BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052I24

Length=823
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF95167.1|  similar to putative preRNA processing ribonucleo...    180   5e-52   Ipomoea nil [qian niu]
ref|XP_006344769.1|  PREDICTED: nucleolar protein 56-like               148   4e-37   Solanum tuberosum [potatoes]
ref|XP_004230313.1|  PREDICTED: nucleolar protein 56-like               148   4e-37   Solanum lycopersicum
ref|XP_009598202.1|  PREDICTED: nucleolar protein 56-like               145   3e-36   Nicotiana tomentosiformis
emb|CDP15007.1|  unnamed protein product                                142   3e-35   Coffea canephora [robusta coffee]
ref|XP_006440077.1|  hypothetical protein CICLE_v10019526mg             142   6e-35   Citrus clementina [clementine]
gb|KDO52602.1|  hypothetical protein CISIN_1g0085712mg                  141   7e-35   Citrus sinensis [apfelsine]
ref|XP_009782739.1|  PREDICTED: nucleolar protein 56-like               141   9e-35   Nicotiana sylvestris
ref|XP_006477001.1|  PREDICTED: nucleolar protein 56-like isoform X2    141   9e-35   Citrus sinensis [apfelsine]
gb|AAT95868.1|  putative preRNA processing ribonucleoprotein            131   7e-34   Brassica juncea [brown mustard]
ref|XP_009359460.1|  PREDICTED: nucleolar protein 56-like               137   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_006440078.1|  hypothetical protein CICLE_v10019526mg             137   2e-33   
ref|XP_009603298.1|  PREDICTED: nucleolar protein 56-like               137   2e-33   Nicotiana tomentosiformis
ref|XP_009767290.1|  PREDICTED: nucleolar protein 56-like               137   2e-33   Nicotiana sylvestris
ref|XP_007037933.1|  Nucleolar protein NOP56                            137   2e-33   
ref|XP_006477000.1|  PREDICTED: nucleolar protein 56-like isoform X1    137   2e-33   Citrus sinensis [apfelsine]
gb|KDO52603.1|  hypothetical protein CISIN_1g0085712mg                  137   3e-33   Citrus sinensis [apfelsine]
gb|EYU23115.1|  hypothetical protein MIMGU_mgv1a004585mg                136   4e-33   Erythranthe guttata [common monkey flower]
ref|XP_008239441.1|  PREDICTED: nucleolar protein 56-like               136   5e-33   Prunus mume [ume]
ref|XP_002283518.1|  PREDICTED: nucleolar protein 56-like               135   7e-33   Vitis vinifera
ref|XP_010102881.1|  hypothetical protein L484_002679                   135   1e-32   Morus notabilis
ref|XP_008392835.1|  PREDICTED: nucleolar protein 56-like               135   1e-32   
ref|XP_008351745.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    135   1e-32   
ref|XP_008374262.1|  PREDICTED: nucleolar protein 56-like               133   4e-32   Malus domestica [apple tree]
gb|KDP30943.1|  hypothetical protein JCGZ_11319                         133   4e-32   Jatropha curcas
ref|XP_009346504.1|  PREDICTED: nucleolar protein 56-like               133   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_009336572.1|  PREDICTED: nucleolar protein 56-like               133   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_002511213.1|  nucleolar protein nop56, putative                  132   1e-31   Ricinus communis
gb|EYU23114.1|  hypothetical protein MIMGU_mgv1a004585mg                132   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006374558.1|  hypothetical protein POPTR_0015s10500g             132   2e-31   Populus trichocarpa [western balsam poplar]
emb|CDY42406.1|  BnaA08g00080D                                          131   2e-31   Brassica napus [oilseed rape]
ref|XP_009106803.1|  PREDICTED: nucleolar protein 56-like               131   2e-31   Brassica rapa
ref|XP_009124126.1|  PREDICTED: nucleolar protein 56-like               131   2e-31   Brassica rapa
emb|CDY59117.1|  BnaCnng34340D                                          131   2e-31   Brassica napus [oilseed rape]
emb|CDY10510.1|  BnaC03g71040D                                          131   2e-31   Brassica napus [oilseed rape]
ref|XP_008464470.1|  PREDICTED: nucleolar protein 56-like               131   3e-31   Cucumis melo [Oriental melon]
ref|XP_006395291.1|  hypothetical protein EUTSA_v10004082mg             131   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_011024058.1|  PREDICTED: nucleolar protein 56-like               131   3e-31   Populus euphratica
ref|XP_004297546.1|  PREDICTED: nucleolar protein 56-like               130   4e-31   Fragaria vesca subsp. vesca
ref|XP_010248928.1|  PREDICTED: nucleolar protein 56-like               131   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010037433.1|  PREDICTED: nucleolar protein 56-like               130   4e-31   Eucalyptus grandis [rose gum]
ref|XP_004165830.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    130   5e-31   
ref|XP_004138057.1|  PREDICTED: nucleolar protein 56-like               130   5e-31   Cucumis sativus [cucumbers]
ref|XP_002318715.1|  nucleolar family protein                           130   6e-31   
ref|XP_006407288.1|  hypothetical protein EUTSA_v10020558mg             130   7e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010499575.1|  PREDICTED: nucleolar protein 56-like               129   7e-31   Camelina sativa [gold-of-pleasure]
gb|KJB40016.1|  hypothetical protein B456_007G042300                    130   8e-31   Gossypium raimondii
ref|XP_007210566.1|  hypothetical protein PRUPE_ppa003786mg             130   8e-31   Prunus persica
ref|NP_187892.2|  NOP56-like pre RNA processing ribonucleoprotein       129   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525694.1|  PREDICTED: nucleolar protein 56-like isoform 1     130   9e-31   Glycine max [soybeans]
dbj|BAE98741.1|  putative nucleolar protein                             129   9e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KHN34404.1|  Nucleolar protein 56                                    130   9e-31   Glycine soja [wild soybean]
ref|XP_011044181.1|  PREDICTED: nucleolar protein 56-like isoform X1    129   1e-30   Populus euphratica
ref|XP_011044182.1|  PREDICTED: nucleolar protein 56-like isoform X2    129   1e-30   Populus euphratica
ref|XP_010250780.1|  PREDICTED: nucleolar protein 56-like               129   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_011083862.1|  PREDICTED: nucleolar protein 56-like               129   1e-30   Sesamum indicum [beniseed]
gb|KJB08032.1|  hypothetical protein B456_001G060200                    129   2e-30   Gossypium raimondii
gb|KHG28458.1|  Nucleolar 56                                            129   2e-30   Gossypium arboreum [tree cotton]
ref|XP_006392564.1|  hypothetical protein EUTSA_v10011387mg             128   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010465064.1|  PREDICTED: nucleolar protein 56-like               128   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002894559.1|  hypothetical protein ARALYDRAFT_474678             128   3e-30   Arabidopsis lyrata subsp. lyrata
gb|KHN44630.1|  Nucleolar protein 56                                    128   3e-30   Glycine soja [wild soybean]
ref|XP_003549846.1|  PREDICTED: nucleolar protein 56-like               128   3e-30   Glycine max [soybeans]
gb|KHN14092.1|  Nucleolar protein 56                                    128   3e-30   Glycine soja [wild soybean]
emb|CDY57300.1|  BnaC03g73340D                                          128   3e-30   Brassica napus [oilseed rape]
emb|CDX82572.1|  BnaA03g32490D                                          127   3e-30   
ref|XP_009135254.1|  PREDICTED: nucleolar protein 56-like               127   4e-30   Brassica rapa
ref|XP_002882791.1|  hypothetical protein ARALYDRAFT_478647             127   4e-30   Arabidopsis lyrata subsp. lyrata
gb|ACJ85565.1|  unknown                                                 127   4e-30   Medicago truncatula
ref|XP_003608861.1|  Nucleolar protein                                  127   4e-30   Medicago truncatula
ref|XP_002322238.2|  nucleolar family protein                           127   5e-30   
emb|CDY52879.1|  BnaCnng23670D                                          125   7e-30   Brassica napus [oilseed rape]
gb|KFK35536.1|  hypothetical protein AALP_AA4G003300                    127   7e-30   Arabis alpina [alpine rockcress]
emb|CAA10127.1|  nucleolar protein                                      126   8e-30   Cicer arietinum [garbanzo]
ref|XP_004515826.1|  PREDICTED: nucleolar protein 56-like               127   8e-30   
emb|CBI15634.3|  unnamed protein product                                126   1e-29   Vitis vinifera
ref|XP_010480175.1|  PREDICTED: nucleolar protein 56-like               126   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010501245.1|  PREDICTED: nucleolar protein 56-like               125   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010480123.1|  PREDICTED: nucleolar protein 56-like               125   2e-29   Camelina sativa [gold-of-pleasure]
gb|AFK46206.1|  unknown                                                 125   2e-29   Medicago truncatula
ref|XP_010462480.1|  PREDICTED: nucleolar protein 56-like               125   2e-29   Camelina sativa [gold-of-pleasure]
gb|KHG15507.1|  Nucleolar 56                                            125   2e-29   Gossypium arboreum [tree cotton]
gb|EYU43055.1|  hypothetical protein MIMGU_mgv1a004561mg                125   2e-29   Erythranthe guttata [common monkey flower]
gb|KFK38628.1|  hypothetical protein AALP_AA3G138900                    125   2e-29   Arabis alpina [alpine rockcress]
ref|XP_007155528.1|  hypothetical protein PHAVU_003G209500g             125   2e-29   Phaseolus vulgaris [French bean]
ref|XP_010677900.1|  PREDICTED: nucleolar protein 56-like               125   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006588283.1|  PREDICTED: nucleolar protein 56-like               125   4e-29   
