780

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 154/242 (64%), Gaps = 26/242 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA----  742
            LPQ L+VHPYSQPTLPLGPF+N++ YP++ Q+Y      FQQP++ N  + QS A     
Sbjct  551  LPQQLSVHPYSQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQPYSSNGPFHQSAATNAVP  610

Query  741  ------VLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  589
                   +P YK+S+  +S P  ++V SG+G FG++ +IPG+F LN   PSAA  TS+G 
Sbjct  611  GVNMKYSVPQYKSSLPATSPPQPSSVVSGFGGFGSSTSIPGNFGLNQNVPSAA--TSMGF  668

Query  588  DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
            D+ LS+Q+KDN H ++LQQ +NS MWL G  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  669  DEALSAQFKDNSHYIALQQSDNSAMWLQGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  727

Query  411  QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  232
            QQPSQ Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S QLWQ+
Sbjct  728  QQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLPEGTL----NSSQTAPSQPSHQLWQH  778

Query  231  SY  226
             Y
Sbjct  779  IY  780



>dbj|BAD72339.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72382.1| TA9 protein-like [Oryza sativa Japonica Group]
Length=371

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 149/242 (62%), Gaps = 26/242 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQ L+VHPY QPTLPLGPF+N++ YP++ Q+Y      FQQ F+ N  + QS A     
Sbjct  142  LPQQLSVHPYPQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQSFSSNGPFHQSAATTGVP  201

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  589
                   +P YK S+  +S P  ++V SG+G FG++  IPG+F LN   PSA   T++G 
Sbjct  202  GVSMKYSMPQYKGSLPATSPPQPSSVVSGFGGFGSSNNIPGNFGLNQNVPSAP--TTMGF  259

Query  588  DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
            ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  260  EEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  318

Query  411  QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  232
            QQPSQ Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S Q+WQ+
Sbjct  319  QQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSHQIWQH  369

Query  231  SY  226
             Y
Sbjct  370  IY  371



>ref|XP_009115248.1| PREDICTED: putative uncharacterized protein DDB_G0271606 [Brassica 
rapa]
Length=859

 Score =   184 bits (468),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 157/246 (64%), Gaps = 32/246 (13%)
 Frame = -1

Query  912  ALPQH-LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTY-QQSLAAV  739
            ALPQ  L + PYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ FAGNS+Y QQ LAA+
Sbjct  629  ALPQQQLPMRPYSQPTMPLAHFANMISYPMIPQNYPYMPSAFQQAFAGNSSYHQQQLAAL  688

Query  738  LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQY  565
            LP YK ++S S+LP S T P+    FGN+  +   G+FPLN  +AP+   G +D LSSQY
Sbjct  689  LPQYKANLSPSTLPQSGTAPASAYGFGNSTNVGSAGNFPLNQQSAPT---GYEDVLSSQY  745

Query  564  KDNHHLMSLQQV------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS------GF  421
            K+N +L++LQQ       +NS MW HGHGSRTMS  PAN Y+N+Q Q Q         G+
Sbjct  746  KENSNLLALQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYFNLQQQQQLQQAQQAAGGY  805

Query  420  RQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-KPSSQQ  244
            RQ QQ  Q Y S GY PNFY SQT   + H  QQQNPRD         A  QP   + QQ
Sbjct  806  RQAQQ-QQQYGSHGY-PNFYQSQT--EMPHERQQQNPRDA--------AGAQPSNQTQQQ  853

Query  243  LWQNSY  226
            LWQNSY
Sbjct  854  LWQNSY  859



>ref|XP_009141365.1| PREDICTED: RNA polymerase II degradation factor 1-like [Brassica 
rapa]
Length=819

 Score =   184 bits (466),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 157/241 (65%), Gaps = 25/241 (10%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  727
            PQ L +HPYSQ T+PL  FAN+ISYP M Q Y YMP  FQQ F+GNS+Y QS AA+LP Y
Sbjct  590  PQQLPMHPYSQHTVPLTHFANMISYPLMPQGYPYMPSAFQQAFSGNSSYHQSPAALLPQY  649

Query  726  KNSVSVSSLPHSATVPSGYGAFGNTGTI-PGSFPLN-PSAAPS-TSLGIDDGLSSQYKDN  556
            KN++S SSLP SA + S YG FGN+  +  G+F LN   AAP+ T+L  +D +S QYK N
Sbjct  650  KNNISPSSLPQSAPISSPYG-FGNSSNVGAGNFSLNQQQAAPTGTTLSYEDVMSLQYKQN  708

Query  555  HHLMSLQQV---------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             HL+SLQQ          ENS +WLHG GS+TMS   +N YYN+QAQ Q     +  QQ 
Sbjct  709  SHLLSLQQQQQQQQQQQNENSPVWLHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQA  768

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS--QQLWQNS  229
               Y SLGY PN+Y SQTG+S++  HQQ+NPR+G        +Q QP   +  Q LWQNS
Sbjct  769  QHQYGSLGY-PNYYQSQTGMSME--HQQRNPREG-------GSQGQPSKQTPQQHLWQNS  818

Query  228  Y  226
            Y
Sbjct  819  Y  819



>gb|KJB57296.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=677

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQHLA+HP+SQPTLPLG FAN+ISYPF+ QSYTY+P  FQQ FAGNS Y QSLAAVLP
Sbjct  540  ALPQHLAMHPFSQPTLPLGHFANMISYPFLPQSYTYVPSAFQQGFAGNSNYPQSLAAVLP  599

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
             YKNSVSVSSLP SA + SGYG FG++  IPG  PLNP  AP+ T++G DD LSSQYKD+
Sbjct  600  QYKNSVSVSSLPQSAAIASGYG-FGSSTNIPGGLPLNPPTAPAGTTIGYDDILSSQYKDS  658

Query  555  HHLMSLQQVEN  523
            +HLMSLQQV N
Sbjct  659  NHLMSLQQVIN  669



>gb|AAL58943.1|AF462857_1 At1g29350/F15D2_27 [Arabidopsis thaliana]
Length=832

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 145/229 (63%), Gaps = 33/229 (14%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +H YSQPTLPL  +AN+I YP M Q+Y YMP  FQQ FAGNS Y Q LAA+LP
Sbjct  586  ALPQQLPMH-YSQPTLPLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLP  644

Query  732  NYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLN-PSAAPSTSLGIDDGLSSQYK  562
             YK +VS  +LP SAT P+    FGN+  +   G+FPLN  SA   T+LG +D LSSQYK
Sbjct  645  QYKTNVSPGNLPQSATAPASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYK  704

Query  561  DNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  427
            +N HL++LQQ           ENS MW  GHGSRTMS  P NTYYN+QAQ Q        
Sbjct  705  EN-HLLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQ  763

Query  426  ---------GFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPR  307
                     G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQNPR
Sbjct  764  QQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQNPR  808



>emb|CDX90188.1| BnaA08g17960D [Brassica napus]
Length=822

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 160/250 (64%), Gaps = 32/250 (13%)
 Frame = -1

Query  912  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  584  ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  643

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQY  565
            P YK ++S S+LP SAT P+    FGN  T  GS   FPLN   +  T  G +D LSSQY
Sbjct  644  PQYKTNLSSSNLPQSATAPASAYGFGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQY  701

Query  564  KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------G  424
            K+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G
Sbjct  702  KESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGG  761

Query  423  FR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKP  256
            +R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       
Sbjct  762  YRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQPSDQ  812

Query  255  SSQQLWQNSY  226
            + QQLWQNSY
Sbjct  813  TQQQLWQNSY  822



>ref|NP_001043788.1| Os01g0663800 [Oryza sativa Japonica Group]
 dbj|BAD72338.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72381.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAF05702.1| Os01g0663800 [Oryza sativa Japonica Group]
 gb|EEE55130.1| hypothetical protein OsJ_02914 [Oryza sativa Japonica Group]
Length=851

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 149/242 (62%), Gaps = 26/242 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQ L+VHPY QPTLPLGPF+N++ YP++ Q+Y      FQQ F+ N  + QS A     
Sbjct  622  LPQQLSVHPYPQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQSFSSNGPFHQSAATTGVP  681

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  589
                   +P YK S+  +S P  ++V SG+G FG++  IPG+F LN   PSA   T++G 
Sbjct  682  GVSMKYSMPQYKGSLPATSPPQPSSVVSGFGGFGSSNNIPGNFGLNQNVPSAP--TTMGF  739

Query  588  DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
            ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  740  EEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  798

Query  411  QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  232
            QQPSQ Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S Q+WQ+
Sbjct  799  QQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSHQIWQH  849

Query  231  SY  226
             Y
Sbjct  850  IY  851



>ref|XP_009109668.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Brassica rapa]
Length=823

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 160/250 (64%), Gaps = 32/250 (13%)
 Frame = -1

Query  912  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  585  ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  644

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQY  565
            P YK ++S S+LP SAT P+    FGN  T  GS   FPLN   +  T  G +D LSSQY
Sbjct  645  PQYKTNLSSSNLPQSATAPASAYGFGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQY  702

Query  564  KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------G  424
            K+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G
Sbjct  703  KESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGG  762

Query  423  FR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKP  256
            +R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       
Sbjct  763  YRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQPSDQ  813

Query  255  SSQQLWQNSY  226
            + QQLWQNSY
Sbjct  814  TQQQLWQNSY  823



>ref|XP_009109669.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Brassica rapa]
Length=822

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 160/250 (64%), Gaps = 32/250 (13%)
 Frame = -1

Query  912  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  584  ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  643

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGS---FPLNPSAAPSTSLGIDDGLSSQY  565
            P YK ++S S+LP SAT P+    FGN  T  GS   FPLN   +  T  G +D LSSQY
Sbjct  644  PQYKTNLSSSNLPQSATAPASAYGFGNNSTNVGSAGNFPLNQQQSAPT--GYEDVLSSQY  701

Query  564  KDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------G  424
            K+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G
Sbjct  702  KESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGG  761

Query  423  FR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKP  256
            +R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       
Sbjct  762  YRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQPSDQ  812

Query  255  SSQQLWQNSY  226
            + QQLWQNSY
Sbjct  813  TQQQLWQNSY  822



>emb|CDY43334.1| BnaC03g59060D [Brassica napus]
Length=822

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 161/248 (65%), Gaps = 30/248 (12%)
 Frame = -1

Query  912  ALPQHL-AVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
            ALPQ L  +HPYSQPT+PL  FAN+ISYP + Q+Y YMP  FQQ +AGN++Y Q LAA+L
Sbjct  586  ALPQQLPQMHPYSQPTMPLAHFANMISYPLIPQNYPYMPSAFQQTYAGNTSYHQQLAALL  645

Query  735  PNYKNSVSVSSLPHSATVPSGYGAFGNTGTI--PGSFPLNPSAAPSTSLGIDDGLSSQYK  562
            P YK ++S S+LP SAT P+    FGN+  +   G+FP+N   +  T  G +D LSSQYK
Sbjct  646  PQYKTNLSPSNLPQSATAPASAYGFGNSTNVGSAGNFPINQQQSAPT--GYEDVLSSQYK  703

Query  561  DNHHLMSLQQV----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS--------GFR  418
            +++HL++LQ      ENS MW HGHGSRTMS  PANTYYN+QAQ QQ          G+R
Sbjct  704  ESNHLLALQHQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQLQQTQQAAAGGYR  763

Query  417  -QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV---QPKPSS  250
               QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG        AQV       + 
Sbjct  764  QAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG------AGAQVGQQTSDQTQ  814

Query  249  QQLWQNSY  226
            QQLWQNSY
Sbjct  815  QQLWQNSY  822



>emb|CDY43685.1| BnaA04g20060D [Brassica napus]
Length=830

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 157/243 (65%), Gaps = 27/243 (11%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  727
            PQ L +HPYSQ T+PL  FAN+ISYP M Q Y YMP  FQQ F+GNS+Y QS AA+LP Y
Sbjct  599  PQQLPMHPYSQHTVPLTHFANMISYPLMPQGYPYMPSAFQQAFSGNSSYHQSPAALLPQY  658

Query  726  KNSVSVSSLPHSATVPSGYGAFGNTGTI-PGSFPLN----PSAAPS-TSLGIDDGLSSQY  565
            KN++S SSLP SA + S YG FGN+  +  G+F LN      AAP+  +L  +D +S QY
Sbjct  659  KNNISPSSLPQSAPISSPYG-FGNSSNVGTGNFSLNQQQQQQAAPTGATLSYEDVMSLQY  717

Query  564  KDNHHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  409
            K N HL+SLQQ         ENS +WLHG GS+TMS   +N YYN+QAQ Q     +  Q
Sbjct  718  KQNSHLLSLQQQQQQQQQQNENSPVWLHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQ  777

Query  408  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS--QQLWQ  235
            Q  Q Y SLGY PN+Y SQTG+S++  +QQ+NPR+G        +Q QP   +  Q LWQ
Sbjct  778  QAQQQYGSLGY-PNYYQSQTGMSME--YQQRNPREG-------GSQGQPSKQTPQQHLWQ  827

Query  234  NSY  226
            NSY
Sbjct  828  NSY  830



>ref|XP_009395691.1| PREDICTED: mucin-17-like [Musa acuminata subsp. malaccensis]
Length=910

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 150/238 (63%), Gaps = 21/238 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS------  751
            +LPQHL V  YSQP LPL  FAN++SY F+ QSY Y+P  FQQ +A NS + QS      
Sbjct  685  SLPQHLPVR-YSQPALPLSHFANMMSYSFLPQSYPYLP-SFQQAYAANSPFHQSHHVAPS  742

Query  750  --LAAVLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  580
              ++   P +K+S+S +SLP  +++ S YG FG+  +IPG F LN  +A+ +T+ G+ + 
Sbjct  743  AGMSYSQPQFKSSLSATSLPQVSSIASAYGGFGSAASIPGGFTLNHTTASANTTTGLGEA  802

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            LS QYK+  H M LQQ EN  MW+ G GSRTMSA PANT+YN Q  NQQ SGFRQ  Q S
Sbjct  803  LSLQYKEGSHYMPLQQNENPAMWVQGAGSRTMSALPANTFYNYQGHNQQ-SGFRQNLQAS  861

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
                +LGY PN Y SQ G S +H   QQ+P DG L G     Q QP   + Q+WQ+ Y
Sbjct  862  P-LGALGY-PNLYLSQGGPSREH---QQSPSDGNLNGSQA-TQSQP---ANQIWQHGY  910



>gb|EEC71225.1| hypothetical protein OsI_03160 [Oryza sativa Indica Group]
Length=732

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 150/242 (62%), Gaps = 26/242 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQ L+VHPY QPTLPLGPF+N++ YP++ Q+Y      FQQ F+ N  + QS A     
Sbjct  503  LPQQLSVHPYPQPTLPLGPFSNLVGYPYLPQNYYLPSAAFQQSFSSNGPFHQSAATTGVP  562

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN---PSAAPSTSLGI  589
                   +P YK+S+  +S P  ++V SG+G FG++  IPG+F LN   PSA   T++G 
Sbjct  563  GVSMKYSMPQYKSSLPATSPPQPSSVVSGFGGFGSSNNIPGNFGLNQNVPSAP--TTMGF  620

Query  588  DDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
            ++ LS+Q+KDN   ++LQQ ++S MWLHG  GSR +SA P   +Y  Q QN QP GFRQ 
Sbjct  621  EEALSTQFKDNSQYIALQQNDSSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPGGFRQG  679

Query  411  QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  232
            QQPSQ Y  LGY+ +FY SQ G+  +H    QN  +G L     ++Q  P   S Q+WQ+
Sbjct  680  QQPSQ-YGGLGYS-SFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSHQIWQH  730

Query  231  SY  226
             Y
Sbjct  731  IY  732



>ref|XP_009394232.1| PREDICTED: uncharacterized protein LOC103979756 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 152/239 (64%), Gaps = 21/239 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
              PQ+L VH YSQP LPLG FANIISYP++  SY Y+P    Q F  NS + Q  AAV  
Sbjct  657  VFPQNLPVHHYSQPALPLGHFANIISYPYLPHSYAYLP-SVHQAFTTNSPFHQPTAAVPS  715