ref|NP_176007.1|  nucleolar protein NOP56-like protein                  124   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796174.1|  PREDICTED: nucleolar protein 56-like isoform X2    125   6e-29   Phoenix dactylifera
ref|XP_010938674.1|  PREDICTED: nucleolar protein 56-like               124   9e-29   Elaeis guineensis
ref|XP_010543116.1|  PREDICTED: nucleolar protein 56-like               124   1e-28   Tarenaya hassleriana [spider flower]
dbj|BAH20197.1|  AT1G56110                                              122   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921864.1|  PREDICTED: nucleolar protein 56-like               123   2e-28   Elaeis guineensis
ref|XP_008796173.1|  PREDICTED: nucleolar protein 56-like isoform X1    123   3e-28   
ref|XP_006307187.1|  hypothetical protein CARUB_v10008778mg             122   3e-28   
ref|XP_002461161.1|  hypothetical protein SORBIDRAFT_02g042030          122   4e-28   Sorghum bicolor [broomcorn]
ref|XP_006297501.1|  hypothetical protein CARUB_v10013523mg             121   5e-28   Capsella rubella
ref|XP_006650085.1|  PREDICTED: nucleolar protein 56-like               122   7e-28   Oryza brachyantha
gb|EPS72848.1|  hypothetical protein M569_01909                         121   8e-28   Genlisea aurea
gb|AFK36574.1|  unknown                                                 121   8e-28   Lotus japonicus
ref|XP_009386842.1|  PREDICTED: nucleolar protein 56-like               121   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS66462.1|  hypothetical protein TRIUR3_03326                       121   1e-27   Triticum urartu
ref|XP_010534767.1|  PREDICTED: nucleolar protein 56                    120   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_003562510.1|  PREDICTED: nucleolar protein 56-like               120   1e-27   Brachypodium distachyon [annual false brome]
dbj|BAK00100.1|  predicted protein                                      120   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT17366.1|  hypothetical protein F775_05055                         120   2e-27   
gb|EMS45652.1|  hypothetical protein TRIUR3_03792                       119   2e-27   Triticum urartu
ref|XP_003563386.1|  PREDICTED: nucleolar protein 56-like               119   4e-27   Brachypodium distachyon [annual false brome]
ref|XP_002465270.1|  hypothetical protein SORBIDRAFT_01g035290          119   4e-27   Sorghum bicolor [broomcorn]
dbj|BAK00655.1|  predicted protein                                      119   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009399980.1|  PREDICTED: nucleolar protein 56-like               119   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001766920.1|  predicted protein                                  119   4e-27   
gb|EMT05996.1|  hypothetical protein F775_30288                         119   4e-27   
ref|XP_008811770.1|  PREDICTED: nucleolar protein 56-like               119   4e-27   Phoenix dactylifera
gb|EAY90010.1|  hypothetical protein OsI_11580                          119   5e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001050122.1|  Os03g0352300                                       119   5e-27   
tpg|DAA45392.1|  TPA: hypothetical protein ZEAMMB73_921810              117   7e-27   
ref|XP_001754987.1|  predicted protein                                  119   7e-27   
ref|XP_004958597.1|  PREDICTED: nucleolar protein 56-like               117   2e-26   Setaria italica
gb|AFW88375.1|  hypothetical protein ZEAMMB73_553591                    117   2e-26   
ref|XP_008677944.1|  PREDICTED: LOC100283975 isoform X1                 117   3e-26   
ref|NP_001150345.1|  LOC100283975                                       117   3e-26   
ref|XP_004984360.1|  PREDICTED: nucleolar protein 56-like               117   3e-26   Setaria italica
ref|XP_008660150.1|  PREDICTED: nucleolar protein 56-like isoform X2    117   3e-26   Zea mays [maize]
ref|XP_008660149.1|  PREDICTED: nucleolar protein 56-like isoform X1    117   4e-26   Zea mays [maize]
ref|XP_006845152.1|  hypothetical protein AMTR_s00005p00226680          112   1e-24   Amborella trichopoda
ref|XP_002964924.1|  hypothetical protein SELMODRAFT_167367             110   6e-24   
gb|AFB34246.1|  hypothetical protein CL3321Contig1_03                   102   8e-24   Abies alba [abete-blanco]
ref|XP_003058762.1|  predicted protein                                  109   8e-24   Micromonas pusilla CCMP1545
gb|AEW09033.1|  hypothetical protein CL3321Contig1_03                   102   9e-24   Pinus lambertiana
ref|XP_003080616.1|  nucleolar protein Nop56, putative (ISS)            105   9e-24   
ref|XP_002114548.1|  hypothetical protein TRIADDRAFT_28215              108   2e-23   Trichoplax adhaerens
ref|XP_001697006.1|  nucleolar protein, component of C/D snoRNPs        107   8e-23   Chlamydomonas reinhardtii
ref|XP_004469207.1|  PREDICTED: nucleolar protein 56 isoform 3          103   2e-22   
emb|CEG01347.1|  NOSIC                                                  105   2e-22   Ostreococcus tauri
ref|XP_002502983.1|  predicted protein                                  106   2e-22   Micromonas commoda
ref|XP_002953396.1|  hypothetical protein VOLCADRAFT_105910             105   3e-22   Volvox carteri f. nagariensis
ref|XP_008119824.1|  PREDICTED: nucleolar protein 56                    105   3e-22   Anolis carolinensis [Carolina anole]
ref|XP_005828248.1|  hypothetical protein GUITHDRAFT_74893              105   3e-22   Guillardia theta CCMP2712
ref|XP_007513547.1|  predicted protein                                  105   4e-22   Bathycoccus prasinos
gb|KDR23556.1|  Nucleolar protein 56                                    104   4e-22   Zootermopsis nevadensis
ref|XP_006874908.1|  PREDICTED: nucleolar protein 56                    104   4e-22   Chrysochloris asiatica
ref|XP_003494005.1|  PREDICTED: nucleolar protein 56-like               104   5e-22   Bombus impatiens
ref|XP_004469206.1|  PREDICTED: nucleolar protein 56 isoform 2          103   5e-22   
ref|XP_003393259.1|  PREDICTED: nucleolar protein 56-like               104   6e-22   Bombus terrestris [large earth bumblebee]
ref|XP_001748935.1|  hypothetical protein                               104   6e-22   Monosiga brevicollis MX1
ref|XP_001110561.2|  PREDICTED: nucleolar protein 56-like               103   6e-22   
ref|XP_011299290.1|  PREDICTED: nucleolar protein 56                    104   6e-22   Fopius arisanus
ref|XP_003773512.1|  PREDICTED: nucleolar protein 56                    105   6e-22   Sarcophilus harrisii
ref|XP_007496986.1|  PREDICTED: nucleolar protein 56                    105   6e-22   Monodelphis domestica
gb|EAX10585.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    103   7e-22   Homo sapiens [man]
gb|AAX61126.1|  XNop56                                                98.6    7e-22   Oreochromis mossambicus [Hawaiian perch]
ref|XP_006187183.1|  PREDICTED: nucleolar protein 56                    103   7e-22   Camelus ferus
ref|XP_006207381.1|  PREDICTED: nucleolar protein 56                    103   8e-22   Vicugna pacos
dbj|BAK08040.1|  predicted protein                                      103   9e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006758084.1|  PREDICTED: nucleolar protein 56 isoform X1         104   1e-21   Myotis davidii
ref|XP_004469205.1|  PREDICTED: nucleolar protein 56 isoform 1          103   1e-21   
ref|XP_006096440.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    104   1e-21   
ref|XP_008139230.1|  PREDICTED: nucleolar protein 56                    104   1e-21   Eptesicus fuscus
ref|XP_003251769.1|  PREDICTED: nucleolar protein 56-like               103   1e-21   
gb|ELK34501.1|  Nucleolar protein 56                                    104   1e-21   Myotis davidii
ref|XP_005874824.1|  PREDICTED: nucleolar protein 56                    104   1e-21   Myotis brandtii
gb|EPQ13011.1|  Nucleolar protein 56                                    104   1e-21   Myotis brandtii
gb|AAK93068.1|  GM14238p                                                100   1e-21   Drosophila melanogaster
gb|AAH02231.1|  Nop56 protein                                           102   1e-21   Mus musculus [mouse]
ref|XP_011144657.1|  PREDICTED: nucleolar protein 56-like             99.4    1e-21   
gb|AAX13146.1|  Nop56                                                   102   1e-21   Drosophila pseudoobscura
dbj|BAM20699.1|  hypothetical protein                                   101   1e-21   Papilio polytes
gb|EFN81118.1|  Nucleolar protein 5A                                  99.4    1e-21   Harpegnathos saltator
gb|EHB04280.1|  Nucleolar protein 56                                    104   2e-21   Heterocephalus glaber [naked mole rat]
ref|XP_005998724.1|  PREDICTED: nucleolar protein 56                    102   2e-21   
gb|EHJ74314.1|  putative nucleolar KKE/D repeat protein DmNOP56         102   2e-21   
ref|XP_011186011.1|  PREDICTED: nucleolar protein 56                    103   2e-21   Zeugodacus cucurbitae [melon fruit fly]
gb|AAH18421.1|  NOP56 protein                                           102   2e-21   Homo sapiens [man]
ref|XP_001419274.1|  predicted protein                                  102   2e-21   Ostreococcus lucimarinus CCE9901
gb|EDL25415.1|  mCG51800                                                101   2e-21   Mus musculus [mouse]
gb|AAX13147.1|  Nop56                                                   102   2e-21   Drosophila miranda
ref|XP_006616125.1|  PREDICTED: nucleolar protein 56-like               103   2e-21   Apis dorsata [rock honeybee]
gb|ELV12810.1|  Nucleolar protein 56                                    103   2e-21   Tupaia chinensis
ref|XP_003973642.1|  PREDICTED: nucleolar protein 56-like               103   2e-21   
ref|XP_005855181.1|  nucleolar protein 56                               101   2e-21   Nannochloropsis gaditana CCMP526
ref|XP_004383061.1|  PREDICTED: nucleolar protein 56                    103   2e-21   Trichechus manatus latirostris
ref|XP_010609331.1|  PREDICTED: nucleolar protein 56 isoform X2         102   2e-21   Fukomys damarensis [Damara mole rat]
ref|XP_005568575.1|  PREDICTED: nucleolar protein 56 isoform X2         102   2e-21   Macaca fascicularis [crab eating macaque]
ref|XP_008972994.1|  PREDICTED: nucleolar protein 56 isoform X2         102   3e-21   Pan paniscus [bonobo]
ref|XP_007656687.1|  PREDICTED: nucleolar protein 56                    102   3e-21   
ref|XP_001358724.2|  Nop56                                              102   3e-21   Drosophila pseudoobscura pseudoobscura
ref|XP_007958209.1|  PREDICTED: nucleolar protein 56 isoform X2         103   3e-21   Orycteropus afer afer
ref|XP_007958208.1|  PREDICTED: nucleolar protein 56 isoform X1         103   3e-21   Orycteropus afer afer
ref|XP_002013567.1|  GL23339                                            102   3e-21   Drosophila persimilis
gb|EWM24566.1|  Pre-mRNA processing ribonucleoprotein, snoRNA-bin...    101   3e-21   Nannochloropsis gaditana
ref|XP_007960441.1|  PREDICTED: nucleolar protein 56 isoform X2         103   3e-21   Chlorocebus sabaeus
emb|CAB92783.1|  nucleolar protein                                      102   3e-21   Drosophila subobscura
ref|XP_010609330.1|  PREDICTED: nucleolar protein 56 isoform X1         103   3e-21   Fukomys damarensis [Damara mole rat]
ref|XP_003706024.1|  PREDICTED: nucleolar protein 56                    102   3e-21   
ref|XP_006984579.1|  PREDICTED: nucleolar protein 56 isoform X2         102   3e-21   Peromyscus maniculatus bairdii
ref|XP_007960434.1|  PREDICTED: nucleolar protein 56 isoform X1         103   3e-21   Chlorocebus sabaeus
ref|XP_003821337.1|  PREDICTED: nucleolar protein 56 isoform X1         103   3e-21   Pan paniscus [bonobo]
ref|NP_001231603.1|  nucleolar protein 56                               103   3e-21   Pan troglodytes
dbj|BAJ21047.1|  NOP56 ribonucleoprotein homolog                        103   3e-21   synthetic construct
ref|NP_001271483.1|  nucleolar protein 56                               103   3e-21   Macaca fascicularis [crab eating macaque]
ref|XP_003695473.1|  PREDICTED: nucleolar protein 56                    102   3e-21   
emb|CAA72789.1|  hNop56                                                 103   3e-21   Homo sapiens [man]
ref|XP_004585734.1|  PREDICTED: nucleolar protein 56                    103   3e-21   Ochotona princeps [southern American pika]
ref|NP_006383.2|  nucleolar protein 56                                  103   3e-21   Homo sapiens [man]
ref|XP_004061753.1|  PREDICTED: nucleolar protein 56                    103   3e-21   Gorilla gorilla gorilla [lowland gorilla]
gb|EAX10587.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    103   3e-21   Homo sapiens [man]
ref|XP_011212587.1|  PREDICTED: nucleolar protein 56                    102   3e-21   Bactrocera dorsalis [papaya fruit fly]
gb|EHH19861.1|  Nucleolar protein 5A                                    103   3e-21   Macaca mulatta [rhesus macaque]
gb|EAX10589.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    103   3e-21   Homo sapiens [man]
dbj|BAF85410.1|  unnamed protein product                                103   3e-21   Homo sapiens [man]
ref|XP_002287003.1|  predicted protein                                  102   3e-21   Thalassiosira pseudonana CCMP1335
gb|EFB15471.1|  hypothetical protein PANDA_007374                       103   3e-21   Ailuropoda melanoleuca
ref|XP_010377311.1|  PREDICTED: nucleolar protein 56                    103   3e-21   Rhinopithecus roxellana
ref|XP_008254455.1|  PREDICTED: nucleolar protein 56                    103   3e-21   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006163996.1|  PREDICTED: nucleolar protein 56                    103   3e-21   Tupaia chinensis
ref|NP_001125816.1|  nucleolar protein 56                               103   3e-21   Pongo abelii [orang utan]
ref|XP_003273471.1|  PREDICTED: nucleolar protein 56                    103   3e-21   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004634291.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Octodon degus
ref|XP_004687397.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Condylura cristata
ref|XP_006984578.1|  PREDICTED: nucleolar protein 56 isoform X1         103   4e-21   Peromyscus maniculatus bairdii
ref|XP_011367718.1|  PREDICTED: nucleolar protein 56 isoform X2         102   4e-21   Pteropus vampyrus
ref|XP_007635385.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Cricetulus griseus [Chinese hamsters]
ref|XP_005893993.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Bos mutus
ref|XP_004014434.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Ovis aries [domestic sheep]
ref|XP_005974822.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Pantholops hodgsonii [Tibetan antelope]
ref|XP_010834818.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Bison bison bison
ref|XP_010589876.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Loxodonta africana [African bush elephant]
ref|XP_010986588.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Camelus dromedarius [camel]
ref|NP_001028794.1|  nucleolar protein 56                               103   4e-21   Bos taurus [bovine]
ref|XP_004433888.1|  PREDICTED: nucleolar protein 56 isoform 2          103   4e-21   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ERE69819.1|  nucleolar protein 56                                    103   4e-21   Cricetulus griseus [Chinese hamsters]
ref|XP_008587878.1|  PREDICTED: nucleolar protein 56                    103   4e-21   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003476468.2|  PREDICTED: nucleolar protein 56                    103   4e-21   Cavia porcellus [guinea pig]
ref|XP_010971089.1|  PREDICTED: nucleolar protein 56                    102   4e-21   Camelus bactrianus [camel]
ref|XP_008505981.1|  PREDICTED: nucleolar protein 56                    102   4e-21   Equus przewalskii [Przewalski horse]
ref|XP_007127210.1|  PREDICTED: nucleolar protein 56 isoform X1         102   4e-21   
ref|XP_007195878.1|  PREDICTED: nucleolar protein 56                    102   4e-21   
ref|XP_004285382.1|  PREDICTED: nucleolar protein 56                    102   4e-21   
ref|XP_005068672.1|  PREDICTED: nucleolar protein 56                    102   4e-21   
ref|XP_004318042.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    102   4e-21   
ref|XP_011367711.1|  PREDICTED: nucleolar protein 56 isoform X1         102   4e-21   Pteropus vampyrus
gb|EAX10584.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    103   5e-21   Homo sapiens [man]
ref|XP_006921729.1|  PREDICTED: nucleolar protein 56                    102   5e-21   Pteropus alecto
ref|XP_004433887.1|  PREDICTED: nucleolar protein 56 isoform 1          102   5e-21   
ref|XP_007465444.1|  PREDICTED: nucleolar protein 56                    102   5e-21   Lipotes vexillifer [baiji]
ref|XP_005604787.1|  PREDICTED: nucleolar protein 56                    102   5e-21   
gb|ELK04028.1|  Nucleolar protein 56                                    102   5e-21   Pteropus alecto
ref|XP_005688279.1|  PREDICTED: nucleolar protein 56                    100   5e-21   
gb|KFB36904.1|  AGAP002063-PA-like protein                              102   6e-21   Anopheles sinensis
gb|AAH90915.1|  Nop56 protein                                           100   6e-21   Danio rerio [leopard danio]
gb|EAX10586.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    101   6e-21   Homo sapiens [man]
gb|KFO20546.1|  Transmembrane channel-like protein 2                    102   6e-21   Fukomys damarensis [Damara mole rat]
ref|XP_006038080.1|  PREDICTED: nucleolar protein 56                    101   6e-21   
ref|XP_008477583.1|  PREDICTED: nucleolar protein 56                    102   6e-21   
ref|XP_007444019.1|  PREDICTED: nucleolar protein 56                    100   6e-21   Python bivittatus
ref|XP_002608922.1|  hypothetical protein BRAFLDRAFT_85513              102   6e-21   Branchiostoma floridae
gb|EAX10588.1|  nucleolar protein 5A (56kDa with KKE/D repeat), i...    102   7e-21   Homo sapiens [man]
ref|XP_005380816.1|  PREDICTED: nucleolar protein 56 isoform X2         101   7e-21   
ref|XP_008065374.1|  PREDICTED: nucleolar protein 56                    102   7e-21   
gb|AAH86568.1|  Nol5a protein                                           101   7e-21   Rattus norvegicus [brown rat]
ref|XP_010350076.1|  PREDICTED: nucleolar protein 56 isoform X2         101   8e-21   Saimiri boliviensis boliviensis
ref|XP_007523137.1|  PREDICTED: nucleolar protein 56                    102   8e-21   
emb|CAJ81913.1|  nucleolar protein 5A (56kDa with KKE/D repeat)         101   8e-21   Xenopus tropicalis [western clawed frog]
ref|XP_008407701.1|  PREDICTED: nucleolar protein 56                    101   9e-21   Poecilia reticulata
ref|XP_005380815.1|  PREDICTED: nucleolar protein 56 isoform X1         102   9e-21   Chinchilla lanigera
ref|XP_005634931.1|  PREDICTED: nucleolar protein 56 isoform X2         100   9e-21   
ref|XP_006500125.1|  PREDICTED: nucleolar protein 56 isoform X1         100   9e-21   Mus musculus [mouse]
ref|XP_004068922.1|  PREDICTED: nucleolar protein 56                    102   9e-21   Oryzias latipes [Japanese rice fish]
ref|NP_001184132.1|  NOP56 ribonucleoprotein homolog                    101   9e-21   Xenopus tropicalis [western clawed frog]
ref|XP_005320605.1|  PREDICTED: nucleolar protein 56                    102   9e-21   Ictidomys tridecemlineatus
ref|XP_007554336.1|  PREDICTED: nucleolar protein 56                    101   1e-20   Poecilia formosa
gb|AAH56732.1|  Nop56 protein                                           100   1e-20   Danio rerio [leopard danio]