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN-PSAAPSTSLGIDDG  580
                   P Y++S+SV+SLP ++ + S YG FG++  +PG + LN  SA+ +T +G+D+ 
Sbjct  716  AGMKYSQPQYRSSLSVASLPQASAIGSAYGGFGSSANVPGGYTLNHTSASTNTMIGLDEA  775

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
            L+ Q+++  H + LQQ EN  MW+HG GSRTMSA P +T+YN   QNQ  SGFRQ QQ S
Sbjct  776  LNLQHREASHHVPLQQSENPAMWIHGGGSRTMSALPTSTFYNYPGQNQH-SGFRQTQQ-S  833

Query  399  QNYASLGYNPNFYH-SQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             +  +LGY PN +H +Q G S +H   QQN  DG + G      VQ +P++ Q+WQ+ Y
Sbjct  834  SHLGALGY-PNLHHDAQAGPSQEH---QQNLSDGNMSGSQT---VQSQPAN-QIWQHGY  884



>gb|KHN22963.1| hypothetical protein glysoja_030633 [Glycine soja]
Length=980

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQHLA+HPYSQP+LPLG FAN+ISYPF+ QSYTYMP  FQQ FAGN+TY QSLAAVLP 
Sbjct  574  LPQHLAMHPYSQPSLPLGHFANMISYPFLPQSYTYMPSAFQQTFAGNNTYPQSLAAVLPQ  633

Query  729  YKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
            YKN+VS SSLP SA +P GYG FG++ +IP GSF LNP AAP+ T++G +D ++SQ+KDN
Sbjct  634  YKNNVSASSLPQSAAIPPGYG-FGSSTSIPGGSFSLNPPAAPTGTTIGYEDVINSQFKDN  692

Query  555  HHLMSLQQVENSGMWLH  505
            +H+MSLQQ   +   +H
Sbjct  693  NHMMSLQQFTCTTSSIH  709



>emb|CDY61562.1| BnaCnng37970D [Brassica napus]
Length=762

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 157/243 (65%), Gaps = 34/243 (14%)
 Frame = -1

Query  903  QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  724
            Q L +HPYSQ T+PL  FAN++SYP M QSY YMP      FAGNS Y  SLAA+LP YK
Sbjct  537  QQLPMHPYSQHTVPLTHFANMMSYPLMPQSYPYMP------FAGNSPYHPSLAALLPQYK  590

Query  723  NSVSVSSLPHSAT---VPSGYGAFGNTGTI-PGSFPLNPS-----AAPS-TSLGIDDGLS  574
            N+VS S+LP S T   + S YG FGN+  + PG+FPLN       AAP+  +L  +D +S
Sbjct  591  NNVSASNLPQSVTSAPISSAYG-FGNSNNVGPGNFPLNQQQQQQQAAPTGATLSYEDIMS  649

Query  573  SQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  409
             QYK N+HL+SLQQ      +NS +W+HG GS+TMS   +N YY++QAQ Q     +  Q
Sbjct  650  LQYKQNNHLLSLQQQQQQQNDNSPLWVHGPGSQTMSGVQSNAYYSLQAQQQAQQLRQAQQ  709

Query  408  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ--LWQ  235
            +  Q Y SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP   +QQ  LWQ
Sbjct  710  EAQQQYGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSKQTQQQHLWQ  759

Query  234  NSY  226
            NSY
Sbjct  760  NSY  762



>ref|XP_009396490.1| PREDICTED: uncharacterized protein LOC103981474 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 147/241 (61%), Gaps = 23/241 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSYTYMPPGFQQPFAGNSTYQQSLAAV-  739
            AL QHL V  YSQP LPLG FAN+ISYP F+ QSYTY+P  FQQ +  NS + QS  AV 
Sbjct  657  ALHQHLPVPHYSQPALPLGHFANMISYPPFLPQSYTYLP-SFQQAYTANSPFHQSPGAVP  715

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN--PSAAPSTSLGID  586
                    P +KNS+SV+SLP ++ + S YG  GN+  IPG F LN   S + ST+ G D
Sbjct  716  GAGMKYSQPQFKNSLSVTSLPQASAIASAYGGLGNSANIPGGFALNHHTSGSASTTTGFD  775

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  409
            + LS Q K+  H M  QQ EN  +WLH   GSR M A PA+T+YN Q Q+QQ SGFRQ  
Sbjct  776  ESLSLQNKEESHYMPPQQSENPNLWLHSAAGSRAMPALPASTFYNYQGQSQQ-SGFRQSP  834

Query  408  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNS  229
            Q S +  +LGY PN YHS  G+S +H   QQN  +G L  G    Q  P   + Q+WQ+ 
Sbjct  835  QAS-HLGALGY-PNLYHSPAGLSREH---QQNTGEGNL-NGPPTTQAHP---ANQIWQHG  885

Query  228  Y  226
            Y
Sbjct  886  Y  886



>ref|XP_009396491.1| PREDICTED: uncharacterized protein LOC103981474 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=885

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 147/241 (61%), Gaps = 23/241 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSYTYMPPGFQQPFAGNSTYQQSLAAV-  739
            AL QHL V  YSQP LPLG FAN+ISYP F+ QSYTY+P  FQQ +  NS + QS  AV 
Sbjct  656  ALHQHLPVPHYSQPALPLGHFANMISYPPFLPQSYTYLP-SFQQAYTANSPFHQSPGAVP  714

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLN--PSAAPSTSLGID  586
                    P +KNS+SV+SLP ++ + S YG  GN+  IPG F LN   S + ST+ G D
Sbjct  715  GAGMKYSQPQFKNSLSVTSLPQASAIASAYGGLGNSANIPGGFALNHHTSGSASTTTGFD  774

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  409
            + LS Q K+  H M  QQ EN  +WLH   GSR M A PA+T+YN Q Q+QQ SGFRQ  
Sbjct  775  ESLSLQNKEESHYMPPQQSENPNLWLHSAAGSRAMPALPASTFYNYQGQSQQ-SGFRQSP  833

Query  408  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNS  229
            Q S +  +LGY PN YHS  G+S +H   QQN  +G L  G    Q  P   + Q+WQ+ 
Sbjct  834  QAS-HLGALGY-PNLYHSPAGLSREH---QQNTGEGNL-NGPPTTQAHP---ANQIWQHG  884

Query  228  Y  226
            Y
Sbjct  885  Y  885



>ref|XP_006410569.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52022.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=840

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 141/226 (62%), Gaps = 29/226 (13%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQ T+PL  FAN+I YP M QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  602  ALPQQLPMHPYSQHTVPLAHFANMIGYPLMPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  661

Query  732  NYKNSVSVSSLPHSAT---VPSGYGAFGNTGTI-PGSFPLN----PSAAPSTSLGIDDGL  577
             YKN++S S++P SAT     S YG FGN+     G++PLN     SA    SL  +D L
Sbjct  662  QYKNNISASNVPQSATSAPTSSAYG-FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDAL  720

Query  576  SSQYKDNHHLMSLQQV-------------ENSGMWLHGHGSRTMSAAPANTYYNI-QAQN  439
            S QYK N+HL+SLQQ              ENS MWLHG GS+TMS  P+NTYYN+   Q 
Sbjct  721  SLQYKQNNHLLSLQQQQQLQQQQLQQQQNENSPMWLHGPGSQTMSGVPSNTYYNLQAQQQ  780

Query  438  QQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  301
             Q     Q Q   Q Y SLGY PN+Y SQT       HQQQNPRDG
Sbjct  781  AQQVRQAQQQAQQQQYGSLGY-PNYYQSQT-----MEHQQQNPRDG  820



>ref|XP_006410567.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52020.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=842

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 141/226 (62%), Gaps = 29/226 (13%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQ T+PL  FAN+I YP M QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  604  ALPQQLPMHPYSQHTVPLAHFANMIGYPLMPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  663

Query  732  NYKNSVSVSSLPHSAT---VPSGYGAFGNTGTI-PGSFPLN----PSAAPSTSLGIDDGL  577
             YKN++S S++P SAT     S YG FGN+     G++PLN     SA    SL  +D L
Sbjct  664  QYKNNISASNVPQSATSAPTSSAYG-FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDAL  722

Query  576  SSQYKDNHHLMSLQQV-------------ENSGMWLHGHGSRTMSAAPANTYYNI-QAQN  439
            S QYK N+HL+SLQQ              ENS MWLHG GS+TMS  P+NTYYN+   Q 
Sbjct  723  SLQYKQNNHLLSLQQQQQLQQQQLQQQQNENSPMWLHGPGSQTMSGVPSNTYYNLQAQQQ  782

Query  438  QQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  301
             Q     Q Q   Q Y SLGY PN+Y SQT       HQQQNPRDG
Sbjct  783  AQQVRQAQQQAQQQQYGSLGY-PNYYQSQT-----MEHQQQNPRDG  822



>gb|KFK36320.1| hypothetical protein AALP_AA4G107400 [Arabis alpina]
Length=834

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 148/217 (68%), Gaps = 18/217 (8%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAA-VL  736
            ALPQ +A+HPYSQP  P+  + N++ YP M QSY YMP  FQQ +AGNS+Y QSLAA +L
Sbjct  600  ALPQQIAMHPYSQPP-PMAHYTNMLGYPLMPQSYPYMPSAFQQAYAGNSSYHQSLAAALL  658

Query  735  PNYKNSVSVSSLPHSATVP---SGYGAFGNTG-TIPGSFPLNPS--AAPST-SLGIDDGL  577
            P YKN++S S+LP S T P   S YG FGN+   + G+FPLN    AAP+  +L  +D L
Sbjct  659  PQYKNNISASNLPQSGTSPATSSAYG-FGNSSNVVAGNFPLNQQQQAAPTGGTLSYEDVL  717

Query  576  SSQYKDNHHLMSLQQVE-----NSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
            + QYK N+HL+SLQQ +     N  +WLHG GS+TMS   +NTYYN+QAQ Q     +  
Sbjct  718  NLQYKQNNHLLSLQQQQQHQQQNEPVWLHGPGSQTMSGVTSNTYYNLQAQQQAQQLRQAQ  777

Query  411  QQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  301
            QQ  Q Y SLGY PN+Y  QTG+S++  HQQQNPRDG
Sbjct  778  QQAQQQYGSLGY-PNYYQPQTGMSME--HQQQNPRDG  811



>gb|EMT31975.1| Retrovirus-related Pol polyprotein LINE-1 [Aegilops tauschii]
Length=1186

 Score =   169 bits (428),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 154/237 (65%), Gaps = 21/237 (9%)
 Frame = -1

Query  906   PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV----  739
             PQ L++HPYSQPTLPLGPFA+++ YP++ Q+Y   P  FQQ ++ N  + QS  A     
Sbjct  961   PQQLSLHPYSQPTLPLGPFASLVGYPYLPQNYYVPPAAFQQAYSSNGPFHQSGGAAVPGS  1020

Query  738   -----LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLS  574
                  +P YK+ + V+S P  ++  SGYG FG++  IP +F  N SA+P+T++GID+ LS
Sbjct  1021  AMKYSMPQYKSGLPVTSPPQHSSAVSGYGGFGSSSNIP-NFGQNQSASPATTMGIDEALS  1079

Query  573   SQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQ  397
             SQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q+ Q  GFR+VQQPSQ
Sbjct  1080  SQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSAQ-GGFREVQQPSQ  1138

Query  396   NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              Y  LG+ P+FY SQ G+  +H    QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  1139  -YGGLGH-PSFYQSQNGMQQEH---PQNPAEGSL----NSSQTAPSQPSHQMWQHSY  1186



>emb|CDJ26391.1| unnamed protein product [Triticum aestivum]
Length=845

 Score =   167 bits (424),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 154/239 (64%), Gaps = 23/239 (10%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS---LAAV-  739
            PQ L++HPYSQPTLPLGPFA+++ YP++ Q+Y   P  FQQ ++ N  + QS    AAV 
Sbjct  618  PQQLSLHPYSQPTLPLGPFASLVGYPYLPQNYYVPPTAFQQAYSSNGPFHQSGGGGAAVP  677

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDG  580
                   +P YK+ + V S P  ++  SGYG FG++  IP +F  N SA+P+T++GID+ 
Sbjct  678  GSAMKYSMPQYKSGLPVMSPPQHSSAVSGYGGFGSSSNIP-NFGQNQSASPATTMGIDEA  736

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
            LSSQ K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q+ Q  GFR+VQQP
Sbjct  737  LSSQLKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSAQ-GGFREVQQP  795

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ Y  LGY P+FY SQ G+  +H    QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  796  SQ-YGGLGY-PSFYQSQNGMQQEH---PQNPAEGSL----NSSQTAPSQPSHQMWQHSY  845



>ref|NP_001130067.1| uncharacterized protein LOC100191159 [Zea mays]
 gb|ACF78188.1| unknown [Zea mays]
Length=255

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 26/240 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  30   LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  86

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLGIDD  583
                   +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  A A  T+LG D+
Sbjct  87   GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAPAAPTTLGFDE  145

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q   GFRQ  Q
Sbjct  146  ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQH-GGFRQAHQ  204

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  205  PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  255



>ref|XP_008648655.1| PREDICTED: uncharacterized protein LOC103629266 [Zea mays]
Length=281

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 146/240 (61%), Gaps = 26/240 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  56   LPQQLLV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  112

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDD  583
                   +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  AA + T+LG D+
Sbjct  113  GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAAAAPTTLGFDE  171

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y+ Q Q+Q   GFRQ  Q
Sbjct  172  ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYDFQGQSQH-GGFRQAHQ  230

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  231  PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  281



>ref|XP_006827353.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
 gb|ERM94590.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
Length=904

 Score =   162 bits (410),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 154/247 (62%), Gaps = 42/247 (17%)
 Frame = -1

Query  903  QHL-AVHPYSQPT-LPLGPFANIISYPFMHQSYTYMPP-GFQQPFA-GNSTYQQSLAA--  742
            QHL +VH +SQPT LPLG F+N++SYP++ QSY Y+P   +Q  +A GN+ + QS +A  
Sbjct  679  QHLPSVHAFSQPTALPLGQFSNMLSYPYLPQSYAYLPSSAYQHAYAAGNTGFHQSPSAGQ  738

Query  741  -------VLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIP-GSFPLNPSAAPSTS--LG  592
                    LP YKNSV+VSSLPHSA       A+G+ GT P GSF LN S   S S  +G
Sbjct  739  GAAGIKYSLPQYKNSVAVSSLPHSAAA-----AYGSFGTNPLGSFALNSSTTSSGSTTMG  793

Query  591  IDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQV  412
             DD +SSQYKD  H + +QQ E+S +W+HG GSR +SA PANTYY++Q  NQ    FRQ 
Sbjct  794  YDDIVSSQYKDGSHYVPIQQNESSAVWVHGPGSRNVSAIPANTYYSLQGHNQL-GEFRQP  852

Query  411  QQPSQNYASLGYNPNFYHSQTGI-----SLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  247
            QQ S +Y +LGY PNFYH+Q G+     +L+H   QQ+P DG              PSS 
Sbjct  853  QQAS-HYNTLGY-PNFYHAQMGVAPPAAALEH---QQSPSDGG----------SRAPSSH  897

Query  246  QLWQNSY  226
            Q+W + Y
Sbjct  898  QIWAHGY  904



>ref|XP_004961192.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Setaria 
italica]
Length=846

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 127/209 (61%), Gaps = 21/209 (10%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSY-TYMPPG-FQQPFAGNSTYQQSLAAV  739
            LPQ LA HPYSQPTLPL  FAN+  YP ++ Q+Y TY+  G FQQP+  N+ + QS AA+
Sbjct  607  LPQQLAAHPYSQPTLPLTHFANMFGYPTYLPQNYATYLSSGAFQQPYPSNAQFHQSAAAL  666

Query  738  L--------PNYKNSVSVSSLPHS-------ATVPSGYGAFGNTGTIPGSFPLNPSAAPS  604
            L        P YKN++S + L          ++V SGYG FGN+  +PG+F LN S   +
Sbjct  667  LGSGLKYSTPEYKNNLSATGLQQQPQQQPPPSSVISGYGGFGNSSNLPGNFALNQSTGSA  726