ref|XP_002073574.1|  GK14188                                            101   1e-20   
ref|XP_001954789.1|  GF16568                                            101   1e-20   Drosophila ananassae
ref|XP_004697938.1|  PREDICTED: nucleolar protein 56                    101   1e-20   Echinops telfairi [lesser hedgehog tenrec]
dbj|BAE24185.1|  unnamed protein product                                101   1e-20   Mus musculus [mouse]
ref|XP_005365683.1|  PREDICTED: nucleolar protein 56                    101   1e-20   Microtus ochrogaster [prairie voles]
ref|XP_005161071.2|  PREDICTED: nucleolar protein 56 isoform X1         101   1e-20   
ref|XP_002054381.1|  GJ22835                                            100   1e-20   
ref|NP_001231234.1|  nucleolar protein 56                               101   1e-20   
ref|XP_002741552.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_002032194.1|  GM23654                                            100   1e-20   
ref|XP_009080666.1|  PREDICTED: nucleolar protein 56                    100   1e-20   
ref|XP_001982282.1|  GG12519                                            100   1e-20   
ref|XP_003361646.2|  PREDICTED: nucleolar protein 56-like               101   1e-20   
ref|XP_011222704.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_008852723.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_002104416.1|  GD18461                                            100   1e-20   
dbj|BAB26511.1|  unnamed protein product                                101   1e-20   
ref|XP_002098284.1|  GE24041                                            100   1e-20   
gb|EPY79204.1|  transmembrane cochlear-expressed protein 2-like p...    101   1e-20   
ref|NP_651040.3|  Nop56                                                 100   1e-20   
ref|NP_077155.2|  nucleolar protein 56                                  101   1e-20   
gb|AAN71368.1|  RE33426p                                                100   1e-20   
ref|XP_003442755.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|NP_001020903.1|  nucleolar protein 56                               101   1e-20   
ref|XP_003941099.1|  PREDICTED: nucleolar protein 56 isoform X1         101   1e-20   
ref|XP_851724.2|  PREDICTED: nucleolar protein 56 isoform X3            101   1e-20   
gb|AAH21355.1|  NOP56 ribonucleoprotein homolog (yeast)                 101   1e-20   
ref|XP_006784620.1|  PREDICTED: nucleolar protein 56-like               101   1e-20   
ref|XP_005634930.1|  PREDICTED: nucleolar protein 56 isoform X1         101   1e-20   
ref|XP_004886763.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_008701649.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_004398200.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_005918710.1|  PREDICTED: nucleolar protein 56-like               101   1e-20   
dbj|BAC37015.1|  unnamed protein product                                101   1e-20   
ref|XP_973514.1|  PREDICTED: nucleolar protein 56                       100   1e-20   
ref|XP_005731328.1|  PREDICTED: nucleolar protein 56-like               101   1e-20   
ref|XP_004661489.1|  PREDICTED: nucleolar protein 56                    100   1e-20   
ref|XP_006732348.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_004545283.1|  PREDICTED: nucleolar protein 56-like               101   1e-20   
ref|XP_001629178.1|  predicted protein                                  100   1e-20   
ref|XP_011065147.1|  PREDICTED: nucleolar protein 56                    100   1e-20   
ref|XP_009554657.1|  PREDICTED: nucleolar protein 56                  99.8    1e-20   
ref|XP_003983778.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_003726537.1|  PREDICTED: nucleolar protein 56                    100   1e-20   
ref|XP_005187804.1|  PREDICTED: nucleolar protein 56                    100   1e-20   
ref|XP_004772971.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
ref|XP_008278728.1|  PREDICTED: nucleolar protein 56                    101   1e-20   
gb|EPZ33215.1|  NOSIC domain-containing protein                         100   1e-20   
ref|XP_004993595.1|  nucleolar protein 5A                               100   2e-20   
emb|CAG01410.1|  unnamed protein product                                101   2e-20   
ref|XP_005140506.1|  PREDICTED: nucleolar protein 56-like             99.0    2e-20   
ref|XP_005848173.1|  hypothetical protein CHLNCDRAFT_145563           99.4    2e-20   
gb|EGI58948.1|  Nucleolar protein 56                                    100   2e-20   
gb|EFN77237.1|  Nucleolar protein 5A                                    100   2e-20   
ref|XP_008318633.1|  PREDICTED: nucleolar protein 56                    100   2e-20   
ref|XP_004611059.1|  PREDICTED: nucleolar protein 56                    100   2e-20   
gb|AAX13148.1|  Nop56                                                 99.4    2e-20   
ref|XP_006626757.1|  PREDICTED: nucleolar protein 56-like               100   2e-20   
gb|EHH65491.1|  Nucleolar protein 5A                                    100   2e-20   
gb|ELT94557.1|  hypothetical protein CAPTEDRAFT_159443                  100   2e-20   
ref|XP_011150468.1|  PREDICTED: nucleolar protein 56-like               100   2e-20   
ref|XP_011135314.1|  PREDICTED: nucleolar protein 56-like               100   2e-20   
gb|KFO72809.1|  Nucleolar protein 56                                  98.6    2e-20   
gb|AAH97676.1|  XNop56 protein                                          100   2e-20   
ref|XP_007073321.1|  PREDICTED: nucleolar protein 56                    100   2e-20   
gb|AAI06207.1|  XNop56 protein                                          100   3e-20   
ref|XP_004332871.1|  nucleolar protein Nop56, putative                99.0    3e-20   
ref|NP_001082151.1|  XNop56 protein                                     100   3e-20   
ref|XP_005815219.1|  PREDICTED: nucleolar protein 56-like               100   3e-20   
ref|XP_005431020.1|  PREDICTED: nucleolar protein 56                  98.2    3e-20   
ref|XP_002000695.1|  GI10373                                          99.8    3e-20   
gb|ELR57620.1|  Nucleolar protein 56                                    100   3e-20   
ref|XP_005715132.1|  box C/D snoRNP component Nop56                   99.8    3e-20   
ref|XP_005278495.1|  PREDICTED: nucleolar protein 56                    100   3e-20   
ref|XP_008556069.1|  PREDICTED: nucleolar protein 56                  99.4    4e-20   
emb|CCA15297.1|  nucleolar protein Nop56 putative                     99.8    4e-20   
ref|XP_010741588.1|  PREDICTED: nucleolar protein 56                    100   4e-20   
ref|XP_001994928.1|  GH17505                                          99.4    4e-20   
ref|XP_009883931.1|  PREDICTED: nucleolar protein 56-like             99.4    4e-20   
gb|EMS45651.1|  hypothetical protein TRIUR3_03791                     98.6    4e-20   
emb|CCI44577.1|  unnamed protein product                              99.4    5e-20   
ref|XP_010764516.1|  PREDICTED: nucleolar protein 56                  97.1    5e-20   
ref|XP_005062209.1|  PREDICTED: nucleolar protein 56                  99.4    6e-20   
ref|XP_009098197.1|  PREDICTED: nucleolar protein 56                  98.6    6e-20   
ref|XP_004345107.2|  nucleolar protein 5A                             99.0    6e-20   
gb|EJK47796.1|  hypothetical protein THAOC_33466                      98.6    6e-20   
ref|XP_005511804.1|  PREDICTED: nucleolar protein 56                  99.4    6e-20   
dbj|BAE27007.1|  unnamed protein product                              99.4    6e-20   
ref|XP_006675663.1|  hypothetical protein BATDEDRAFT_32692            99.0    6e-20   
ref|XP_002423012.1|  Nucleolar protein Nop56, putative                98.6    7e-20   
gb|KJE95980.1|  nucleolar protein 5A                                  98.6    7e-20   
gb|KDQ15155.1|  hypothetical protein BOTBODRAFT_145382                98.6    7e-20   
ref|XP_008879803.1|  hypothetical protein H310_13917                  97.4    7e-20   
ref|XP_010566789.1|  PREDICTED: nucleolar protein 56                  99.0    8e-20   
ref|XP_008892177.1|  hypothetical protein PPTG_02695                  98.6    8e-20   
ref|XP_005518148.1|  PREDICTED: nucleolar protein 56                  99.0    8e-20   
emb|CDS07170.1|  hypothetical protein LRAMOSA09693                    98.6    9e-20   
ref|NP_001026559.1|  nucleolar protein 56                             98.6    9e-20   
emb|CDH49232.1|  nucleolar protein nop56                              98.2    1e-19   
gb|ACN10991.1|  Nucleolar protein 5A                                  98.6    1e-19   
ref|NP_001134028.1|  Nucleolar protein 5A                             98.6    1e-19   
emb|CDQ61956.1|  unnamed protein product                              98.6    1e-19   
ref|XP_002127982.1|  PREDICTED: nucleolar protein 56-like             98.6    1e-19   
gb|KDO20999.1|  hypothetical protein SPRG_13895                       96.7    1e-19   
gb|KDO22655.1|  hypothetical protein SPRG_12284                       96.7    1e-19   
ref|XP_008616077.1|  hypothetical protein SDRG_11801                  96.7    1e-19   
ref|XP_320984.4|  AGAP002063-PA                                       97.8    1e-19   
ref|XP_004933030.1|  PREDICTED: nucleolar protein 56-like             97.4    1e-19   
ref|XP_002999165.1|  nucleolar protein Nop56                          97.8    2e-19   
ref|NP_957511.1|  nucleolar protein 56                                97.4    2e-19   
emb|CBN81123.1|  Nucleolar protein 5A                                 98.2    2e-19   
ref|XP_009519011.1|  hypothetical protein PHYSODRAFT_482921           97.8    2e-19   
ref|XP_007246079.1|  PREDICTED: nucleolar protein 56-like             97.8    2e-19   
ref|XP_004414666.1|  PREDICTED: nucleolar protein 56-like             94.0    3e-19   
ref|XP_006113647.1|  PREDICTED: nucleolar protein 56                  96.3    4e-19   
ref|XP_011401661.1|  Nucleolar protein 56                             96.3    4e-19   
ref|XP_003383935.1|  PREDICTED: nucleolar protein 56-like             95.9    4e-19   
ref|XP_001603746.2|  PREDICTED: nucleolar protein 56                  96.3    5e-19   
ref|XP_010879154.1|  PREDICTED: nucleolar protein 56                  96.7    5e-19   
gb|KDE09204.1|  nucleolar protein 56                                  96.7    5e-19   
gb|ETN58694.1|  nucleolar protein Nop56                               96.3    5e-19   
ref|XP_007866915.1|  Nop-domain-containing protein                    96.7    5e-19   
ref|XP_010726026.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  95.1    6e-19   
ref|XP_002434695.1|  ribosome biogenesis protein - Nop58p/Nop5p, ...  96.3    7e-19   
gb|EJW87228.1|  hypothetical protein WUBG_01856                       94.0    7e-19   
gb|EPB88498.1|  hypothetical protein HMPREF1544_04733                 95.9    7e-19   
ref|XP_007883174.1|  PREDICTED: nucleolar protein 56                  95.9    7e-19   
emb|CEP08181.1|  hypothetical protein                                 95.9    7e-19   
dbj|GAN01361.1|  nop-domain-containing protein                        95.5    8e-19   
gb|EZA47226.1|  Nucleolar protein                                     94.7    8e-19   
emb|CDP96759.1|  Protein Bm4869, isoform b                            92.8    8e-19   
ref|XP_001900200.1|  nol5a protein                                    92.8    8e-19   
ref|XP_002836982.1|  hypothetical protein                             95.5    9e-19   
ref|XP_011350170.1|  PREDICTED: nucleolar protein 56 isoform X2       94.7    9e-19   
ref|XP_011350169.1|  PREDICTED: nucleolar protein 56 isoform X1       94.7    1e-18   
emb|CCX08180.1|  Similar to Nucleolar protein 56; acc. no. Q12460     95.1    1e-18   
ref|XP_009029570.1|  hypothetical protein HELRODRAFT_157952           94.7    1e-18   
gb|ACO12309.1|  Nucleolar protein 5A                                  95.1    1e-18   
ref|XP_011504958.1|  PREDICTED: nucleolar protein 56                  95.1    1e-18   
ref|XP_011172969.1|  PREDICTED: nucleolar protein 56                  94.7    1e-18   
ref|XP_006958132.1|  Nop-domain-containing protein                    95.1    2e-18   
ref|XP_001845079.1|  nucleolar protein Nop56                          94.7    2e-18   
ref|XP_011493522.1|  AAEL017421-PA                                    94.7    2e-18   
ref|XP_011451342.1|  PREDICTED: nucleolar protein 56-like             94.0    2e-18   
gb|KDD75119.1|  putative snoRNA binding domain-containing protein     94.7    2e-18   
ref|XP_005239616.1|  PREDICTED: dynactin subunit 1                    93.6    2e-18   
gb|ESA02498.1|  hypothetical protein GLOINDRAFT_337356                93.2    2e-18   
ref|XP_002747496.3|  PREDICTED: nucleolar protein 56                  93.2    3e-18   
gb|EFX71480.1|  nucleolar protein-like protein 5A                     94.4    3e-18   
ref|XP_009037754.1|  hypothetical protein AURANDRAFT_59068            94.0    3e-18   
ref|XP_009056335.1|  hypothetical protein LOTGIDRAFT_119841           94.4    3e-18   
ref|XP_003325018.1|  hypothetical protein PGTG_06555                  94.4    3e-18   
ref|XP_009497331.1|  hypothetical protein H696_05198                  94.0    3e-18   
gb|KFH67499.1|  hypothetical protein MVEG_06231                       94.0    3e-18   
gb|KFH65972.1|  hypothetical protein MVEG_08074                       93.6    4e-18   
gb|ENH83289.1|  pre-rRNA processing nucleolar protein                 92.8    4e-18   
gb|EQB50536.1|  NOSIC domain-containing protein                       92.8    4e-18   
ref|XP_007408019.1|  hypothetical protein MELLADRAFT_47719            94.0    4e-18   
ref|XP_005435467.1|  PREDICTED: dynactin subunit 1                    92.8    4e-18   
ref|XP_007277106.1|  pre-rRNA processing nucleolar protein            92.8    4e-18   
ref|XP_011350166.1|  PREDICTED: nucleolar protein 56-like             93.6    4e-18   
ref|XP_003747562.1|  PREDICTED: nucleolar protein 56                  93.2    5e-18   
ref|XP_009268467.1|  Nucleolar protein 56                             93.6    5e-18   
dbj|GAA94153.1|  hypothetical protein E5Q_00801                       93.6    5e-18   
gb|KHC63324.1|  nucleolar protein 56                                  92.4    5e-18   
gb|KGQ80465.1|  nucleolar protein 56                                  92.4    5e-18   
gb|KHC51644.1|  nucleolar protein 56                                  92.4    5e-18   
ref|XP_719331.1|  hypothetical protein CaO19.7569                     92.4    5e-18   
gb|KGU00418.1|  nucleolar protein 56                                  92.4    5e-18   
gb|EZA47223.1|  Nucleolar protein                                     93.2    5e-18   
gb|EFQ30418.1|  NOSIC domain-containing protein                       92.0    6e-18   
ref|XP_004523360.1|  PREDICTED: nucleolar protein 56-like             92.8    7e-18   
ref|XP_007294646.1|  nucleolar protein NOP56                          93.2    7e-18   
gb|EFN63818.1|  Nucleolar protein 5A                                  92.4    8e-18   
ref|XP_001387632.1|  nucleolar protein involved in pre- rRNA proc...  91.7    8e-18   
ref|XP_002546388.1|  protein SIK1                                     92.8    8e-18   
ref|XP_006665709.1|  protein SIK1                                     92.8    9e-18   
ref|XP_011262960.1|  PREDICTED: nucleolar protein 56                  92.4    1e-17   
emb|CCF42847.1|  NOSIC domain-containing protein                      92.4    1e-17   
gb|AEE63285.1|  unknown                                               92.4    1e-17   
gb|ERL90889.1|  hypothetical protein D910_08234                       92.4    1e-17   
gb|ENN72756.1|  hypothetical protein YQE_10561                        92.4    1e-17   
gb|KIY69599.1|  Nop-domain-containing protein                         92.4    1e-17   
emb|CBY23079.1|  unnamed protein product                              90.5    1e-17   
ref|XP_005780212.1|  hypothetical protein EMIHUDRAFT_434886           92.0    1e-17   
ref|XP_007373328.1|  nucleolar protein                                91.3    1e-17   
gb|KIK08078.1|  hypothetical protein K443DRAFT_672961                 92.4    1e-17   
ref|XP_502927.1|  YALI0D17116p                                        92.0    1e-17   
ref|XP_006462942.1|  hypothetical protein AGABI2DRAFT_179517          90.9    1e-17   
emb|CEF70244.1|  FI04781p                                             91.7    1e-17   
ref|NP_505660.1|  Protein K07C5.4                                     92.0    1e-17   
ref|XP_003869074.1|  Sik1 U3 snoRNP protein                           92.0    1e-17   
gb|KDQ62806.1|  hypothetical protein JAAARDRAFT_149920                92.0    1e-17   
ref|XP_002637091.1|  Hypothetical protein CBG09590                    91.7    2e-17   
ref|XP_002422458.1|  U3 snoRNP protein, putative                      90.5    2e-17   
ref|XP_007341452.1|  Nop-domain-containing protein                    91.7    2e-17   
ref|XP_008037222.1|  Nop-domain-containing protein                    92.0    2e-17   
ref|XP_002186383.1|  predicted protein                                91.7    2e-17   
gb|EGT55440.1|  hypothetical protein CAEBREN_23703                    91.3    2e-17   
gb|EMG49250.1|  U3 snoRNP protein, putative                           90.5    2e-17   
ref|XP_005706848.1|  box C/D snoRNP component Nop56                   91.7    2e-17   
gb|EHB14403.1|  Cytochrome P450 4F22                                  92.4    2e-17   
ref|XP_003665025.1|  hypothetical protein MYCTH_2308306               91.7    2e-17   
ref|XP_008087967.1|  Nop                                              91.7    2e-17   
emb|CEI88169.1|  Putative Nucleolar protein 5A                        88.6    2e-17   
gb|ACY66544.1|  Nop56-like protein                                    85.1    2e-17   
ref|XP_001545409.1|  hypothetical protein BC1G_16079                  89.4    2e-17   
ref|XP_001904386.1|  hypothetical protein                             91.3    2e-17   
gb|KHN77449.1|  putative NOP5 family protein K07C5.4                  87.8    3e-17   
gb|KIL66800.1|  hypothetical protein M378DRAFT_9857                   91.3    3e-17   
ref|XP_005645633.1|  Nop-domain-containing protein                    91.3    3e-17   
ref|XP_007270791.1|  Nop-domain-containing protein                    91.3    3e-17   
emb|CCD43379.1|  similar to pre-rRNA processing nucleolar protein...  89.7    4e-17   
gb|KGQ03303.1|  Nucleolar protein 56                                  90.9    4e-17   
ref|XP_461822.2|  DEHA2G06314p                                        88.2    4e-17   
ref|XP_008602627.1|  NOSIC domain-containing protein                  90.9    4e-17   
dbj|GAC95110.1|  hypothetical protein PHSY_002685                     90.9    4e-17   
ref|XP_001586795.1|  hypothetical protein SS1G_11824                  89.4    4e-17   
ref|NP_595368.1|  U3 snoRNP protein Nop56 (predicted)                 90.5    4e-17   
gb|KDR83033.1|  hypothetical protein GALMADRAFT_238789                90.9    4e-17   
ref|XP_003101512.1|  hypothetical protein CRE_12866                   90.5    4e-17   
gb|ETS59786.1|  hypothetical protein PaG_06313                        90.5    4e-17   
ref|XP_011392585.1|  putative snoRNP complex protein NOP56            90.5    5e-17   
gb|AAY34143.2|  Nop56p                                                89.7    5e-17   
emb|CBQ71505.1|  probable SIK1-involved in pre-rRNA processing        90.5    5e-17   
gb|KEP47080.1|  small nuclear ribonucleoprotein                       90.5    5e-17   
emb|CBJ48969.1|  conserved unknown protein                            90.5    5e-17   