Query  603  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  424
            ++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR  SA P   +Y  Q Q+Q   G
Sbjct  727  STLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSRATSALPQGHFYGFQGQSQL-GG  785

Query  423  FRQVQQPS-QNYASLGYNPNFYHSQTGIS  340
            FRQ QQP    +   GY P FY SQ G++
Sbjct  786  FRQAQQPQPSQFGGHGY-PTFYQSQGGLT  813



>ref|XP_004961191.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Setaria 
italica]
Length=847

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 127/209 (61%), Gaps = 21/209 (10%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSY-TYMPPG-FQQPFAGNSTYQQSLAAV  739
            LPQ LA HPYSQPTLPL  FAN+  YP ++ Q+Y TY+  G FQQP+  N+ + QS AA+
Sbjct  608  LPQQLAAHPYSQPTLPLTHFANMFGYPTYLPQNYATYLSSGAFQQPYPSNAQFHQSAAAL  667

Query  738  L--------PNYKNSVSVSSLPHS-------ATVPSGYGAFGNTGTIPGSFPLNPSAAPS  604
            L        P YKN++S + L          ++V SGYG FGN+  +PG+F LN S   +
Sbjct  668  LGSGLKYSTPEYKNNLSATGLQQQPQQQPPPSSVISGYGGFGNSSNLPGNFALNQSTGSA  727

Query  603  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  424
            ++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR  SA P   +Y  Q Q+Q   G
Sbjct  728  STLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSRATSALPQGHFYGFQGQSQL-GG  786

Query  423  FRQVQQPS-QNYASLGYNPNFYHSQTGIS  340
            FRQ QQP    +   GY P FY SQ G++
Sbjct  787  FRQAQQPQPSQFGGHGY-PTFYQSQGGLT  814



>ref|XP_010232108.1| PREDICTED: uncharacterized protein LOC100846506 isoform X2 [Brachypodium 
distachyon]
Length=824

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 144/240 (60%), Gaps = 30/240 (13%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS--------  751
            PQ L VHPYSQP   LGPFA+++ YP++ Q+Y   PP FQQ +A N  + QS        
Sbjct  602  PQQLPVHPYSQPAA-LGPFASLVGYPYLPQNYYVPPPAFQQAYANNGPFHQSGGAAAAAV  660

Query  750  ----LAAVLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSLGID  586
                +   +P YK+S+  +S P  ++V  GYG FGN    P +F  N SA+ P T++G+D
Sbjct  661  PGSAMKYSMPQYKSSLPATSPPQHSSVVPGYGGFGN---FP-NFGQNQSASSPGTTMGLD  716

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
            + LS+Q+K+ +H M+LQQ +NS MWLHG  +    A P + +Y  Q QN Q  GFRQ QQ
Sbjct  717  EALSTQFKEANHYMALQQSDNSAMWLHGAAAS--RAVPPSNFYGFQGQNTQ-GGFRQAQQ  773

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQTG+      + QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  774  PSQ-YGGLGY-PSFYQSQTGMP---QERLQNPTEGSL----NSSQTTPSQPSHQIWQHSY  824



>ref|XP_003569505.1| PREDICTED: uncharacterized protein LOC100846506 isoform X1 [Brachypodium 
distachyon]
Length=834

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 144/240 (60%), Gaps = 30/240 (13%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS--------  751
            PQ L VHPYSQP   LGPFA+++ YP++ Q+Y   PP FQQ +A N  + QS        
Sbjct  612  PQQLPVHPYSQPAA-LGPFASLVGYPYLPQNYYVPPPAFQQAYANNGPFHQSGGAAAAAV  670

Query  750  ----LAAVLPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSLGID  586
                +   +P YK+S+  +S P  ++V  GYG FGN    P +F  N SA+ P T++G+D
Sbjct  671  PGSAMKYSMPQYKSSLPATSPPQHSSVVPGYGGFGN---FP-NFGQNQSASSPGTTMGLD  726

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
            + LS+Q+K+ +H M+LQQ +NS MWLHG  +    A P + +Y  Q QN Q  GFRQ QQ
Sbjct  727  EALSTQFKEANHYMALQQSDNSAMWLHGAAAS--RAVPPSNFYGFQGQNTQ-GGFRQAQQ  783

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQTG+      + QNP +G L     ++Q  P   S Q+WQ+SY
Sbjct  784  PSQ-YGGLGY-PSFYQSQTGMP---QERLQNPTEGSL----NSSQTTPSQPSHQIWQHSY  834



>ref|XP_004969440.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=837

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 135/239 (56%), Gaps = 22/239 (9%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQ L VHPYSQPTLPLGPFA+++ YP+M Q+Y      FQQ ++ N  + QS A     
Sbjct  610  LPQQLPVHPYSQPTLPLGPFASLVGYPYMPQNYFLPSAAFQQAYSSNGPFHQSAAPAVPG  669

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS--TSLGIDD  583
                  +P YK+S   SSL    +  SGYG FGN   IPG+F LN   APS  T+LG D+
Sbjct  670  AGMKYSMPQYKSSTPASSL-PQPSSLSGYGGFGNANNIPGNFSLN-QGAPSAPTTLGFDE  727

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             L +Q+KD +H  +LQQ +NS MWLHG      +  P N Y       Q      QVQQP
Sbjct  728  ALGTQFKDPNHYAALQQSDNSAMWLHGAAGSRAAVPPGNFYGFQGQSQQGGFRQAQVQQP  787

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ Y  LGY P+FY SQ G+  +H    QNP +G L     N Q  P   S QLWQ+SY
Sbjct  788  SQ-YGGLGY-PSFYQSQAGLPQEH---PQNPTEGSL----NNPQAAPSQPSHQLWQHSY  837



>ref|XP_008671999.1| PREDICTED: uncharacterized protein LOC100191159 isoform X1 [Zea 
mays]
 tpg|DAA58235.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=842

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 26/240 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  617  LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  673

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLGIDD  583
                   +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  A A  T+LG D+
Sbjct  674  GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAPAAPTTLGFDE  732

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q   GFRQ  Q
Sbjct  733  ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQH-GGFRQAHQ  791

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  792  PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  842



>ref|XP_004969439.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
Length=839

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 135/239 (56%), Gaps = 22/239 (9%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LPQ L VHPYSQPTLPLGPFA+++ YP+M Q+Y      FQQ ++ N  + QS A     
Sbjct  612  LPQQLPVHPYSQPTLPLGPFASLVGYPYMPQNYFLPSAAFQQAYSSNGPFHQSAAPAVPG  671

Query  738  ------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS--TSLGIDD  583
                  +P YK+S   SSL    +  SGYG FGN   IPG+F LN   APS  T+LG D+
Sbjct  672  AGMKYSMPQYKSSTPASSL-PQPSSLSGYGGFGNANNIPGNFSLN-QGAPSAPTTLGFDE  729

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             L +Q+KD +H  +LQQ +NS MWLHG      +  P N Y       Q      QVQQP
Sbjct  730  ALGTQFKDPNHYAALQQSDNSAMWLHGAAGSRAAVPPGNFYGFQGQSQQGGFRQAQVQQP  789

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ Y  LGY P+FY SQ G+  +H    QNP +G L     N Q  P   S QLWQ+SY
Sbjct  790  SQ-YGGLGY-PSFYQSQAGLPQEH---PQNPTEGSL----NNPQAAPSQPSHQLWQHSY  839



>tpg|DAA58234.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=821

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 144/240 (60%), Gaps = 26/240 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A    
Sbjct  596  LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSAPFQQAYSSNGPFHQSAAPAVP  652

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLGIDD  583
                   +P YK+S   S+LP  +++ SGYG FG+   IPG+F  N  A A  T+LG D+
Sbjct  653  GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPGNFSQNQGAPAAPTTLGFDE  711

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q   GFRQ  Q
Sbjct  712  ALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQH-GGFRQAHQ  770

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P   S QLWQ+ Y
Sbjct  771  PSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQPSHQLWQHIY  821



>gb|EMS47817.1| hypothetical protein TRIUR3_20557 [Triticum urartu]
Length=1165

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 136/197 (69%), Gaps = 16/197 (8%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQS---LAAV-  739
            PQ L++HPYSQPTLPLGPFA+++ YP++ Q+Y   PP FQQ ++ N  + QS    AAV 
Sbjct  711  PQQLSLHPYSQPTLPLGPFASLVGYPYLPQNYYVPPPAFQQAYSSNGPFHQSDGGAAAVP  770

Query  738  -------LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDG  580
                   +P YK+ + V+S P  ++  SGYG FG++  IP +F  N SA+P+T++GID+ 
Sbjct  771  GSAMKYSMPQYKSGLPVTSPPQHSSAVSGYGGFGSSSNIP-NFGQNQSASPATTMGIDEA  829

Query  579  LSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
            LSSQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q++Q  GFR+VQQP
Sbjct  830  LSSQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSEQ-GGFREVQQP  888

Query  402  SQNYASLGYNPNFYHSQ  352
            SQ Y  LGY P+FY SQ
Sbjct  889  SQ-YGGLGY-PSFYQSQ  903



>ref|XP_010413764.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=843

 Score =   157 bits (396),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 143/241 (59%), Gaps = 40/241 (17%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ +A++PYSQPTLPL  +AN+I YP + QSY Y+P  FQQ +AGN++Y QSLAA+LP
Sbjct  585  ALPQQIAMNPYSQPTLPLTHYANMIGYPMIPQSYPYIPSAFQQAYAGNNSYHQSLAALLP  644

Query  732  NYKNSVSVSSLPHSATVPSGYGA---FGNTGTIPGS-FPLN--PSAAPS-TSLGIDDGLS  574
             YKN+ S S+LP S T      +   FGN+  +    F LN    AAPS  +L  +D LS
Sbjct  645  QYKNNTSASNLPQSTTTTPASSSAYMFGNSSNVETENFLLNQQQQAAPSGATLSYEDVLS  704

Query  573  SQYKDNHHLMSLQQV------------------------------ENSGMWLHGHGSRTM  484
             QYK N++L+SLQQ                               EN  MWLHG GS+TM
Sbjct  705  LQYKQNNYLLSLQQQQQQQLQQQQQQQQQQQQQQQQQQQQHQQQNENLPMWLHGPGSQTM  764

Query  483  SAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRD  304
            S    NTYYN+QAQ Q     +  QQ  Q Y  LGY PN+Y SQTGIS++  HQQQNPR+
Sbjct  765  SGVAGNTYYNLQAQQQSQQVRQAQQQEQQQYGLLGY-PNYYQSQTGISIE--HQQQNPRE  821

Query  303  G  301
            G
Sbjct  822  G  822



>ref|XP_010413763.1| PREDICTED: alpha-protein kinase 1-like isoform X1 [Camelina sativa]
Length=864

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 143/241 (59%), Gaps = 40/241 (17%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ +A++PYSQPTLPL  +AN+I YP + QSY Y+P  FQQ +AGN++Y QSLAA+LP
Sbjct  606  ALPQQIAMNPYSQPTLPLTHYANMIGYPMIPQSYPYIPSAFQQAYAGNNSYHQSLAALLP  665

Query  732  NYKNSVSVSSLPHSATVPSGYGA---FGNTGTIPGS-FPLN--PSAAPS-TSLGIDDGLS  574
             YKN+ S S+LP S T      +   FGN+  +    F LN    AAPS  +L  +D LS
Sbjct  666  QYKNNTSASNLPQSTTTTPASSSAYMFGNSSNVETENFLLNQQQQAAPSGATLSYEDVLS  725

Query  573  SQYKDNHHLMSLQQV------------------------------ENSGMWLHGHGSRTM  484
             QYK N++L+SLQQ                               EN  MWLHG GS+TM
Sbjct  726  LQYKQNNYLLSLQQQQQQQLQQQQQQQQQQQQQQQQQQQQHQQQNENLPMWLHGPGSQTM  785

Query  483  SAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRD  304
            S    NTYYN+QAQ Q     +  QQ  Q Y  LGY PN+Y SQTGIS++  HQQQNPR+
Sbjct  786  SGVAGNTYYNLQAQQQSQQVRQAQQQEQQQYGLLGY-PNYYQSQTGISIE--HQQQNPRE  842

Query  303  G  301
            G
Sbjct  843  G  843



>ref|XP_008645740.1| PREDICTED: uncharacterized protein LOC103627229 [Zea mays]
Length=281

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 142/240 (59%), Gaps = 26/240 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A  +P
Sbjct  56   LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSSPFQQAYSSNGPFHQSAAPAMP  112

Query  732  N---------YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDD  583
                      YK+S   S+LP  +++ SGYG FG+   IP +F  N  AA + T+LG D+
Sbjct  113  GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPRNFSQNQGAAAAPTTLGFDE  171

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q++   GFRQ   
Sbjct  172  ALGTQFKHPNHYAALQQSDNSAMWLHGGAGSRTISAVPPGNFYGFQGQSKH-GGFRQAHH  230

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQT +  +H    Q+P +G L     N    P   S QLWQ+ Y
Sbjct  231  PSQ-YGGLGY-PSFYQSQTSLPQEH---PQSPTEGSL----NNPYGVPSQPSHQLWQHIY  281



>gb|AFW71654.1| hypothetical protein ZEAMMB73_647126 [Zea mays]
Length=432

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 142/240 (59%), Gaps = 26/240 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y Y+P   FQQ ++ N  + QS A  +P
Sbjct  207  LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNY-YLPSSPFQQAYSSNGPFHQSAAPAMP  263

Query  732  N---------YKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDD  583
                      YK+S   S+LP  +++ SGYG FG+   IP +F  N  AA + T+LG D+
Sbjct  264  GAGMKYPMPQYKSSPPASTLPQPSSL-SGYGGFGSANNIPRNFSQNQGAAAAPTTLGFDE  322

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q++   GFRQ   
Sbjct  323  ALGTQFKHPNHYAALQQSDNSAMWLHGGAGSRTISAVPPGNFYGFQGQSKH-GGFRQAHH  381

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ Y  LGY P+FY SQT +  +H    Q+P +G L     N    P   S QLWQ+ Y
Sbjct  382  PSQ-YGGLGY-PSFYQSQTSLPQEH---PQSPTEGSL----NNPYGVPSQPSHQLWQHIY  432



>ref|XP_006654843.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=807

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 140/239 (59%), Gaps = 29/239 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQHLA+HPY+Q TLPLG +A++I YP + QSY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  587  LPQHLALHPYAQATLPLG-YASMIGYPSLPQSYAYLPPAAFQQPYMNSGLFHQAAAAVPN  645

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  583
                  LP YK++VS++SLP  A++ S Y G FG   ++PG+F LN S A +T+  G D 
Sbjct  646  SSVKYPLPQYKSNVSLASLPQPASLLSSYVGGFGAASSMPGNFALNQSTASATAAPGFDG  705

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + +QYK+ +H +SLQQ EN  MW+HG GSRTM    AN  Y  Q Q     G RQ Q P
Sbjct  706  TVPAQYKEGNHFVSLQQSENPAMWMHGAGSRTMPPLAANALYGYQGQQGHQGGLRQGQLP  765

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  A+LG       SQ G+     H+ +NP DG       N        + Q+W NSY
Sbjct  766  SQFGAALG------QSQPGLG----HEHRNPSDG-------NLSAAAAAQANQMWPNSY  807



>ref|XP_003567874.1| PREDICTED: uncharacterized protein LOC100840916 [Brachypodium 
distachyon]
Length=859

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 137/223 (61%), Gaps = 24/223 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY-TYMPPGFQQPFAGNSTYQQSLAAV--  739
            LPQ L VHPYSQPTLP+ PF N++ YP++ Q+Y  Y+P  FQQ ++ N  + QS AAV  
Sbjct  622  LPQQLTVHPYSQPTLPIAPFTNMMGYPYLAQNYPAYLPSAFQQAYSSNGQFHQSAAAVPG  681

Query  738  ------LPNYKNSVSVSSL----PHSATVPSGYGAFGNTGTIPGSFPLNPSA-APSTSLG  592
                  +P YK ++S ++L    P S     GYG FG++  +P +F LN +A + ST+ G
Sbjct  682  AGMKYAMPQYKGNLSATNLQQQQPSSVL---GYGGFGSSSNLPANFNLNQNATSASTNAG  738

Query  591  IDDGLSSQYKD-NHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR  418
             D+ L +QYKD N ++ +LQQ  +NS MWLHG GSRT +A P   +Y  Q Q+QQ    R
Sbjct  739  FDEALGAQYKDANQYMAALQQQGDNSAMWLHGAGSRTAAALPPTQFYGYQGQSQQ-GALR  797

Query  417  QVQQPSQNYASLGYN--PNFYHSQTGISLDHHHQQQNPRDGPL  295
            Q QQ  Q  +  G +  P FYHSQ+G++ +HH   QNP +  L
Sbjct  798  QAQQQPQQPSQFGGHGYPAFYHSQSGMTQEHH--PQNPSEASL  838



>gb|ACF86865.1| unknown [Zea mays]
Length=564

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+QPTLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  348  LPQHL-LHPYAQPTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPT  405

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  583
                  LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S AA +T+LG D 
Sbjct  406  SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTASNMPGNFPLNQSTAAATTTLGFDG  465

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  466  TVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  524

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W N+Y
Sbjct  525  SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNTY  564



>ref|XP_009132981.1| PREDICTED: uncharacterized protein LOC103857526 [Brassica rapa]
Length=808

 Score =   148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 150/240 (63%), Gaps = 31/240 (13%)
 Frame = -1

Query  903  QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  724
            Q L +HPYSQ T+PL  FAN++SYP M QSY YMP      FAGNS Y  SLAA+LP YK
Sbjct  586  QQLPMHPYSQHTVPLTHFANMMSYPLMPQSYPYMP------FAGNSPYHPSLAALLPQYK  639

Query  723  NSVSVSSLPHSAT---VPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
            N+V  S+LP SAT   + S YG FGN+ ++         AAPS  +L  +D +S QYK N
Sbjct  640  NNVLASNLPQSATSAPISSAYG-FGNSSSVGALNQQQQQAAPSGATLSYEDIMSLQYKHN  698

Query  555  HHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
             HL+SLQQ         +NS +W+HG GS+TMS   +N YYN+QAQ Q     +  QQ  
Sbjct  699  SHLLSLQQQQQQQQHQNDNSPLWVHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQ  758

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ--LWQNSY  226
            Q + SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  759  QQHGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  808



>emb|CDX84653.1| BnaA03g15770D [Brassica napus]
Length=813

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 150/240 (63%), Gaps = 31/240 (13%)
 Frame = -1

Query  903  QHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNYK  724
            Q L +HPYSQ T+PL  FAN++SYP M QSY YMP      FAGNS Y  SLAA+LP YK
Sbjct  591  QQLPMHPYSQHTVPLTHFANMMSYPLMPQSYPYMP------FAGNSPYHPSLAALLPQYK  644

Query  723  NSVSVSSLPHSAT---VPSGYGAFGNTGTIPGSFPLNPSAAPS-TSLGIDDGLSSQYKDN  556
            N+V  S+LP SAT   + S YG FGN+ ++         AAPS  +L  +D +S QYK N
Sbjct  645  NNVLASNLPQSATSAPISSAYG-FGNSSSVGALNQQQQQAAPSGATLSYEDIMSLQYKHN  703

Query  555  HHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPS  400
             HL+SLQQ         +NS +W+HG GS+TMS   +N YYN+QAQ Q     +  QQ  
Sbjct  704  SHLLSLQQQQQQQQHQNDNSPLWVHGPGSQTMSGVQSNAYYNLQAQQQAQQLRQAQQQAQ  763

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ--LWQNSY  226
            Q + SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP   +QQ  LWQNSY
Sbjct  764  QQHGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSKQTQQQHLWQNSY  813



>ref|NP_001141689.1| uncharacterized protein LOC100273818 [Zea mays]
 gb|ACN27855.1| unknown [Zea mays]
 gb|ACN28046.1| unknown [Zea mays]
 gb|AFW79333.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+QPTLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  611  LPQHL-LHPYAQPTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPT  668

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  583
                  LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S AA +T+LG D 
Sbjct  669  SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTASNMPGNFPLNQSTAAATTTLGFDG  728

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  729  TVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  787

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W N+Y
Sbjct  788  SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNTY  827



>ref|XP_008647566.1| PREDICTED: uncharacterized protein LOC100273818 isoform X1 [Zea 
mays]
Length=828

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 140/239 (59%), Gaps = 33/239 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+QPTLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  612  LPQHL-LHPYAQPTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPT  669

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  583
                  LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S AA +T+LG D 
Sbjct  670  SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTASNMPGNFPLNQSTAAATTTLGFDG  729

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  730  TVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  788

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W N+Y
Sbjct  789  SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNTY  828



>ref|XP_002881327.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57586.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 140/244 (57%), Gaps = 44/244 (18%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            A+PQ +A+HPYSQPTLPL  +AN+ISYP M QSY Y+P  FQQ FAGN++Y QSLAA+LP
Sbjct  603  AIPQQIAMHPYSQPTLPLTHYANMISYPLMPQSYPYIPSTFQQAFAGNNSYHQSLAALLP  662

Query  732  NYKNSVSVSSLPH---SATVPSGYGAFGNTGTIPGSFPLN-PSAAP-STSLGIDDGLSSQ  568
             YKN++S S+LP    S    S YG   ++    G+F LN    AP   +   +D LS Q
Sbjct  663  QYKNNISASNLPQSATSPASSSAYGVGNSSNVEAGNFLLNQQQVAPIGATFSYEDALSLQ  722

Query  567  YKDNHHLMSLQQV---------------------------------ENSGMWLHGHGSRT  487
            YK N++L+ LQQ                                  EN  MWL+G GS+T
Sbjct  723  YKQNNYLLYLQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQNENFPMWLNGPGSQT  782

Query  486  MSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL---GYNPNFYHSQTGISLDHHHQQQ  316
            MS  P+NTYYN++AQ Q     +  QQ  Q   +    GY PN+Y SQTG+S++   QQQ
Sbjct  783  MSGVPSNTYYNLEAQQQSQQVRQAQQQAQQAQQAQQQYGY-PNYYQSQTGMSME--QQQQ  839

Query  315  NPRD  304
            NPRD
Sbjct  840  NPRD  843



>ref|XP_002440322.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
 gb|EES18752.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
Length=649

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 139/239 (58%), Gaps = 33/239 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  + Q+ AAV  
Sbjct  433  LPQHL-LHPYAQATLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGLFHQAAAAVPN  490

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSA-APSTSLGIDD  583
                  LP YK++++++SLP   ++ S Y G FG    +PG+FPLN S  + +T+LG D 
Sbjct  491  SSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATTTLGFDG  550

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + S +KD +  +SLQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q P
Sbjct  551  TVPSHFKDGNQFISLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-AGLRQGQLP  609

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  610  SQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  649



>dbj|BAJ92311.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 141/229 (62%), Gaps = 27/229 (12%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISY------PFMHQSY-TYMP-PGFQQPFAGNSTYQ  757
            +LPQ L VHPYSQPTLP+ PFAN+I        P++ Q+Y  Y+P   FQQ ++ N  + 
Sbjct  619  SLPQQL-VHPYSQPTLPIAPFANMIGANMIGYNPYLAQNYPAYLPSTAFQQAYSSNGQFH  677

Query  756  QSLAAV--------LPNYKNSVSVSSLPHS---ATVPSGYGAFGNTGTIPGSFPLNPSAA  610
            QS AAV        +P YKN++S ++L      ++V SGY  FG++  +PG+F LN +AA
Sbjct  678  QSAAAVPGAGMKYSMPQYKNNMSAANLQQQQQPSSVISGYAGFGSSSNLPGNFALNQNAA  737

Query  609  P-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  436
            P S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+Q
Sbjct  738  PASANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQ  797

Query  435  QPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  295
            Q   FR  Q  Q    Y   GY P FYH+Q G++ +HH   QNP DG L
Sbjct  798  QQGAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQEHH--PQNPADGTL  843



>gb|EMS63247.1| hypothetical protein TRIUR3_29233 [Triticum urartu]
Length=823

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 141/229 (62%), Gaps = 27/229 (12%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISY------PFMHQSY-TYMP-PGFQQPFAGNSTYQ  757
            +LPQ L VHPYSQPTLP+ PFAN+I        P++ Q+Y  Y+P   FQQ ++ N  + 
Sbjct  597  SLPQQL-VHPYSQPTLPIAPFANMIGANMIGYNPYLAQNYPAYLPSTAFQQAYSSNGQFH  655

Query  756  QSLAAV--------LPNYKNSVSVSSLPHS---ATVPSGYGAFGNTGTIPGSFPLNPSAA  610
            QS AAV        +P YKN++S ++L      ++V SGY  FG++  +PG+F LN +AA
Sbjct  656  QSAAAVPGAGMKYSMPQYKNNMSGANLQQQQQPSSVISGYAGFGSSSNLPGNFALNQNAA  715

Query  609  P-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  436
            P S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+Q
Sbjct  716  PPSANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQ  775

Query  435  QPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  295
            Q   FR  Q  Q    Y   GY P FYHSQ G++ +HH   QNP DG L
Sbjct  776  QQGAFRQAQQPQQPSQYGGHGY-PAFYHSQGGMAQEHH--PQNPADGAL  821



>dbj|BAJ85689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score =   144 bits (364),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 140/229 (61%), Gaps = 27/229 (12%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISY------PFMHQSY-TYMP-PGFQQPFAGNSTYQ  757
            +LPQ L VHPYSQPTLP+ PFAN+I        P++ Q+Y  Y+P   FQQ ++ N  + 
Sbjct  619  SLPQQL-VHPYSQPTLPIAPFANMIGANMIGYNPYLAQNYPAYLPSTAFQQAYSSNGQFH  677

Query  756  QSLAAV--------LPNYKNSVSVSSLPHS---ATVPSGYGAFGNTGTIPGSFPLNPSAA  610
            QS AAV        +P YKN++S ++L      ++V SGY  FG++  +PG+F LN +AA
Sbjct  678  QSAAAVPGAGMKYSMPQYKNNMSAANLQQQQQPSSVISGYAGFGSSSNLPGNFALNQNAA  737

Query  609  P-STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  436
            P S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+Q
Sbjct  738  PASANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQ  797

Query  435  QPSGFR--QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  295
            Q   FR  Q  Q    Y   GY P FYH+Q G++  HH   QNP DG L
Sbjct  798  QQGAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQGHH--PQNPADGTL  843



>ref|XP_008656717.1| PREDICTED: uncharacterized protein LOC103636139 [Zea mays]
 gb|AFW83479.1| putative DUF1296 domain containing family protein [Zea mays]
Length=840

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 141/239 (59%), Gaps = 22/239 (9%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPN  730
            LPQ L V  YSQPTLPLGPF +++ YP++ Q+Y      FQQ ++ N  + QS A  +P 
Sbjct  613  LPQQLPV--YSQPTLPLGPFTSLVGYPYLPQNYYLPSAAFQQAYSSNGPFHQSGAPAVPG  670

Query  729  YKNSVSV----SSLP----HSATVPSGYGAFGNTGTIPGSFPLNPSAAPS--TSLGIDDG  580
                 S+    SS P       +  SGYG FGN   IPG+F LN   APS  T+LG D+ 
Sbjct  671  AGMKYSMPQYKSSPPASSLPQPSSLSGYGGFGNANNIPGNFSLN-QGAPSAPTTLGFDEA  729

Query  579  LSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
            L +Q+KD +H  +LQQ +NS MWLH G GSRT+SA P   +Y +Q Q+QQ  GFRQ  QP
Sbjct  730  LGTQFKDPNHYAALQQSDNSAMWLHGGAGSRTVSAVPPGNFYGLQGQSQQ-GGFRQAHQP  788

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ Y  LGY P+FY SQ+  SL   H  QN  +G L     N+Q  P   S  LWQ+SY
Sbjct  789  SQ-YGGLGY-PSFYQSQSQASLPQEH-PQNLTEGSL----NNSQGVPSQPSHHLWQHSY  840



>ref|XP_008229421.1| PREDICTED: cell wall protein AWA1-like [Prunus mume]
Length=840

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 128/239 (54%), Gaps = 30/239 (13%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
             LPQHL    YSQP L     ANII YP M QSY+  P   QQ + G S +QQS+A +  
Sbjct  622  VLPQHLTSRSYSQPALSYEQLANIIGYPSMTQSYSPAPSTLQQAYLGGSAFQQSVAGMDY  681

Query  738  -LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  562
              P Y++  SVS LP SA    G+G FG +  + GSF  N SAAP +    DD L ++YK
Sbjct  682  NFPQYRSGASVSRLPPSAAAVGGHGNFGASNNVHGSFLQNASAAPISMSDYDDALRARYK  741

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--Q  397
            D  HL  L Q            SRT+S+ P + Y N+  QNQQ +G+RQ    Q PS  Q
Sbjct  742  DGSHLTPLHQ-----------SSRTLSSVPDSVYDNLLRQNQQNAGYRQGQAGQMPSQLQ  790

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ--QLWQNSY  226
            +Y S GY P+FY SQ GI+ +HH Q  N  D  L      A +Q     Q  Q+WQ +Y
Sbjct  791  HYGSPGY-PDFYPSQMGITQEHHRQSLN--DLSL------AGIQDLSPQQLHQIWQRTY  840



>ref|XP_002440264.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
 gb|EES18694.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
Length=856

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 141/245 (58%), Gaps = 29/245 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYP-FMHQSY-TYMPPG-FQQPFAGNSTYQQSLAAV  739
            LPQ LA HPYSQPTLP+  F N++ YP ++ Q+Y TY+  G FQQ +  N  + QS AA+
Sbjct  616  LPQQLAHHPYSQPTLPITHFPNMVGYPTYLPQNYATYLSSGTFQQAYPSNGPFHQSAAAL  675

Query  738  L--------PNYKNSVSVSSLPHS--------ATVPSGYGAFGNTGTIPGSFPLNPSAAP  607
            L        P YKN++S + L           ++V SGYG FG++G I G+F LN S   
Sbjct  676  LGSGMKYSTPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGFGSSGNIQGNFTLNQSTGS  735

Query  606  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  427
            +++LG D+ LS QYKD    M+LQQ +NSGMWLHG GSR  S  P N +Y  Q Q+Q   
Sbjct  736  ASTLGFDEALSRQYKDTSQYMALQQGDNSGMWLHGSGSRATSTLPPNHFYGYQGQSQL-G  794

Query  426  GFRQVQQPS-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  250
            GFRQ QQP    +   GY P FY SQ G++ +H    QN  +G L G     QV P   S
Sbjct  795  GFRQAQQPQPSQFGGHGY-PTFYQSQGGLTQEH---PQNLAEGSLNGF----QVAPSQPS  846

Query  249  QQLWQ  235
               WQ
Sbjct  847  HPNWQ  851



>gb|EEC79757.1| hypothetical protein OsI_21141 [Oryza sativa Indica Group]
Length=798

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 26/239 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  575  LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  633

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  583
                  LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  634  SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  693

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  694  TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALYGYQGQQGHQGGLRQGQLP  753

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  754  SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAAAA----QANQMWPNSY  798



>ref|XP_008654853.1| PREDICTED: uncharacterized protein LOC100280182 isoform X3 [Zea 
mays]
Length=792

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  575  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  632

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  633  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  692

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  693  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  751

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  752  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  792



>ref|XP_008654854.1| PREDICTED: uncharacterized protein LOC100280182 isoform X4 [Zea 
mays]
Length=791

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  574  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  631

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  632  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  691

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  692  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  750

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  751  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  791



>gb|AFW81250.1| putative DUF1296 domain containing family protein [Zea mays]
Length=787

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  570  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  627

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  628  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  687

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  688  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  746

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  747  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  787



>ref|XP_007217053.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
 gb|EMJ18252.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
Length=883

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 127/239 (53%), Gaps = 30/239 (13%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
             LPQHL    YSQP L     ANI+ YP M QSY+  P   QQ + G S +QQS+A +  
Sbjct  665  VLPQHLTSRSYSQPALSYEQLANIMGYPSMTQSYSPAPSTLQQAYLGGSAFQQSVAGMDY  724