>dbj|BAF95167.1| similar to putative preRNA processing ribonucleoprotein [Ipomoea 
nil]
Length=194

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -2

Query  816  WSYFFIllslvvllXKNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDF  637
            +   F    +     KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDF
Sbjct  26   YGLIFHSSFIGRASAKNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDF  85

Query  636  YDKGVAPRKNIDVMKAAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGK  457
            YDKGVAPRKNIDVM+AAIENFQSKDESMDVDTAPSPASTKKSKKKKSKAVEDGEPMEE  
Sbjct  86   YDKGVAPRKNIDVMRAAIENFQSKDESMDVDTAPSPASTKKSKKKKSKAVEDGEPMEEVN  145

Query  456  LDHTNGDASeepkkkkrkerkaeeEQNNTGAENAHVLNGT  337
            L         + +K++    ++    N  GAE AHVLNGT
Sbjct  146  L-IIQMVMHLKNQKRRNGRSESRRGANQPGAEXAHVLNGT  184


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  473  PWKKVNLIIQMVMHLKNQKRRNGRSEKQKRSKTTQEQKMHMF  348
            P ++VNLIIQMVMHLKNQKRRNGRSE ++ +     +  H+ 
Sbjct  140  PMEEVNLIIQMVMHLKNQKRRNGRSESRRGANQPGAEXAHVL  181



>ref|XP_006344769.1| PREDICTED: nucleolar protein 56-like [Solanum tuberosum]
Length=553

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASRLDCFLD +TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRMARYLANKCSIASRLDCFLDKSTTTFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDA  433
            AAIE  + KD  MDVD         K KK K   VE  +PM E K   TNGDA
Sbjct  426  AAIETVEDKDTEMDVD--ELSTKKSKKKKSKVDVVEYAQPMIEDKPLETNGDA  476



>ref|XP_004230313.1| PREDICTED: nucleolar protein 56-like [Solanum lycopersicum]
Length=553

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASRLDCFLD +TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRMARYLANKCSIASRLDCFLDKSTTTFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDA  433
            AAIE  + KD  MDVD         K KK K   VE  +PM E K   TNGDA
Sbjct  426  AAIETVEDKDTEMDVD--EPSTKKSKKKKSKVDVVEYAQPMIEDKPLETNGDA  476



>ref|XP_009598202.1| PREDICTED: nucleolar protein 56-like [Nicotiana tomentosiformis]
Length=545

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASRLDCFLD +TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRLDCFLDTSTTTFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDAS  430
            +AIE  + KD  MDVD   +  S KK  K +       +PM E K   TNGDAS
Sbjct  426  SAIETVEGKDTEMDVDEPSTKKSKKKKSKVEVVEY--AQPMIEDKPLVTNGDAS  477



>emb|CDP15007.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 90/116 (78%), Gaps = 3/116 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCFL+ NT +FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFLEKNTNAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDta--pspastkkskkkkskAVEDGEPMEEGKLDH-TNGDA  433
            AA+EN + K+  MDVD A         K KK K++  EDGE MEE K    TNGDA
Sbjct  426  AALENSEKKELEMDVDDAPDEPSVKKSKQKKSKAQGAEDGEAMEEDKTPAVTNGDA  481



>ref|XP_006440077.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
 gb|ESR53317.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
Length=554

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAEKNTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDAS  430
            AAIE+ ++ D  M      +     K KK KS+   DGEPM   K+  TNGDAS
Sbjct  426  AAIESTENNDTEMKEAATDTSGKKSKKKKSKSEIAVDGEPMSADKVAATNGDAS  479



>gb|KDO52602.1| hypothetical protein CISIN_1g0085712mg, partial [Citrus sinensis]
Length=484

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  297  RNKGRMARYLANKCSIASRIDCFAEKNTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  356

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDAS  430
            AAIE+ ++ D  M      +     K KK KS+   DGEPM   K+  TNGDAS
Sbjct  357  AAIESTENNDTEMKEAATDTSGKKSKKKKSKSEIAVDGEPMSVDKVAATNGDAS  410



>ref|XP_009782739.1| PREDICTED: nucleolar protein 56-like [Nicotiana sylvestris]
Length=547

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASRLDCFLD +TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRLDCFLDTSTTTFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE  + KD  MDVD
Sbjct  426  SAIETVKGKDTEMDVD  441



>ref|XP_006477001.1| PREDICTED: nucleolar protein 56-like isoform X2 [Citrus sinensis]
Length=553

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAEKNTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDAS  430
            AAIE+ ++ D  M      +     K KK KS+   DGEPM   K+  TNGDAS
Sbjct  426  AAIESTENNDTEMKEAATDTSGKKSKKKKSKSEIAVDGEPMSVDKVAATNGDAS  479



>gb|AAT95868.1| putative preRNA processing ribonucleoprotein [Brassica juncea]
Length=138

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  51   KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  110

Query  591  AAIENFQSKDE  559
              IEN Q+KDE
Sbjct  111  EVIENLQNKDE  121



>ref|XP_009359460.1| PREDICTED: nucleolar protein 56-like [Pyrus x bretschneideri]
Length=549

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF DN+TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADNSTTAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+ QSKD  M+ +
Sbjct  426  SAIESTQSKDTEMETE  441



>ref|XP_006440078.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
 gb|ESR53318.1| hypothetical protein CICLE_v10019526mg [Citrus clementina]
Length=562

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAEKNTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIEN--------FQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGD  436
            AAIE+        F + D  M      +     K KK KS+   DGEPM   K+  TNGD
Sbjct  426  AAIESTENNVITTFSNADTEMKEAATDTSGKKSKKKKSKSEIAVDGEPMSADKVAATNGD  485

Query  435  AS  430
            AS
Sbjct  486  AS  487



>ref|XP_009603298.1| PREDICTED: nucleolar protein 56-like [Nicotiana tomentosiformis]
Length=555

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMAR+LANKCSIASRLDCFLD +TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRMARFLANKCSIASRLDCFLDKSTTAFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGK-LDHTNGDA  433
            AAIE  + KD  +D     +     K KK K++  E G+PM+E K     NGDA
Sbjct  426  AAIETAEDKDMDVDEAANEASTKKSKKKKSKAEITEGGQPMDEDKPFVDRNGDA  479



>ref|XP_009767290.1| PREDICTED: nucleolar protein 56-like [Nicotiana sylvestris]
Length=554

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMAR+LANKCSIASRLDCFLD +TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRMARFLANKCSIASRLDCFLDKSTTAFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGK-LDHTNGDA  433
            AAIE  + KD  +D     +     K KK K++ +E G+PM+E K     NGDA
Sbjct  426  AAIETAEDKDMDVDEAANEASTKKTKKKKSKAEIMEGGQPMDEDKPFVDRNGDA  479



>ref|XP_007037933.1| Nucleolar protein NOP56 [Theobroma cacao]
 gb|EOY22434.1| Nucleolar protein NOP56 [Theobroma cacao]
Length=545

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D  TT FGEKLREQVEERL+FYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADKGTTVFGEKLREQVEERLEFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGK-LDHTNGDAS  430
            AAIE+ +SKD  ++++      ++ K  KK+    EDGE M E K    TNGDAS
Sbjct  426  AAIESTESKD--LEMEDTQPGEASVKKSKKRKSKTEDGEAMAEDKPAAATNGDAS  478



>ref|XP_006477000.1| PREDICTED: nucleolar protein 56-like isoform X1 [Citrus sinensis]
Length=561

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAEKNTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIEN--------FQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGD  436
            AAIE+        F + D  M      +     K KK KS+   DGEPM   K+  TNGD
Sbjct  426  AAIESTENNVITTFSNADTEMKEAATDTSGKKSKKKKSKSEIAVDGEPMSVDKVAATNGD  485

Query  435  AS  430
            AS
Sbjct  486  AS  487



>gb|KDO52603.1| hypothetical protein CISIN_1g0085712mg, partial [Citrus sinensis]
Length=492

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  297  RNKGRMARYLANKCSIASRIDCFAEKNTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  356

Query  591  AAIEN--------FQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGD  436
            AAIE+        F + D  M      +     K KK KS+   DGEPM   K+  TNGD
Sbjct  357  AAIESTENNVITTFSNADTEMKEAATDTSGKKSKKKKSKSEIAVDGEPMSVDKVAATNGD  416