Query  738  -LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  562
              P Y++  SVS LP SA    G+G FG +  + GSF  N SAAP +    DD L ++YK
Sbjct  725  NFPQYRSGASVSRLPPSAAAVGGHGNFGASNNVHGSFLQNASAAPISMSDYDDALRARYK  784

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS--Q  397
            D  HL  L Q            SRT+S+ P + Y  +  QNQQ +G++Q    Q PS  Q
Sbjct  785  DGSHLTPLHQ-----------SSRTLSSIPDSVYNTLLRQNQQNAGYQQGQAGQMPSQLQ  833

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ--QLWQNSY  226
            +Y S GY P+FY SQ GI+ +HH Q  N  D  L      A +Q     Q  Q+WQ +Y
Sbjct  834  HYGSPGY-PDFYPSQMGITQEHHRQSVN--DLSL------AGIQDLSPQQLHQIWQRTY  883



>ref|XP_008654851.1| PREDICTED: uncharacterized protein LOC100280182 isoform X1 [Zea 
mays]
 gb|AFW81249.1| putative DUF1296 domain containing family protein [Zea mays]
Length=826

 Score =   136 bits (342),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  609  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  666

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  667  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  726

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  727  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  785

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  786  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  826



>ref|NP_001146586.1| uncharacterized protein LOC100280182 [Zea mays]
 gb|ACL54332.1| unknown [Zea mays]
Length=827

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  610  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  667

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  668  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  727

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  728  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  786

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  787  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  827



>gb|AFW81248.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  610  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  667

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  668  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  727

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  728  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  786

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  787  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  827



>ref|XP_008654852.1| PREDICTED: uncharacterized protein LOC100280182 isoform X2 [Zea 
mays]
Length=823

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  606  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  663

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  664  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  723

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  724  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  782

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  783  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  823



>gb|AFW81251.1| putative DUF1296 domain containing family protein [Zea mays]
Length=847

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 34/240 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAVLP  733
            LPQHL +HPY+Q TLPLG +A++I YP +  SY Y+PP  FQQP+  +  +    AA +P
Sbjct  630  LPQHL-LHPYAQTTLPLG-YASMIGYPSLPPSYAYLPPAAFQQPYMNSGMFLHQAAAAVP  687

Query  732  N---------YKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPST-SLGID  586
            N         YK++++++SLP   ++ S Y G FG    +PG+FPLN S   +T +LG D
Sbjct  688  NSSVKYPLPQYKSNIALASLPQPGSLLSSYVGGFGTANNMPGNFPLNQSTTSATATLGFD  747

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
              + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  748  GTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-TGLRQGQL  806

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            PSQ  ++LG       SQ G+  +H    +NP D  L G            + Q+W NSY
Sbjct  807  PSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------ANQMWPNSY  847



>ref|NP_001056433.1| Os05g0581800 [Oryza sativa Japonica Group]
 gb|AAU10711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18347.1| Os05g0581800 [Oryza sativa Japonica Group]
Length=852

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 29/239 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  632  LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  690

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  583
                  LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  691  SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  750

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  751  TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY-YQGQQGHQGGLRQGQLP  809

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  810  SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAA------QANQMWPNSY  852



>gb|AAT44198.1| unknown protein [Oryza sativa Japonica Group]
Length=860

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 29/239 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  640  LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  698

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  583
                  LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  699  SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  758

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  759  TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY-YQGQQGHQGGLRQGQLP  817

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  818  SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAA------QANQMWPNSY  860



>gb|EEE64826.1| hypothetical protein OsJ_19683 [Oryza sativa Japonica Group]
Length=853

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 135/239 (56%), Gaps = 29/239 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPP-GFQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A++I YP +  SYTY+PP  FQQP+  +  + Q+ AAV  
Sbjct  633  LPQHLTLHPYAQATLPLG-YASMIGYPSLAPSYTYLPPPAFQQPYMNSGLFHQAAAAVPN  691

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GIDD  583
                  LP YK +VS++SLP  A++ S Y G FG   ++PG+F LN S   +T+  G D 
Sbjct  692  SSVKYPLPQYKGNVSLASLPQQASLLSSYVGGFGAASSMPGNFALNQSTPSATAAPGFDG  751

Query  582  GLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQP  403
             + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ Q P
Sbjct  752  TVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY-YQGQQGHQGGLRQGQLP  810

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            SQ  A L        +Q G+     H+ +NP DG L      A       + Q+W NSY
Sbjct  811  SQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAA------QANQMWPNSY  853



>ref|XP_006654800.1| PREDICTED: uncharacterized protein LOC102700994 [Oryza brachyantha]
Length=815

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 147/244 (60%), Gaps = 27/244 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY--TYMP-PGFQQPFAGNSTYQQSLAAV  739
            LPQ L VHPYSQPT+PL PFAN+I YP++ Q+Y   Y+P   FQQ ++ N  + QS AA 
Sbjct  575  LPQQL-VHPYSQPTVPLAPFANMIGYPYLAQNYPAAYLPSAAFQQAYSSNGPFHQSPAAA  633

Query  738  LPN-------------YKNSVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAA-PS  604
            +P              YKN++S +SL    ++V SGYG FG++  + G+F LN +AA  S
Sbjct  634  VPGGAMKYNMNVLPQQYKNNLSATSLQQQPSSVISGYGGFGSSSNLQGNFNLNQNAASAS  693

Query  603  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  424
            T+LG D+ LS+ YKD +  M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ   
Sbjct  694  TNLGFDEALSTPYKDPNQYMALQQGDNSAMWLHGAGSRATSAVPPSHFYGFQGQSQQGGF  753

Query  423  -FRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  247
               Q  Q    +   GY P FYHSQ+G++ +HH   QNP +G    G  +AQ QP   S 
Sbjct  754  RQAQQPQQHSQFGGHGY-PAFYHSQSGLTQEHH---QNPAEGGGLNGFQSAQSQP---SH  806

Query  246  QLWQ  235
            Q WQ
Sbjct  807  QGWQ  810



>emb|CBI20348.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = -1

Query  567  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  391
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q QNQQP GFRQ  QPSQ++
Sbjct  74   YKNGNHLISFQQQNENSTMWNHGPGSQTMSAVPANTYYSFQGQNQQPGGFRQGHQPSQHF  133

Query  390  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  238
              LGY PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  134  GVLGY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  177



>gb|EEC79711.1| hypothetical protein OsI_21014 [Oryza sativa Indica Group]
Length=852

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 145/241 (60%), Gaps = 28/241 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY--TYMP-PGFQQPFAGNSTYQQSLAAV  739
            LPQ L VHPYSQPT+PL PFAN+I YP++ Q+Y   Y+P   FQQ ++ N  + QS AA 
Sbjct  619  LPQQL-VHPYSQPTVPLAPFANMIGYPYLAQNYPAAYLPSAAFQQAYSSNGPFHQSAAAA  677

Query  738  LPN----------YKNSVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSL  595
            +P           +KN++S +SL    ++V SGYG FG++  +PG+F LN +AA  ST+L
Sbjct  678  VPGAMKYNMNVPQFKNNLSATSLQQQPSSVISGYGGFGSSSNLPGNFTLNQNAASASTNL  737

Query  594  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG-FR  418
            G D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ      
Sbjct  738  GFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPPSHFYGFQGQSQQGGFRQA  797

Query  417  QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  238
            Q  Q    +   GY P FYHSQ   S +HH   QNP +G L  G  NAQ QP   S Q W
Sbjct  798  QQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-NGFQNAQSQP---SHQGW  846

Query  237  Q  235
            Q
Sbjct  847  Q  847



>ref|NP_001056347.1| Os05g0566900 [Oryza sativa Japonica Group]
 gb|AAU10662.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18261.1| Os05g0566900 [Oryza sativa Japonica Group]
 dbj|BAG89781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00089.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64717.1| hypothetical protein OsJ_19573 [Oryza sativa Japonica Group]
Length=852

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 145/241 (60%), Gaps = 28/241 (12%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY--TYMP-PGFQQPFAGNSTYQQSLAAV  739
            LPQ L VHPYSQPT+PL PFAN+I YP++ Q+Y   Y+P   FQQ ++ N  + QS AA 
Sbjct  619  LPQQL-VHPYSQPTVPLAPFANMIGYPYLAQNYPAAYLPSAAFQQAYSSNGPFHQSAAAA  677

Query  738  LPN----------YKNSVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAA-PSTSL  595
            +P           +KN++S +SL    ++V SGYG FG++  +PG+F LN +AA  ST+L
Sbjct  678  VPGAMKYNMNVPQFKNNLSATSLQQQPSSVISGYGGFGSSSNLPGNFTLNQNAASASTNL  737

Query  594  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG-FR  418
            G D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ      
Sbjct  738  GFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPPSHFYGFQGQSQQGGFRQA  797

Query  417  QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  238
            Q  Q    +   GY P FYHSQ   S +HH   QNP +G L  G  NAQ QP   S Q W
Sbjct  798  QQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-NGFQNAQSQP---SHQGW  846

Query  237  Q  235
            Q
Sbjct  847  Q  847



>ref|XP_004961107.1| PREDICTED: uncharacterized protein LOC101764022 isoform X2 [Setaria 
italica]
Length=793

 Score =   127 bits (318),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 127/217 (59%), Gaps = 29/217 (13%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYM-PPGFQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A +I YP +  SY Y+ P  FQQP+  N  + Q+ AAV  
Sbjct  581  LPQHL-LHPYAQATLPLG-YAGMIGYPSLPPSYAYIQPAAFQQPYMSN-MFHQAAAAVPN  637

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  583
                  LP YK   +++SLP  A++ S Y G FG    +PG+FP+N S A+ +T+LG D 
Sbjct  638  SSVKYPLPQYK---ALASLPQPASLLSSYVGGFGTANNMPGNFPVNQSTASATTTLGFDG  694

Query  582  GLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             +   YK+ +  +SLQQ  EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  695  SVPPHYKEGNQFISLQQQNENPAMWMHGAGSRGMPPLAASTLYGYQGQSHQ-AGLRQGQL  753

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  295
            PSQ   +LG       SQ G+  +H    +NP DG L
Sbjct  754  PSQFGTALG------QSQPGLGPEH----RNPSDGNL  780



>ref|XP_004961106.1| PREDICTED: uncharacterized protein LOC101764022 isoform X1 [Setaria 
italica]
Length=794

 Score =   127 bits (318),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 127/217 (59%), Gaps = 29/217 (13%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYM-PPGFQQPFAGNSTYQQSLAAV--  739
            LPQHL +HPY+Q TLPLG +A +I YP +  SY Y+ P  FQQP+  N  + Q+ AAV  
Sbjct  582  LPQHL-LHPYAQATLPLG-YAGMIGYPSLPPSYAYIQPAAFQQPYMSN-MFHQAAAAVPN  638

Query  738  ------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPS-AAPSTSLGIDD  583
                  LP YK   +++SLP  A++ S Y G FG    +PG+FP+N S A+ +T+LG D 
Sbjct  639  SSVKYPLPQYK---ALASLPQPASLLSSYVGGFGTANNMPGNFPVNQSTASATTTLGFDG  695

Query  582  GLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ  406
             +   YK+ +  +SLQQ  EN  MW+HG GSR M    A+T Y  Q Q+ Q +G RQ Q 
Sbjct  696  SVPPHYKEGNQFISLQQQNENPAMWMHGAGSRGMPPLAASTLYGYQGQSHQ-AGLRQGQL  754

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  295
            PSQ   +LG       SQ G+  +H    +NP DG L
Sbjct  755  PSQFGTALG------QSQPGLGPEH----RNPSDGNL  781



>ref|XP_010230981.1| PREDICTED: uncharacterized protein LOC100825596 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 132/243 (54%), Gaps = 35/243 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LP HLA+HPY+Q TLPLG + +++ YP + QSY   P  FQQP+  +  + Q+ AA    
Sbjct  628  LPHHLALHPYAQATLPLG-YTSMMGYPSLPQSYYLPPAAFQQPYMNSGLFHQAAAAAAAA  686

Query  738  ----------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-  595
                      +P YK++V ++S+P  A++ S Y G FG    +PG++ LN S+ P+ +  
Sbjct  687  AAPNSNVKYPMPQYKSNVPLASMPQQASLLSNYVGGFGTANGMPGNYALNQSSVPANAAP  746

Query  594  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  415
            G D  + SQYKD +H +SLQQ EN  MW+HG GSR M    ANT Y  Q Q     G RQ
Sbjct  747  GFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGSRGMPPLAANTLYGYQGQQGHQGGLRQ  806

Query  414  VQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  235
             Q PSQ  A+LG       SQ G+  +H    +NP D  L   G          + Q+W 
Sbjct  807  GQLPSQFGAALG------QSQQGLGQEH----RNPSDSNLSAAGQ---------ANQMWP  847

Query  234  NSY  226
            NSY
Sbjct  848  NSY  850



>ref|XP_003567822.1| PREDICTED: uncharacterized protein LOC100825596 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 132/243 (54%), Gaps = 35/243 (14%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---  739
            LP HLA+HPY+Q TLPLG + +++ YP + QSY   P  FQQP+  +  + Q+ AA    
Sbjct  627  LPHHLALHPYAQATLPLG-YTSMMGYPSLPQSYYLPPAAFQQPYMNSGLFHQAAAAAAAA  685

Query  738  ----------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-  595
                      +P YK++V ++S+P  A++ S Y G FG    +PG++ LN S+ P+ +  
Sbjct  686  AAPNSNVKYPMPQYKSNVPLASMPQQASLLSNYVGGFGTANGMPGNYALNQSSVPANAAP  745

Query  594  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  415
            G D  + SQYKD +H +SLQQ EN  MW+HG GSR M    ANT Y  Q Q     G RQ
Sbjct  746  GFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGSRGMPPLAANTLYGYQGQQGHQGGLRQ  805

Query  414  VQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  235
             Q PSQ  A+LG       SQ G+  +H    +NP D  L   G          + Q+W 
Sbjct  806  GQLPSQFGAALG------QSQQGLGQEH----RNPSDSNLSAAGQ---------ANQMWP  846

Query  234  NSY  226
            NSY
Sbjct  847  NSY  849



>ref|XP_006410568.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52021.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=885

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 87/129 (67%), Gaps = 9/129 (7%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLP  733
            ALPQ L +HPYSQ T+PL  FAN+I YP M QSY YMP  FQQ FAGNS+Y QSLAA+LP
Sbjct  604  ALPQQLPMHPYSQHTVPLAHFANMIGYPLMPQSYPYMPSAFQQAFAGNSSYHQSLAALLP  663

Query  732  NYKNSVSVSSLPHSAT---VPSGYGAFGNTGTI-PGSFPLN----PSAAPSTSLGIDDGL  577
             YKN++S S++P SAT     S YG FGN+     G++PLN     SA    SL  +D L
Sbjct  664  QYKNNISASNVPQSATSAPTSSAYG-FGNSSNAGAGNYPLNHQQQQSAPSGASLSYEDAL  722

Query  576  SSQYKDNHH  550
            S QYK N+H
Sbjct  723  SLQYKQNNH  731



>ref|XP_007048866.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
 gb|EOX93023.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
Length=873

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 130/239 (54%), Gaps = 34/239 (14%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
             L +HL+ H YSQ             YP + QS+TY P   Q  +   + + +S + +  
Sbjct  659  VLKEHLSAHSYSQ-----------TGYPAIPQSHTYSPYALQHAYPNGNVFHESFSGMKY  707

Query  738  -LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTS-LGIDDGLSSQY  565
             LP Y+ S S+SSLP S +  SGY + GN+  IPGSF  N SA P+ S +G DD L SQY
Sbjct  708  NLPQYR-SNSMSSLPLSGSYTSGYESLGNSTDIPGSFLHNLSAGPAGSKVGYDDFLRSQY  766

Query  564  KD---NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQN  394
            +D   N +L  LQQ + S +W + HGSRT S  P + YY++Q QN Q +G+ Q Q+ SQ 
Sbjct  767  RDGGANFNL--LQQNDGSAVWDYVHGSRTTSTIPHSAYYSLQGQNHQLAGYHQGQRHSQL  824

Query  393  YASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQL---WQNSY  226
            +  LGY P  Y+SQ GI+     QQQN  D  L G          PSS+QL   WQ  Y
Sbjct  825  HGFLGY-PGVYNSQAGIT--REQQQQNLGDVILNGSQS-------PSSKQLPQNWQRRY  873



>emb|CAN79286.1| hypothetical protein VITISV_039797 [Vitis vinifera]
Length=298

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = -1

Query  567  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  391
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q+QNQQP  FRQ  QPSQ++
Sbjct  191  YKNGNHLISFQQQNENSAMWNHGPGSQTMSAVPANTYYSFQSQNQQPGRFRQGHQPSQHF  250

Query  390  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  238
             +L Y PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  251  GALEY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  294



>emb|CDY37665.1| BnaA04g20030D, partial [Brassica napus]
Length=670

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 89/130 (68%), Gaps = 8/130 (6%)
 Frame = -1

Query  906  PQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVLPNY  727
            PQ L +HPYSQ T+PL  FAN+ISYP M Q Y YMP  FQQ F+GNS+Y QS AA+LP Y
Sbjct  529  PQQLPMHPYSQHTVPLTHFANMISYPLMPQGYPYMPSAFQQAFSGNSSYHQSPAALLPQY  588

Query  726  KNSVSVSSLPHSATVPSGYGAFGNTGTI-PGSFPLN-----PSAAPS-TSLGIDDGLSSQ  568
            KN++S SSLP SA + S YG FGN+  +  G+F LN       AAP+  +L  +D +S Q
Sbjct  589  KNNISPSSLPQSAPISSPYG-FGNSSNVGAGNFSLNQQQQQQQAAPTGATLSYEDVMSLQ  647

Query  567  YKDNHHLMSL  538
            YK N HL+SL
Sbjct  648  YKQNSHLLSL  657



>ref|NP_001266740.1| uncharacterized protein LOC101027201 [Zea mays]
 gb|ACN30616.1| unknown [Zea mays]
Length=390

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 133/245 (54%), Gaps = 28/245 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTL-PLGPFANIISYP-FMHQSYT-YMPPG-FQQPFAGNSTYQQSLAA  742
            LPQ LA HPYSQPTL P+  F NI+ YP ++ Q+Y  Y+  G FQQ +  N  + QS AA
Sbjct  149  LPQQLAHHPYSQPTLAPITHFPNIVGYPPYLPQNYAAYLSSGTFQQAYPSNGAFHQSAAA  208

Query  741  VL--------PNYKNSVSVSSLPHS--------ATVPSGYGAFGNTGTIPGSFPLNPSAA  610
            +L        P YKN++S + L           ++V SGYG  G++  I G+F LN S  
Sbjct  209  LLGSGMKYSAPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGLGSSSNIQGNFTLNQSTG  268

Query  609  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  430
              ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q  
Sbjct  269  TGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLG  327

Query  429  SGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  250
               +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G     QV P   S
Sbjct  328  GFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF----QVAPSQPS  380

Query  249  QQLWQ  235
               WQ
Sbjct  381  HPSWQ  385



>emb|CAE00871.1| TA9 protein [Oryza sativa Japonica Group]
Length=140

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = -1

Query  669  GAFGNTGTIPGSFPLN---PSAAPSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-  502
            G FG++  IPG+F LN   PSA   T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG 
Sbjct  1    GGFGSSNNIPGNFGLNQNVPSAP--TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGA  58

Query  501  HGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQ  322
             GSR +SA P   +Y  Q QN QP GFRQ QQPSQ Y  LGY P+FY SQ G+  +H   
Sbjct  59   AGSRAVSAVPPGNFYGFQGQN-QPGGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPHEH---  112

Query  321  QQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             QN  +G L     ++Q  P   S Q+WQ+ Y
Sbjct  113  PQNLTEGTL----NSSQTTPSQPSHQIWQHIY  140



>ref|XP_008655403.1| PREDICTED: uncharacterized protein LOC101027201 isoform X2 [Zea 
mays]
Length=836

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 133/245 (54%), Gaps = 28/245 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTL-PLGPFANIISYP-FMHQSYT-YMPPG-FQQPFAGNSTYQQSLAA  742
            LPQ LA HPYSQPTL P+  F NI+ YP ++ Q+Y  Y+  G FQQ +  N  + QS AA
Sbjct  595  LPQQLAHHPYSQPTLAPITHFPNIVGYPPYLPQNYAAYLSSGTFQQAYPSNGAFHQSAAA  654

Query  741  VL--------PNYKNSVSVSSLPHS--------ATVPSGYGAFGNTGTIPGSFPLNPSAA  610
            +L        P YKN++S + L           ++V SGYG  G++  I G+F LN S  
Sbjct  655  LLGSGMKYSAPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGLGSSSNIQGNFTLNQSTG  714

Query  609  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  430
              ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q  
Sbjct  715  TGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLG  773

Query  429  SGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  250
               +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G     QV P   S
Sbjct  774  GFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF----QVAPSQPS  826

Query  249  QQLWQ  235
               WQ
Sbjct  827  HPSWQ  831



>ref|XP_008655402.1| PREDICTED: uncharacterized protein LOC101027201 isoform X1 [Zea 
mays]
 gb|AFW81159.1| putative DUF1296 domain containing family protein [Zea mays]
Length=856

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 133/245 (54%), Gaps = 28/245 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTL-PLGPFANIISYP-FMHQSYT-YMPPG-FQQPFAGNSTYQQSLAA  742
            LPQ LA HPYSQPTL P+  F NI+ YP ++ Q+Y  Y+  G FQQ +  N  + QS AA
Sbjct  615  LPQQLAHHPYSQPTLAPITHFPNIVGYPPYLPQNYAAYLSSGTFQQAYPSNGAFHQSAAA  674

Query  741  VL--------PNYKNSVSVSSLPHS--------ATVPSGYGAFGNTGTIPGSFPLNPSAA  610
            +L        P YKN++S + L           ++V SGYG  G++  I G+F LN S  
Sbjct  675  LLGSGMKYSAPEYKNNLSATGLQQQHQPQPQPPSSVISGYGGLGSSSNIQGNFTLNQSTG  734

Query  609  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  430
              ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q  
Sbjct  735  TGSTLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLG  793

Query  429  SGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  250
               +  QQ    +   GY P FY SQ G++ +HH   QN  +G L G     QV P   S
Sbjct  794  GFGQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSLNGF----QVAPSQPS  846

Query  249  QQLWQ  235
               WQ
Sbjct  847  HPSWQ  851



>ref|XP_010449499.1| PREDICTED: uncharacterized protein LOC104731723 isoform X2 [Camelina 
sativa]
Length=794

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 129/237 (54%), Gaps = 38/237 (16%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  580  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  636

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL+S 
Sbjct  637  ATAPPVP----PPSAYG-FGGGAASSNNFPLNPTNATNS---YEDVLSSQFKDSNHLVSS  688

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  373
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  689  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  745

Query  372  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  746  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  794



>ref|XP_010449498.1| PREDICTED: uncharacterized protein LOC104731723 isoform X1 [Camelina 
sativa]
Length=795

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 129/237 (54%), Gaps = 38/237 (16%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  581  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  637

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL+S 
Sbjct  638  ATAPPVP----PPSAYG-FGGGAASSNNFPLNPTNATNS---YEDVLSSQFKDSNHLVSS  689

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  373
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  690  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  746

Query  372  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  747  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  795



>ref|XP_008650021.1| PREDICTED: cell wall protein AWA1-like [Zea mays]
 gb|AFW79202.1| putative DUF1296 domain containing family protein [Zea mays]
Length=851

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 118/206 (57%), Gaps = 22/206 (11%)
 Frame = -1

Query  909  LPQHLAVHPYSQPTLPLGPFANIISYPFMHQSY-TYMPPG-FQQPFAGNSTYQQS-----  751
            LPQ LA HPYSQPTLP+  F N++ YP++ Q+Y TY+  G FQQ +  +  + QS     
Sbjct  614  LPQQLAHHPYSQPTLPITHFPNMVGYPYLPQNYATYLSSGTFQQAYPSSGPFHQSAAAAL  673

Query  750  ----LAAVLPNYKNSVSVSSLPHS--------ATVPSGYGAFGNTGTIPGSFPLNPSAAP  607
                +    P YKN++S + L           ++V SGYG FG++  I G+F L+ S   
Sbjct  674  LASGMKYSTPEYKNNLSATGLQQQHQPQPQPLSSVISGYGGFGSSSNIQGNFTLSQSTGS  733

Query  606  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  427
            +++LG D+ LS QYK+    M+LQQ +NSGMW+HG GSR  S  P N +Y  Q Q+Q   
Sbjct  734  ASALGFDEALSRQYKNTSQYMALQQGDNSGMWVHGSGSRAASTLPPNHFYGYQGQSQL-G  792

Query  426  GFRQVQQPS-QNYASLGYNPNFYHSQ  352
            GF + QQP    +   GY P  Y SQ
Sbjct  793  GFARAQQPQPSQFGGHGY-PTVYQSQ  817



>ref|XP_010439897.1| PREDICTED: uncharacterized protein LOC104723267 isoform X1 [Camelina 
sativa]
Length=799

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 130/237 (55%), Gaps = 38/237 (16%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFA-GNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F+ GN    QSLAA+LP YK  
Sbjct  585  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFSTGN---HQSLAAMLPQYKTQ  641

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP+ A ++    +D L+SQ+KD++HL+S 
Sbjct  642  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLTSQFKDSNHLVSS  693

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  373
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  694  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  750

Query  372  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  751  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  799



>ref|XP_010439898.1| PREDICTED: uncharacterized protein LOC104723267 isoform X2 [Camelina 
sativa]
Length=798

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 130/237 (55%), Gaps = 38/237 (16%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFA-GNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F+ GN    QSLAA+LP YK  
Sbjct  584  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFSTGN---HQSLAAMLPQYKTQ  640

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP+ A ++    +D L+SQ+KD++HL+S 
Sbjct  641  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLTSQFKDSNHLVSS  692

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFRQVQQPSQNYASLGYN  373
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFRQ QQ  Q   S    
Sbjct  693  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQPSQQQQ  749

Query  372  PNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             +F        YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  750  QHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQTQQQLWPNNY  798



>ref|XP_011467573.1| PREDICTED: uncharacterized protein LOC101307606 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 124/237 (52%), Gaps = 30/237 (13%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
             LPQHL    YSQPT      ANII YP   QS++  P   QQ +AG +   QS+A +  
Sbjct  589  VLPQHLTARSYSQPTYE--QIANIIGYPSPPQSFSRTPSALQQAYAGGTGLHQSVAGMEY  646

Query  738  -LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  562
              P ++N  S+S +P SA    G+G+FG +  + G++  N S AP      DD   SQYK
Sbjct  647  SFPQHRNGASISRVPPSAAA-GGHGSFGTSTNVHGNYLHNSSVAPVRDY--DDVFRSQYK  703

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS--Q  397
            D +HL  L Q             RT+S+   + Y N+  QNQQ +G+RQ Q    PS  Q
Sbjct  704  DGNHLTPLHQ-----------SPRTLSSVQDSAYNNLLGQNQQYAGYRQEQAGQVPSQLQ  752

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +Y S+GY P++Y+SQ GI+     Q+Q+  + P   G  +   Q     QQ+WQ +Y
Sbjct  753  HYGSMGY-PDYYNSQMGIT--QERQRQSLNESPFAPGIPDLSPQQL---QQIWQRTY  803



>ref|XP_011467574.1| PREDICTED: uncharacterized protein LOC101307606 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=731

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 124/237 (52%), Gaps = 30/237 (13%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV--  739
             LPQHL    YSQPT      ANII YP   QS++  P   QQ +AG +   QS+A +  
Sbjct  517  VLPQHLTARSYSQPTYE--QIANIIGYPSPPQSFSRTPSALQQAYAGGTGLHQSVAGMEY  574

Query  738  -LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYK  562
              P ++N  S+S +P SA    G+G+FG +  + G++  N S AP      DD   SQYK
Sbjct  575  SFPQHRNGASISRVPPSAAA-GGHGSFGTSTNVHGNYLHNSSVAPVRDY--DDVFRSQYK  631

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS--Q  397
            D +HL  L Q             RT+S+   + Y N+  QNQQ +G+RQ Q    PS  Q
Sbjct  632  DGNHLTPLHQ-----------SPRTLSSVQDSAYNNLLGQNQQYAGYRQEQAGQVPSQLQ  680

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            +Y S+GY P++Y+SQ GI+     Q+Q+  + P   G  +   Q     QQ+WQ +Y
Sbjct  681  HYGSMGY-PDYYNSQMGIT--QERQRQSLNESPFAPGIPDLSPQQL---QQIWQRTY  731



>ref|XP_010559260.1| PREDICTED: uncharacterized protein LOC104827729 isoform X4 [Tarenaya 
hassleriana]
Length=793

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  897  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  721
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  605  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  664

Query  720  SVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  550
                ++LP S A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  665  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  709

Query  549  LMSLQQVENSGMWLHGHGSRTMSA  478
            L SLQQ EN   W  G  SR  S+
Sbjct  710  LASLQQNENPRTWFQGQNSRLESS  733



>ref|XP_010559259.1| PREDICTED: uncharacterized protein LOC104827729 isoform X3 [Tarenaya 
hassleriana]
Length=794

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  897  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  721
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  606  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  665

Query  720  SVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  550
                ++LP S A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  666  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  710

Query  549  LMSLQQVENSGMWLHGHGSRTMSA  478
            L SLQQ EN   W  G  SR  S+
Sbjct  711  LASLQQNENPRTWFQGQNSRLESS  734



>ref|XP_010559258.1| PREDICTED: uncharacterized protein LOC104827729 isoform X2 [Tarenaya 
hassleriana]
Length=795

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  897  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  721
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  607  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  666

Query  720  SVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  550
                ++LP S A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  667  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  711

Query  549  LMSLQQVENSGMWLHGHGSRTMSA  478
            L SLQQ EN   W  G  SR  S+
Sbjct  712  LASLQQNENPRTWFQGQNSRLESS  735



>ref|XP_010559257.1| PREDICTED: uncharacterized protein LOC104827729 isoform X1 [Tarenaya 
hassleriana]
Length=796

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 19/144 (13%)
 Frame = -1

Query  897  LAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQ-SLAAVLPNYKN  721
            LA+HPYSQPTLPLG +AN+I YPF+ QSYTYMP  FQQ F+GN+TY Q  L+A+LP+YK+
Sbjct  608  LAMHPYSQPTLPLGHYANMIGYPFLPQSYTYMPSAFQQAFSGNNTYHQPPLSAMLPHYKS  667

Query  720  SVSVSSLPHS-ATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHH--  550
                ++LP S A VP G            + PLNPS A ++    D+ L SQ++D +   
Sbjct  668  ----NNLPQSAAAVPGG-----------NNIPLNPSNAVNSLSRYDNVLGSQFRDGNQLA  712

Query  549  LMSLQQVENSGMWLHGHGSRTMSA  478
            L SLQQ EN   W  G  SR  S+
Sbjct  713  LASLQQNENPRTWFQGQNSRLESS  736



>ref|XP_009356619.1| PREDICTED: uncharacterized protein LOC103947437 isoform X3 [Pyrus 
x bretschneideri]
Length=804

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 111/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  739
             LPQ  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  585  VLPQRHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  644

Query  738  ---LPNYKNSVSVSSLPHSATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  571
                P Y++  SVS LP SA    +G+G+FG +    GSF  N SA P +    DD    
Sbjct  645  EYNFPQYRSGASVSRLPTSAAAAVAGHGSFGASNNNHGSFLHNASATPGSIADYDDVFRP  704

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  400
            QYKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PS
Sbjct  705  QYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPS  753

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQN  313
            Q  +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  754  QLQSYRGH-PDFYHSQVDVTQELQRQRLN  781



>ref|XP_010102151.1| hypothetical protein L484_021385 [Morus notabilis]
 gb|EXB92401.1| hypothetical protein L484_021385 [Morus notabilis]
Length=826

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 115/203 (57%), Gaps = 13/203 (6%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPL-GPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAVL  736
             LPQH   +  SQPT+PL  P  N+I Y  + QSY+++P  FQQ + G+     SLA + 
Sbjct  610  VLPQHRIAN--SQPTVPLEKPSNNMIGYSGLPQSYSHLPSNFQQGYPGSDKV--SLADLN  665