Query  435  AS  430
            AS
Sbjct  417  AS  418



>gb|EYU23115.1| hypothetical protein MIMGU_mgv1a004585mg [Erythranthe guttata]
Length=518

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASRLDCFLD +TT++GEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRLDCFLDKSTTTYGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDV  547
            +AIE   +KDE+M +
Sbjct  426  SAIETADNKDETMVI  440



>ref|XP_008239441.1| PREDICTED: nucleolar protein 56-like [Prunus mume]
Length=552

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D++TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADSSTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIEN QSKD  M+ +
Sbjct  426  SAIENTQSKDTEMETE  441



>ref|XP_002283518.1| PREDICTED: nucleolar protein 56-like [Vitis vinifera]
Length=558

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF ++NTT FGEKLREQVEERL+FYDKG+APRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAESNTTVFGEKLREQVEERLEFYDKGIAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGK-LDHTNGDAS  430
            AAIE  Q+ D + D  T    A   K KK K +A EDGEPM E K    TNGDAS
Sbjct  426  AAIEITQNND-TEDKATTEPSAKKSKKKKSKVEAAEDGEPMVEDKPTAATNGDAS  479



>ref|XP_010102881.1| hypothetical protein L484_002679 [Morus notabilis]
 gb|EXB94318.1| hypothetical protein L484_002679 [Morus notabilis]
Length=547

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +N TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAENGTTAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ Q KD  M+ +
Sbjct  426  AAIESAQGKDAEMETE  441



>ref|XP_008392835.1| PREDICTED: nucleolar protein 56-like [Malus domestica]
Length=546

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  768  NKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMKA  589
            NKGRMARYLANKCSIASR+DCF D++TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK+
Sbjct  367  NKGRMARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLDFYDKGVAPRKNIDVMKS  426

Query  588  AIENFQSKDESMDVD  544
            AIE+ QSKD  M+ +
Sbjct  427  AIESTQSKDTEMETE  441



>ref|XP_008351745.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 56-like [Malus 
domestica]
Length=543

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -2

Query  768  NKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMKA  589
            NKGRMARYLANKCSIASR+DCF D++TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK+
Sbjct  364  NKGRMARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLDFYDKGVAPRKNIDVMKS  423

Query  588  AIENFQSKDESMDVD  544
            AIE+ QSKD  M+ +
Sbjct  424  AIESTQSKDTEMETE  438



>ref|XP_008374262.1| PREDICTED: nucleolar protein 56-like [Malus domestica]
Length=548

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D+++T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADSSSTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+ QSKD  M+ +
Sbjct  426  SAIESTQSKDTEMETE  441



>gb|KDP30943.1| hypothetical protein JCGZ_11319 [Jatropha curcas]
Length=556

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 104/146 (71%), Gaps = 2/146 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +  +T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSERGSTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVED-GEPMEEGKLD-HTNGDASeepk  418
            AAIE  Q  D  M+ +     ++ K  KKK      + GEPM E K    TNGDASE+ K
Sbjct  426  AAIEGSQKTDVEMETEEPAVHSAKKSKKKKSKSEAAEGGEPMAEDKPTVATNGDASEDAK  485

Query  417  kkkrkerkaeeEQNNTGAENAHVLNG  340
             +K+K+++  + +     EN++V+NG
Sbjct  486  SEKKKKKEKRKMEEEQAVENSNVVNG  511



>ref|XP_009346504.1| PREDICTED: nucleolar protein 56-like [Pyrus x bretschneideri]
Length=547

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D+++T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADSSSTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+ QSKD  M+ +
Sbjct  426  SAIESTQSKDTEMETE  441



>ref|XP_009336572.1| PREDICTED: nucleolar protein 56-like [Pyrus x bretschneideri]
Length=547

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D+++T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADSSSTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+ QSKD  M+ +
Sbjct  426  SAIESTQSKDTEMETE  441



>ref|XP_002511213.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF51815.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF DN TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSDNGTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++K++ M+ +
Sbjct  426  AAIESAENKEDDMETE  441



>gb|EYU23114.1| hypothetical protein MIMGU_mgv1a004585mg [Erythranthe guttata]
Length=519

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASRLDCFLD +TT++GEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRLDCFLDKSTTTYGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSK-DESMDV  547
            +AIE   +K DE+M +
Sbjct  426  SAIETADNKEDETMVI  441



>ref|XP_006374558.1| hypothetical protein POPTR_0015s10500g [Populus trichocarpa]
 gb|ERP52355.1| hypothetical protein POPTR_0015s10500g [Populus trichocarpa]
Length=553

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +N TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSENGTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++KD  M+ +
Sbjct  426  AAIESTENKDTDMETE  441



>emb|CDY42406.1| BnaA08g00080D [Brassica napus]
Length=519

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q+KDE
Sbjct  426  EVIENLQNKDE  436



>ref|XP_009106803.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
Length=519

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q+KDE
Sbjct  426  EVIENLQNKDE  436



>ref|XP_009124126.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
 emb|CDY63487.1| BnaAnng18930D [Brassica napus]
Length=521

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q+KDE
Sbjct  426  EVIENLQNKDE  436



>emb|CDY59117.1| BnaCnng34340D [Brassica napus]
Length=515

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q+KDE
Sbjct  426  EVIENLQNKDE  436



>emb|CDY10510.1| BnaC03g71040D [Brassica napus]
Length=513

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q+KDE
Sbjct  426  EVIENLQNKDE  436



>ref|XP_008464470.1| PREDICTED: nucleolar protein 56-like [Cucumis melo]
Length=552

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIA+R+DCF +++TT+FGEKLREQVEERLDFYDKG+APRKNIDVMK
Sbjct  367  RNKGRMARYLANKCSIATRIDCFAESSTTTFGEKLREQVEERLDFYDKGIAPRKNIDVMK  426

Query  591  AAIENFQSKDESMDVD  544
            AAIE+  +K  +MDV+
Sbjct  427  AAIESADNKATAMDVE  442



>ref|XP_006395291.1| hypothetical protein EUTSA_v10004082mg [Eutrema salsugineum]
 gb|ESQ32577.1| hypothetical protein EUTSA_v10004082mg [Eutrema salsugineum]
Length=491

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D+++T+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADSSSTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDESM  553
              +EN + KDE+M
Sbjct  426  EVLENLEKKDEAM  438



>ref|XP_011024058.1| PREDICTED: nucleolar protein 56-like [Populus euphratica]
Length=553

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +N TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSENGTTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++KD  M+ +
Sbjct  426  AAIESNENKDTDMETE  441



>ref|XP_004297546.1| PREDICTED: nucleolar protein 56-like [Fragaria vesca subsp. vesca]
Length=545

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D +TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADTSTTAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +A+E+ Q+K+  M+ +
Sbjct  426  SAMESTQNKESEMETE  441



>ref|XP_010248928.1| PREDICTED: nucleolar protein 56-like [Nelumbo nucifera]
Length=564

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NTT FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSEMNTTVFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
            AAIE+ Q+KD+
Sbjct  426  AAIESVQNKDD  436



>ref|XP_010037433.1| PREDICTED: nucleolar protein 56-like [Eucalyptus grandis]
 gb|KCW49154.1| hypothetical protein EUGRSUZ_K02739 [Eucalyptus grandis]
Length=555

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF ++ TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSESGTTAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMD  550
            AA+E+ Q+KD  M+
Sbjct  426  AALESTQNKDVEME  439



>ref|XP_004165830.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 56-like [Cucumis 
sativus]
Length=552

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIA+R+DCF +++TT+FGEKLREQVEERLDFYDKG+APRKNIDVMK
Sbjct  367  RNKGRMARYLANKCSIATRIDCFAESSTTTFGEKLREQVEERLDFYDKGIAPRKNIDVMK  426

Query  591  AAIENFQSKDESMDVD  544
            AAIE+  +K   MDV+
Sbjct  427  AAIESADNKATDMDVE  442



>ref|XP_004138057.1| PREDICTED: nucleolar protein 56-like [Cucumis sativus]
 gb|KGN63494.1| hypothetical protein Csa_1G002140 [Cucumis sativus]
Length=552

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIA+R+DCF +++TT+FGEKLREQVEERLDFYDKG+APRKNIDVMK
Sbjct  367  RNKGRMARYLANKCSIATRIDCFAESSTTTFGEKLREQVEERLDFYDKGIAPRKNIDVMK  426

Query  591  AAIENFQSKDESMDVD  544
            AAIE+  +K   MDV+
Sbjct  427  AAIESADNKATDMDVE  442



>ref|XP_002318715.1| nucleolar family protein [Populus trichocarpa]
 gb|EEE96935.1| nucleolar family protein [Populus trichocarpa]
Length=540

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +++TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAESSTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI + ++KD +M+++
Sbjct  426  AAIGSAENKDTAMEIE  441



>ref|XP_006407288.1| hypothetical protein EUTSA_v10020558mg [Eutrema salsugineum]
 gb|ESQ48741.1| hypothetical protein EUTSA_v10020558mg [Eutrema salsugineum]
Length=504

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF DN+TT+FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADNSTTAFGDKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVLENLEKKDE  436



>ref|XP_010499575.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=498

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D++TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVLENLEKKDE  436



>gb|KJB40016.1| hypothetical protein B456_007G042300 [Gossypium raimondii]
Length=534

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  +T FGEKLREQVEERL+FYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCFSERGSTVFGEKLREQVEERLEFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+ Q+KD  M+V+
Sbjct  426  SAIESTQNKDTEMEVE  441



>ref|XP_007210566.1| hypothetical protein PRUPE_ppa003786mg [Prunus persica]
 gb|EMJ11765.1| hypothetical protein PRUPE_ppa003786mg [Prunus persica]
Length=549