Query  735  PNY-KNSVSVSSLPHSATVPSGYGAFGNTGTIPGSF-PLNPSAAPSTSLGIDDGLSSQYK  562
             N  ++  S+S  P  A+  +GYG +G    +PGS+  ++PS     + G DD    QYK
Sbjct  666  YNLPQHGASMSRFP-GASATAGYGNYGMPSNVPGSYLQISPSPPMIPNSGYDDLFHRQYK  724

Query  561  DNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASL  382
            D  H   LQQ  NS  W  G GSR + +A    YYN+  QNQQ SG+RQ  QPSQ Y  L
Sbjct  725  DRDHFTPLQQ--NSSSWNQGPGSRKLPSAEEIAYYNLHGQNQQYSGYRQDHQPSQYYGGL  782

Query  381  GYNPNFYHSQTGISLDHHHQQQN  313
             Y+ N Y SQTG++ +  HQQ N
Sbjct  783  EYS-NPYRSQTGMARE--HQQHN  802



>ref|XP_009356617.1| PREDICTED: uncharacterized protein LOC103947437 isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 111/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  739
             LPQ  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  608  VLPQRHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  667

Query  738  ---LPNYKNSVSVSSLPHSATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  571
                P Y++  SVS LP SA    +G+G+FG +    GSF  N SA P +    DD    
Sbjct  668  EYNFPQYRSGASVSRLPTSAAAAVAGHGSFGASNNNHGSFLHNASATPGSIADYDDVFRP  727

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  400
            QYKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PS
Sbjct  728  QYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPS  776

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQN  313
            Q  +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  777  QLQSYRGH-PDFYHSQVDVTQELQRQRLN  804



>ref|XP_008380341.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=799

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 110/208 (53%), Gaps = 21/208 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  739
             LPQ  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  582  VLPQRHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  641

Query  738  ---LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQ  568
                P Y++  SVS LP SA   +G G+FG +    GSF  N SA P +    DD    Q
Sbjct  642  EYNFPQYRSGASVSRLPTSAAA-AGRGSFGASNNNHGSFLHNASATPGSIADYDDVFRPQ  700

Query  567  YKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PSQ  397
            YKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PSQ
Sbjct  701  YKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPSQ  749

Query  396  NYASLGYNPNFYHSQTGISLDHHHQQQN  313
              +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  750  LQSYRGH-PDFYHSQVDVTQELQRQRLN  776



>dbj|BAK03133.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 128/250 (51%), Gaps = 42/250 (17%)
 Frame = -1

Query  909  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  739
            LP HLA +HPY+Q  LPLG +A++I YP + QSY Y+PP  +QQP+  +  + Q  AA  
Sbjct  309  LPHHLAALHPYAQGGLPLG-YASMIGYPSLPQSYAYLPPAAYQQPYINSGLFHQGAAAAP  367

Query  738  -------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLN---PSAAPSTSLG  592
                   +P YK++V + SLP  A++ S Y G FG    +P +F LN   PSA  +T+ G
Sbjct  368  NSGVKYPMPQYKSNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPSA--TTAPG  425

Query  591  IDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN--------TYYNIQAQNQ  436
             D  + SQYKD +  +SLQQ EN  MW+HG GSR M    AN               Q  
Sbjct  426  FDGTMPSQYKDGNPYISLQQGENPAMWMHGAGSRGMPPLAANPLYGYQGQQQGYQGQQQG  485

Query  435  QPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  256
               G RQ Q PSQ  A+LG       SQ G+  +H    +NP DG       N       
Sbjct  486  HQGGLRQGQMPSQYGAALG------QSQPGLGPEH----RNPSDG-------NLSAAAAA  528

Query  255  SSQQLWQNSY  226
             + Q+W N Y
Sbjct  529  QANQMWPNGY  538



>ref|XP_010434571.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X3 [Camelina sativa]
Length=798

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 129/240 (54%), Gaps = 42/240 (18%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  582  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  638

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL S 
Sbjct  639  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLSSQFKDSNHLTSS  690

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQ  406
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFR             QQ
Sbjct  691  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQQPSQQ  747

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              Q++   GY  + YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  748  QQQHFGGHGY-VSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQAQQQLWPNNY  798



>ref|XP_010434569.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X1 [Camelina sativa]
 ref|XP_010434570.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=799

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 129/240 (54%), Gaps = 42/240 (18%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLGP+ N+ISYPFM QSY  YM  G+QQ F  GN    QSLAA+LP YK  
Sbjct  583  NPYSHQPGMPLGPYGNLISYPFMAQSYNPYMASGYQQAFPTGN---HQSLAAMLPQYKTQ  639

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP+ A ++    +D LSSQ+KD++HL S 
Sbjct  640  ATAPPVP----PPSAYG-FGGGAASNNNFPLNPTNATNS---YEDVLSSQFKDSNHLTSS  691

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQ  406
              QQ +NS  W  G    SR +   P + YY+    QNQQP GFR             QQ
Sbjct  692  LQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQQPSQQ  748

Query  405  PSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
              Q++   GY  + YHSQ  +SLDH H Q             NA+   K + QQLW N+Y
Sbjct  749  QQQHFGGHGY-VSPYHSQGAMSLDHLHHQH--------QQQQNARDASKQAQQQLWPNNY  799



>dbj|BAJ94362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=845

 Score =   110 bits (274),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 128/250 (51%), Gaps = 42/250 (17%)
 Frame = -1

Query  909  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  739
            LP HLA +HPY+Q  LPLG +A++I YP + QSY Y+PP  +QQP+  +  + Q  AA  
Sbjct  616  LPHHLAALHPYAQGGLPLG-YASMIGYPSLPQSYAYLPPAAYQQPYINSGLFHQGAAAAP  674

Query  738  -------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLN---PSAAPSTSLG  592
                   +P YK++V + SLP  A++ S Y G FG    +P +F LN   PSA  +T+ G
Sbjct  675  NSGVKYPMPQYKSNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPSA--TTAPG  732

Query  591  IDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN--------TYYNIQAQNQ  436
             D  + SQYKD +  +SLQQ EN  MW+HG GSR M    AN               Q  
Sbjct  733  FDGTMPSQYKDGNPYISLQQGENPAMWMHGAGSRGMPPLAANPLYGYQGQQQGYQGQQQG  792

Query  435  QPSGFRQVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  256
               G RQ Q PSQ  A+LG       SQ G+  +H    +NP DG       N       
Sbjct  793  HQGGLRQGQMPSQYGAALG------QSQPGLGPEH----RNPSDG-------NLSAAAAA  835

Query  255  SSQQLWQNSY  226
             + Q+W N Y
Sbjct  836  QANQMWPNGY  845



>ref|XP_002870069.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=802

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 128/241 (53%), Gaps = 43/241 (18%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  718
            +PYS QP +PLG + N+ISYPFM QSY  YMP  FQQ F  GN    QSLAA+LP YK  
Sbjct  585  NPYSHQPGMPLGHYGNLISYPFMAQSYNPYMPSAFQQAFPTGN---HQSLAAMLPQYKTQ  641

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS-  541
             +   +P     PS YG FG       +FPLNP++A ++    +D LSSQ+ D +HL S 
Sbjct  642  ATAPPVP----PPSAYG-FGGGAASSNNFPLNPTSAANS---YEDVLSSQFNDGNHLASS  693

Query  540  -LQQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSGFR------------QVQ  409
              QQ ENS  W  G    SR +   P + YY+    QNQQP GFR            Q Q
Sbjct  694  LQQQNENSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPGFRQAQQLQQQQQPSQQQ  750

Query  408  QPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNS  229
            Q  Q+Y   GY  + YHSQ  +SL+H H Q             NA+   K + QQLW N+
Sbjct  751  QQQQHYGGHGY-VSPYHSQAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPNN  801

Query  228  Y  226
            Y
Sbjct  802  Y  802



>emb|CDY61669.1| BnaC01g40800D [Brassica napus]
Length=740

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 124/234 (53%), Gaps = 41/234 (18%)
 Frame = -1

Query  885  PYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVS  712
            PYS QP +PLG + N++SYPFM QSY  YMP  FQQ F   + +Q    ++LP YK   +
Sbjct  534  PYSHQPGMPLGHYGNLMSYPFMPQSYNPYMPSAFQQAFPSGNHHQ----SMLPQYKTQAT  589

Query  711  VSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--L  538
               +P     PS YG  G    +  +FPLN ++AP++    +D LSSQ++D++HL S   
Sbjct  590  APPVP----PPSAYGFGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSNHLASSLQ  642

Query  537  QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--------QVQQPSQNYASL  382
            QQ E+   W  G  S +    P + YY+   QNQQP GFR          QQ  Q++   
Sbjct  643  QQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQHFGGH  699

Query  381  GYNPNFYHSQTGISLD--HHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
             Y  + YHSQ  +SLD  HH QQQN RD              K + QQLW N+Y
Sbjct  700  SYG-SHYHSQASMSLDHLHHQQQQNARDA------------SKQTHQQLWPNNY  740



>ref|XP_009356618.1| PREDICTED: uncharacterized protein LOC103947437 isoform X2 [Pyrus 
x bretschneideri]
Length=809

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 111/209 (53%), Gaps = 21/209 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFM--HQSYTYMPPGFQQPFAGNSTYQQSLAAV  739
            ++ +  A   Y+QPT      ANII YP M   Q+Y+ MP   QQ + G S + QS A++
Sbjct  590  SMSERHAARSYAQPTHSYEQLANIIGYPSMPQAQNYSPMPSNLQQEYLGGSAFHQSGASM  649

Query  738  ---LPNYKNSVSVSSLPHSATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  571
                P Y++  SVS LP SA    +G+G+FG +    GSF  N SA P +    DD    
Sbjct  650  EYNFPQYRSGASVSRLPTSAAAAVAGHGSFGASNNNHGSFLHNASATPGSIADYDDVFRP  709

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  400
            QYKD +HL +L Q            SRT+ + P + + N+  QNQQ +G+RQ Q    PS
Sbjct  710  QYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQHAGYRQGQAGQLPS  758

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQN  313
            Q  +  G+ P+FYHSQ  ++ +   Q+ N
Sbjct  759  QLQSYRGH-PDFYHSQVDVTQELQRQRLN  786



>gb|EMS61509.1| hypothetical protein TRIUR3_20581 [Triticum urartu]
Length=767

 Score =   103 bits (258),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 89/147 (61%), Gaps = 13/147 (9%)
 Frame = -1

Query  909  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  739
            LP HLA +HPY+Q  LPLG +A++I YP + QSY Y+PP  +QQP+  +  + Q  AA  
Sbjct  557  LPHHLAALHPYAQGGLPLG-YASMIGYPSLPQSYAYLPPAAYQQPYMNSGLFHQGAAAAP  615

Query  738  -------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLNPSAAPSTSL-GID  586
                   +P YK +V + SLP  A++ S Y G FG    +P +F LN S  P+T+  G D
Sbjct  616  NSGVKYPMPQYKGNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPPATTAPGFD  675

Query  585  DGLSSQYKDNHHLMSLQQVENSGMWLH  505
              + SQYKD +  MSLQQ EN  MW+H
Sbjct  676  GAMPSQYKDGNPYMSLQQGENPAMWMH  702



>ref|XP_006282485.1| hypothetical protein CARUB_v10006235mg [Capsella rubella]
 gb|EOA15383.1| hypothetical protein CARUB_v10006235mg [Capsella rubella]
Length=732

 Score =   100 bits (249),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 114/214 (53%), Gaps = 29/214 (14%)
 Frame = -1

Query  912  ALPQHLAVHPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAV  739
            AL QHLA++ +S QP +PLG ++N+ISYPFM QSY  YMP GFQQ    N+  QQSLAA+
Sbjct  529  ALTQHLALNSFSHQPRMPLGHYSNLISYPFMTQSYNPYMPSGFQQALPTNN--QQSLAAM  586

Query  738  LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKD  559
            LP YK+  +   +P     P     FG +     +F LNP++A ++    +D  SSQ+K 
Sbjct  587  LPQYKSQATAHHVP-----PPSVNGFGGSAASSNNFSLNPASAANS---YEDVSSSQFKH  638

Query  558  NHHLMSLQQ--VENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR----------  418
             +HL S  Q   ENS  W  G     +     N YY+    QNQ   GFR          
Sbjct  639  INHLASPHQHKNENSAAWHQG-KQPNLRVTMGNGYYSFPGHQNQHLHGFRQTQQLQQQHQ  697

Query  417  QVQQPSQNYASLGY-NPNFYHSQTGISLDHHHQQ  319
              Q   Q++   GY +P  YHSQ  +SLDH H Q
Sbjct  698  LSQHQQQHFGGHGYVSP--YHSQAAMSLDHLHYQ  729



>ref|XP_009131438.1| PREDICTED: flocculation protein FLO11 [Brassica rapa]
Length=780

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 119/236 (50%), Gaps = 41/236 (17%)
 Frame = -1

Query  885  PYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVS  712
            PYS QP +PLG + N++SYPFM QSY  YMP  FQQ F   + +Q    ++LP YK   +
Sbjct  570  PYSHQPGMPLGHYGNLMSYPFMPQSYNPYMPSAFQQAFPSGNHHQ----SMLPQYKTQAT  625

Query  711  VSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--L  538
               +P     PS YG  G    +  +FPLN ++AP++    +D LSSQ++D+ HL S   
Sbjct  626  APPVP----PPSAYGFGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSSHLASSLQ  678

Query  537  QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGYNPNF--  364
            QQ E+   W  G  S +    P + YY+   QNQQP GFRQ Q   Q         +F  
Sbjct  679  QQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQQHFGG  735

Query  363  ------YHSQTGISLDH----HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
                  YHSQ  +SLDH    H QQQN RD                  QQLW N+Y
Sbjct  736  HGYGSPYHSQAPMSLDHLHHQHQQQQNARDASKQTHQ-----------QQLWPNNY  780



>emb|CDX78828.1| BnaA01g08950D [Brassica napus]
Length=698

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 123/236 (52%), Gaps = 42/236 (18%)
 Frame = -1

Query  885  PYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPFAGNSTYQQSLAAVLPNYKNSVS  712
            PYS QP +PLG + N++SYPFM QSY  YMP  FQQ F   + +Q    ++LP YK   +
Sbjct  489  PYSHQPGMPLGHYGNLMSYPFMPQSYNPYMPSAFQQAFPSGNHHQ----SMLPQYKTQAT  544

Query  711  VSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--L  538
               +P     PS YG  G    +  +FPLN ++AP++    +D LSSQ++D+ HL S   
Sbjct  545  APPVP----PPSAYGFGGGGSALSSNFPLNSTSAPNS---YEDVLSSQFRDSSHLASSLQ  597

Query  537  QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR--------QVQQPSQNYASL  382
            QQ E+   W  G  S +    P + YY+   QNQQP GFR          QQ  Q++   
Sbjct  598  QQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQAQLLQQPSQQQQQQHFGGH  654

Query  381  GYNPNFYHSQTGISLDH----HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            GY  + YHSQ  +SLDH    H QQQN RD              +   QQLW N+Y
Sbjct  655  GYG-SPYHSQAPMSLDHLHHQHQQQQNARD-----------ASKQTHQQQLWPNNY  698



>gb|KFK28493.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=797

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 122/237 (51%), Gaps = 43/237 (18%)
 Frame = -1

Query  888  HPYSQPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNSV  715
            +PYSQP +PLGP+ N+ISY FM QSY  YMP  FQQ F  GN    QSLAA+LP YK   
Sbjct  583  NPYSQPGMPLGPYGNLISYQFMPQSYNPYMPSAFQQAFPTGN---HQSLAAMLPQYKTQA  639

Query  714  SVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--  541
            +   +P     PS YG FG       ++PLN ++A ++    +D L    ++++HL S  
Sbjct  640  TAPPVP----PPSAYG-FGGGAASSNNYPLNSTSAANS---YEDVL----RESNHLASSL  687

Query  540  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR-------------QVQQP  403
             QQ E+S  W  G  + +    P + YY+  + QNQQP GFR             Q QQ 
Sbjct  688  QQQNEDSAAWHQGQQANSR-VVPGSGYYSFPSHQNQQPPGFRQGQQLQQQQPSQQQQQQQ  746

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  232
             Q +   GY  N YHSQ  +SL+H H Q             NA+   K + QQLW N
Sbjct  747  QQQFGGHGYG-NPYHSQAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPN  794



>gb|KFK28492.1| hypothetical protein AALP_AA7G003100 [Arabis alpina]
Length=796

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 122/237 (51%), Gaps = 43/237 (18%)
 Frame = -1

Query  888  HPYSQPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNSV  715
            +PYSQP +PLGP+ N+ISY FM QSY  YMP  FQQ F  GN    QSLAA+LP YK   
Sbjct  582  NPYSQPGMPLGPYGNLISYQFMPQSYNPYMPSAFQQAFPTGN---HQSLAAMLPQYKTQA  638

Query  714  SVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS--  541
            +   +P     PS YG FG       ++PLN ++A ++    +D L    ++++HL S  
Sbjct  639  TAPPVP----PPSAYG-FGGGAASSNNYPLNSTSAANS---YEDVL----RESNHLASSL  686

Query  540  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR-------------QVQQP  403
             QQ E+S  W  G  + +    P + YY+  + QNQQP GFR             Q QQ 
Sbjct  687  QQQNEDSAAWHQGQQANSR-VVPGSGYYSFPSHQNQQPPGFRQGQQLQQQQPSQQQQQQQ  745

Query  402  SQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQN  232
             Q +   GY  N YHSQ  +SL+H H Q             NA+   K + QQLW N
Sbjct  746  QQQFGGHGYG-NPYHSQAAMSLEHLHHQH--------QQQQNARDASKQTQQQLWPN  793



>emb|CAB53656.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78817.1| hypothetical protein [Arabidopsis thaliana]
Length=762

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 96/170 (56%), Gaps = 18/170 (11%)
 Frame = -1

Query  909  LPQHLAVHPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAV  739
            L QHLA++PYS QP +PLG + N+ISYPFM Q Y  +M   FQQ F  GN    QSL  +
Sbjct  545  LAQHLALNPYSHQPEMPLGHYGNLISYPFMAQCYNPFMLSAFQQVFPTGN---HQSLVDM  601

Query  738  LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKD  559
            L  YK   +   +P     PS YG FG       +FPLNP++A ++    +D LSSQ+ +
Sbjct  602  LMQYKTQTTAPPVP----PPSAYG-FGGGAVSSNNFPLNPTSAANS---YEDVLSSQFNE  653

Query  558  NHHLMS--LQQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR  418
            ++HL S   QQ E +  W  G  + +    P + YY+    QNQQP GFR
Sbjct  654  SNHLASSLQQQNEKTTAWHQGQQANSR-VVPGSGYYSYPGHQNQQPPGFR  702



>ref|NP_193549.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84004.1| uncharacterized protein AT4G18150 [Arabidopsis thaliana]
Length=758

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 96/170 (56%), Gaps = 18/170 (11%)
 Frame = -1

Query  909  LPQHLAVHPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAV  739
            L QHLA++PYS QP +PLG + N+ISYPFM Q Y  +M   FQQ F  GN    QSL  +
Sbjct  541  LAQHLALNPYSHQPEMPLGHYGNLISYPFMAQCYNPFMLSAFQQVFPTGN---HQSLVDM  597

Query  738  LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKD  559
            L  YK   +   +P     PS YG FG       +FPLNP++A ++    +D LSSQ+ +
Sbjct  598  LMQYKTQTTAPPVP----PPSAYG-FGGGAVSSNNFPLNPTSAANS---YEDVLSSQFNE  649

Query  558  NHHLMS--LQQVENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR  418
            ++HL S   QQ E +  W  G  + +    P + YY+    QNQQP GFR
Sbjct  650  SNHLASSLQQQNEKTTAWHQGQQANSR-VVPGSGYYSYPGHQNQQPPGFR  698



>ref|XP_006414144.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
 gb|ESQ55597.1| hypothetical protein EUTSA_v10027504mg [Eutrema salsugineum]
Length=799

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 125/238 (53%), Gaps = 35/238 (15%)
 Frame = -1

Query  888  HPYS-QPTLPLGPFANIISYPFMHQSYT-YMPPGFQQPF-AGNSTYQQSLAAVLPNYKNS  718
            +PY+ QP +P+G + N+ISYPFM QSY  YMP  FQQ F  GN    Q+LAA+   YKN 
Sbjct  580  NPYAHQPGMPVGHYGNLISYPFMPQSYNPYMPLAFQQAFPTGN---HQTLAAMHLQYKNQ  636

Query  717  VSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHL-MS  541
             +   +P     PS Y  FG       +FPL P+ + ++    +D LSSQ+KD +HL +S
Sbjct  637  ATAPPIP----PPSAY-RFGGGAPSSNNFPLTPTTSANS---YEDVLSSQFKDRNHLALS  688

Query  540  LQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQA-QNQQPSGFR-----------QVQQPS  400
            LQQ  ENS  W  G  S +    P + YY+    Q+QQP GFR             QQ  
Sbjct  689  LQQQNENSAAWHQGQQSNSR-VVPGSGYYSFPGHQSQQPPGFRQAQQLQQQQQPSQQQQQ  747

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  226
            Q++   GY  + YHSQ  +SL+H H Q             NA+   K + QQLW N+Y
Sbjct  748  QHFGGHGY-ASPYHSQAAMSLEHLHHQHQ-----HQQQQQNARDASKQTQQQLWPNNY  799



>ref|XP_008362365.1| PREDICTED: uncharacterized protein LOC103426056 [Malus domestica]
Length=843

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 105/209 (50%), Gaps = 21/209 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISY-PFM--HQSYTYMPPGFQQPFAGNSTYQQSLAA  742
             LPQ      Y+QPTL     AN + Y P +   Q+Y+ +PP  QQ + G S +  S A+
Sbjct  624  VLPQCHTARSYAQPTLSYEQLANGMVYKPSIPQAQNYSPVPPNLQQEYVGGSAFHMSGAS  683

Query  741  VLPNY--KNSVSVSSLPHSATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  571
            +  N+   +  SVS LP SA    +G+G FG +    GS   N SA P +    DD    
Sbjct  684  MEYNFPQYSGASVSRLPTSAAAAVTGHGRFGASNNTHGSLLHNASATPGSIPDYDDVFRP  743

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  400
            QYKD +HL +L Q            SRT+ + P   + N+   NQQ +G+RQ Q    P+
Sbjct  744  QYKDGNHLAALYQ-----------SSRTLPSVPDRAFNNLHGHNQQHAGYRQGQAGQLPT  792

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQN  313
            Q    LG+ P+FY SQ  ++ +H  Q+ N
Sbjct  793  QLQNYLGH-PDFYFSQKDVTQEHQRQRLN  820



>ref|XP_008342489.1| PREDICTED: uncharacterized protein LOC103405294 [Malus domestica]
Length=843

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 105/209 (50%), Gaps = 21/209 (10%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISY-PFM--HQSYTYMPPGFQQPFAGNSTYQQSLAA  742
             LPQ      Y+QPTL     AN + Y P +   Q+Y+ +PP  QQ + G S +  S A+
Sbjct  624  VLPQCHTARSYAQPTLSYEQLANGMVYKPSIPQAQNYSPVPPNLQQEYVGGSAFHMSGAS  683

Query  741  VLPNY--KNSVSVSSLPHSATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  571
            +  N+   +  SVS LP SA    +G+G FG +    GS   N SA P +    DD    
Sbjct  684  MEYNFPQYSGASVSRLPTSAAAAVTGHGRFGASNNTHGSLLHNASATPGSIPDYDDVFRP  743

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQ---PS  400
            QYKD +HL +L Q            SRT+ + P   + N+   NQQ +G+RQ Q    P+
Sbjct  744  QYKDGNHLAALYQ-----------SSRTLPSVPDRAFNNLHGHNQQHAGYRQGQAGQLPT  792

Query  399  QNYASLGYNPNFYHSQTGISLDHHHQQQN  313
            Q    LG+ P+FY SQ  ++ +H  Q+ N
Sbjct  793  QLQNYLGH-PDFYFSQKDVTQEHQRQRLN  820



>gb|KDP46910.1| hypothetical protein JCGZ_10401 [Jatropha curcas]
Length=883

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 111/231 (48%), Gaps = 20/231 (9%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQ--PFAGNSTYQQSLAAV  739
             +PQHL  H YSQ  L L    N  +Y  + Q+Y+ +P   QQ   +  +S +   LA +
Sbjct  663  VVPQHLPAHSYSQSPLSLEELLNWNAYSAVPQTYSGIPSALQQQQAYQDSSAFLDPLAGM  722

Query  738  ---LPNYKNSVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSL-GIDDGLSS  571
               L   +   S SS+P S    S YG  GN+    GSF  +PSA  + S+ G +D L S
Sbjct  723  RYNLQQLRGVASRSSIPLSHANVSSYGGLGNSTNFSGSFLNDPSATINRSVVGYNDLLRS  782

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNY  391
            QYK+ ++   L Q  +   W +  GSR +S  P N YYN Q    QP  ++Q Q  SQNY
Sbjct  783  QYKEGNNFTMLHQNHSLSSWDYEPGSRPLSTVPNNGYYNFQG--GQPPMYQQGQLLSQNY  840

Query  390  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  238
             +    P F HSQ  I      QQQN  D PL    G     P    +QLW
Sbjct  841  GA----PVF-HSQQRIL--REEQQQNLGDLPLSSSQG-----PSKQVRQLW  879



>emb|CDY11787.1| BnaC03g57910D [Brassica napus]
Length=737

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 83/134 (62%), Gaps = 25/134 (19%)
 Frame = -1

Query  579  LSSQYKDNHHLMSLQ----QVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  427
            LSS++  ++H+++LQ    Q ENS MW HGHGSRTMS  PANT+YN+QAQ QQ       
Sbjct  613  LSSKHTRSNHVLALQHQQQQNENSAMWHHGHGSRTMSGVPANTHYNLQAQQQQQLQQTQQ  672

Query  426  ----GFR-QVQQPSQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV--  268
                G+R   QQ  Q Y S GY+ NFY  QT +SL+   QQQNPRDG        AQV  
Sbjct  673  AAAVGYRQAQQQQQQRYGSYGYS-NFYQFQTEMSLE--RQQQNPRDGA------GAQVGQ  723

Query  267  QPKPSSQQLWQNSY  226
            QP   +QQLWQNSY
Sbjct  724  QPSDQTQQLWQNSY  737



>ref|XP_009377414.1| PREDICTED: uncharacterized protein LOC103966021 [Pyrus x bretschneideri]
Length=822

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 106/209 (51%), Gaps = 25/209 (12%)
 Frame = -1

Query  912  ALPQHLAVHPYSQPTLPLGPFANIISY-PFM--HQSYTYMPPGFQQPFAGNSTYQQSLAA  742
             LPQ      Y+QPTL     AN + Y P M   Q+Y+ +PP  QQ + G S + QS A+
Sbjct  603  VLPQCHTSRSYAQPTLSYEQLANSMVYKPSMPQAQNYSPVPPNLQQEYVGGSAFHQSGAS  662

Query  741  VLPNY--KNSVSVSSLPHSATVP-SGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSS  571
            +  N+   +  SVS LP SA    +G+ +FG +    GS   N SA P +    DD    
Sbjct  663  MEYNFPQYSGASVSRLPTSAAAAVTGHVSFGASNNTHGSLLHNASATPGSIPDYDDVFRP  722

Query  570  QYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ---VQQPS  400
            QYKD +HL +L Q            SRT+ + P + + N+   NQQ +G+RQ    Q P+
Sbjct  723  QYKDGNHLATLYQ-----------SSRTLPSVPDSAFNNLLGHNQQHAGYRQGRAGQLPT  771

Query  399  --QNYASLGYNPNFYHSQTGISLDHHHQQ  319
              QNY     +P+FY SQ  ++ +H  Q+
Sbjct  772  KLQNYRG---HPDFYFSQKDVTQEHQRQR  797



>gb|KDO60960.1| hypothetical protein CISIN_1g0031902mg, partial [Citrus sinensis]
Length=759

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 90/184 (49%), Gaps = 15/184 (8%)
 Frame = -1

Query  891  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  721
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  576  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  635

Query  720  SVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  541
            S ++  LP S +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  636  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  684

Query  540  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  364
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  685  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  744

Query  363  YHSQ  352
            YHS 
Sbjct  745  YHSD  748



>gb|KDO60959.1| hypothetical protein CISIN_1g0031902mg, partial [Citrus sinensis]
Length=755

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 90/184 (49%), Gaps = 15/184 (8%)
 Frame = -1

Query  891  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  721
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  572  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  631

Query  720  SVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  541
            S ++  LP S +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  632  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  680

Query  540  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  364
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  681  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  740

Query  363  YHSQ  352
            YHS 
Sbjct  741  YHSD  744



>ref|XP_006484854.1| PREDICTED: uncharacterized protein LOC102628559 isoform X1 [Citrus 
sinensis]
Length=840

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 90/184 (49%), Gaps = 15/184 (8%)
 Frame = -1

Query  891  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  721
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  657  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  716

Query  720  SVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  541
            S ++  LP S +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  717  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  765

Query  540  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  364
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  766  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  825

Query  363  YHSQ  352
            YHS 
Sbjct  826  YHSD  829



>gb|EMT27654.1| hypothetical protein F775_52320 [Aegilops tauschii]
Length=649

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 86/149 (58%), Gaps = 17/149 (11%)
 Frame = -1

Query  909  LPQHLA-VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPG-FQQPFAGNSTYQQSLAAV-  739
            LP HLA +HPY+Q  LPLG + N+  YP + QSY Y+PP  +QQ +  +  + Q  AA  
Sbjct  502  LPHHLAALHPYAQGGLPLG-YENMTGYPSLPQSYAYLPPAAYQQAYMNSGLFHQGAAAAP  560

Query  738  -------LPNYKNSVSVSSLPHSATVPSGY-GAFGNTGTIPGSFPLN---PSAAPSTSLG  592
                   +P Y ++V + SLP  A++ S Y G FG    +P +F LN   PSA  +T+ G
Sbjct  561  NSGIKYPMPQYNSNVPLGSLPQPASMLSNYVGGFGTANGMPQNFALNQSNPSA--TTTPG  618

Query  591  IDDGLSSQYKDNHHLMSLQQVENSGMWLH  505
             D  + SQYKD +  MSLQQVE +   +H
Sbjct  619  FDGAMPSQYKDGNPYMSLQQVEPTRERIH  647



>ref|XP_006484855.1| PREDICTED: uncharacterized protein LOC102628559 isoform X2 [Citrus 
sinensis]
Length=836

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 90/184 (49%), Gaps = 15/184 (8%)
 Frame = -1

Query  891  VHPYSQPTLPLGPFANIISYPFMHQSYTYMPPGFQQPFAGNSTYQQSLAAV---LPNYKN  721
            +H Y+Q  LP G   N+I YP M Q  TY+P   Q  +   S +  SLA +   LP Y++
Sbjct  653  LHSYAQSRLPSGKLTNMIGYPSMPQRQTYVPSALQHAYPEASVFHDSLAGMNYNLPQYRS  712

Query  720  SVSVSSLPHSATVPSGYGAFGNTGTIPGSFPLNPSAAPSTSLGIDDGLSSQYKDNHHLMS  541
            S ++  LP S +  S YG+F  + T+P    +  +  P           S Y D + L  
Sbjct  713  SGTIGGLPLSNSGLSAYGSFVGSSTLPMGAAVGYNGPP----------QSHYMDGNSL-P  761

Query  540  LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPSQNYASLGY-NPNF  364
             QQ   S  W  G   +  S    + YY++  QNQ   G++  QQ SQ+Y SLGY NPN 
Sbjct  762  RQQHNRSSTWDLGASRQASSMHSDSAYYSLLRQNQHHPGYQVDQQASQHYESLGYPNPNT  821

Query  363  YHSQ  352
            YHS 
Sbjct  822  YHSD  825



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2061751161600