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF D++TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFADSSTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKD  562
            +AIEN Q K+
Sbjct  426  SAIENTQIKE  435



>ref|NP_187892.2| NOP56-like pre RNA processing ribonucleoprotein [Arabidopsis 
thaliana]
 dbj|BAB02430.1| nucleolar protein [Arabidopsis thaliana]
 gb|AEE75254.1| NOP56-like pre RNA processing ribonucleoprotein [Arabidopsis 
thaliana]
Length=499

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCSIASR+DCF DN+TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARFLANKCSIASRIDCFSDNSTTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVLENLEKKDE  436



>ref|XP_003525694.1| PREDICTED: nucleolar protein 56-like isoform 1 [Glycine max]
Length=550

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FGEKLREQVEERLDFYDKGVAPRKNIDVM+
Sbjct  366  KNKGRMARYLANKCSIASRIDCFAERGTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMQ  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++KD  M+ +
Sbjct  426  AAIESAENKDTEMETE  441



>dbj|BAE98741.1| putative nucleolar protein [Arabidopsis thaliana]
Length=465

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCSIASR+DCF DN+TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARFLANKCSIASRIDCFSDNSTTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVLENLEKKDE  436



>gb|KHN34404.1| Nucleolar protein 56 [Glycine soja]
Length=550

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FGEKLREQVEERLDFYDKGVAPRKNIDVM+
Sbjct  366  KNKGRMARYLANKCSIASRIDCFAERGTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMQ  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++KD  M+ +
Sbjct  426  AAIESAENKDTEMETE  441



>ref|XP_011044181.1| PREDICTED: nucleolar protein 56-like isoform X1 [Populus euphratica]
Length=547

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF ++ TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSESGTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI + ++KD +M+V+
Sbjct  426  AAIGSAENKDTAMEVE  441



>ref|XP_011044182.1| PREDICTED: nucleolar protein 56-like isoform X2 [Populus euphratica]
Length=503

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF ++ TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  322  RNKGRMARYLANKCSIASRIDCFSESGTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  381

Query  591  AAIENFQSKDESMDVD  544
            AAI + ++KD +M+V+
Sbjct  382  AAIGSAENKDTAMEVE  397



>ref|XP_010250780.1| PREDICTED: nucleolar protein 56-like [Nelumbo nucifera]
Length=554

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + NT  FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSEMNTNIFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKD-ESMD  550
            AAIE+ Q+KD E MD
Sbjct  426  AAIESTQTKDGEKMD  440



>ref|XP_011083862.1| PREDICTED: nucleolar protein 56-like [Sesamum indicum]
Length=521

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCFL+ NTT+FGEKLR+QVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFLEKNTTAFGEKLRQQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDE  559
            +AIE+   K++
Sbjct  426  SAIESVDGKED  436



>gb|KJB08032.1| hypothetical protein B456_001G060200 [Gossypium raimondii]
Length=533

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FGEKLREQVEERL+FYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCFAERGTTVFGEKLREQVEERLEFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMD  550
            +AIE  Q+KD  M+
Sbjct  426  SAIETTQNKDVEME  439



>gb|KHG28458.1| Nucleolar 56 [Gossypium arboreum]
Length=533

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FGEKLREQVEERL+FYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCFAERGTTVFGEKLREQVEERLEFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMD  550
            +AIE  Q+KD  M+
Sbjct  426  SAIETTQNKDVEME  439



>ref|XP_006392564.1| hypothetical protein EUTSA_v10011387mg [Eutrema salsugineum]
 gb|ESQ29850.1| hypothetical protein EUTSA_v10011387mg [Eutrema salsugineum]
Length=526

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q+K E
Sbjct  426  EVIENLQNKGE  436



>ref|XP_010465064.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=498

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D++TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVLENLEKKDE  436



>ref|XP_002894559.1| hypothetical protein ARALYDRAFT_474678 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70818.1| hypothetical protein ARALYDRAFT_474678 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q +DE
Sbjct  426  EVIENLQKQDE  436



>gb|KHN44630.1| Nucleolar protein 56 [Glycine soja]
Length=552

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF +  TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFSERGTTTFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAV-EDGEPMEEGKL-DHTNGDA  433
            +AIE+ +++  +M+ +     +  K  KKK   +V +DG+ M   K+ + TNGDA
Sbjct  426  SAIESVETEYTAMETEAPVEVSGKKAKKKKHKASVTDDGDNMAVDKITETTNGDA  480



>ref|XP_003549846.1| PREDICTED: nucleolar protein 56-like [Glycine max]
Length=549

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FG+KLREQVEERLDFYDKGVAPRKNIDVM+
Sbjct  366  KNKGRMARYLANKCSIASRIDCFSEKGTTVFGQKLREQVEERLDFYDKGVAPRKNIDVMQ  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++KD  M+ +
Sbjct  426  AAIESAENKDTEMETE  441



>gb|KHN14092.1| Nucleolar protein 56 [Glycine soja]
Length=549

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FG+KLREQVEERLDFYDKGVAPRKNIDVM+
Sbjct  366  KNKGRMARYLANKCSIASRIDCFSEKGTTVFGQKLREQVEERLDFYDKGVAPRKNIDVMQ  425

Query  591  AAIENFQSKDESMDVD  544
            AAIE+ ++KD  M+ +
Sbjct  426  AAIESAENKDTEMETE  441



>emb|CDY57300.1| BnaC03g73340D [Brassica napus]
Length=505

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D++TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVMENLEKKDE  436



>emb|CDX82572.1| BnaA03g32490D [Brassica napus]
Length=505

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D++TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVMENLEKKDE  436



>ref|XP_009135254.1| PREDICTED: nucleolar protein 56-like [Brassica rapa]
Length=505

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D++TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADSSTTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVMENLEKKDE  436



>ref|XP_002882791.1| hypothetical protein ARALYDRAFT_478647 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59050.1| hypothetical protein ARALYDRAFT_478647 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCSIASR+DCF D++TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARFLANKCSIASRIDCFSDSSTTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVMENLEKKDE  436



>gb|ACJ85565.1| unknown [Medicago truncatula]
Length=524

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +  T++FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSEKGTSAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+  +KD  M+ +
Sbjct  426  SAIESVDNKDTEMETE  441



>ref|XP_003608861.1| Nucleolar protein [Medicago truncatula]
 gb|ACJ85727.1| unknown [Medicago truncatula]
 gb|AES91058.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
 gb|AFK48590.1| unknown [Medicago truncatula]
Length=524

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +  T++FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSEKGTSAFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+  +KD  M+ +
Sbjct  426  SAIESVDNKDTEMETE  441



>ref|XP_002322238.2| nucleolar family protein [Populus trichocarpa]
 gb|EEF06365.2| nucleolar family protein [Populus trichocarpa]
Length=499

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +N TT FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSENGTTVFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSK  565
            AAIE+ ++K
Sbjct  426  AAIESTENK  434



>emb|CDY52879.1| BnaCnng23670D [Brassica napus]
Length=323

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCS+ASR+DCF D++TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  183  KNKGRIARYLANKCSVASRIDCFADSSTTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  242

Query  591  AAIENFQSKDE  559
              +E+ + KDE
Sbjct  243  EVLESLEKKDE  253



>gb|KFK35536.1| hypothetical protein AALP_AA4G003300 [Arabis alpina]
Length=508

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCS+ASR+DCF DN TT++GEKL+EQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARFLANKCSMASRIDCFADNATTAYGEKLKEQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDESM  553
              +E+ Q+KDE M
Sbjct  426  EVLESLQNKDEEM  438



>emb|CAA10127.1| nucleolar protein [Cicer arietinum]
Length=454

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +N +T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  295  KNKGRMARYLANKCSIASRIDCFSENGSTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  354

Query  591  AAIENFQSKDESMDVD  544
            +AIE   +KD  M+ +
Sbjct  355  SAIEIADNKDTEMETE  370



>ref|XP_004515826.1| PREDICTED: nucleolar protein 56-like [Cicer arietinum]
Length=525

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +N +T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCFSENGSTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE   +KD  M+ +
Sbjct  426  SAIEIADNKDTEMETE  441



>emb|CBI15634.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF ++NTT FGEKLREQVEERL+FYDKG+APRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFAESNTTVFGEKLREQVEERLEFYDKGIAPRKNIDVMK  425

Query  591  AAIENFQSKD  562
            AAIE  Q+ D
Sbjct  426  AAIEITQNND  435



>ref|XP_010480175.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=528

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q  D+
Sbjct  426  EVIENLQKNDD  436



>ref|XP_010501245.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=521

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q  D+
Sbjct  426  EVIENLQKNDD  436



>ref|XP_010480123.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
 ref|XP_010480124.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=528

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q  D+
Sbjct  426  EVIENLQKNDD  436



>gb|AFK46206.1| unknown [Medicago truncatula]
Length=524

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF +  T++FGEKLREQVEERLDFYDKG APRKNIDVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFSEKGTSAFGEKLREQVEERLDFYDKGAAPRKNIDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+  +KD  M+ +
Sbjct  426  SAIESVDNKDTEMETE  441



>ref|XP_010462480.1| PREDICTED: nucleolar protein 56-like [Camelina sativa]
Length=521

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN Q  D+
Sbjct  426  EVIENLQKNDD  436



>gb|KHG15507.1| Nucleolar 56 [Gossypium arboreum]
Length=534

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  +T FGEKLREQVEERL+FYDKGVAPRKNIDVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCFSERGSTVFGEKLREQVEERLEFYDKGVAPRKNIDVMK  425

Query  591  AAIENFQSKD  562
            +AIE+ Q+KD
Sbjct  426  SAIESTQNKD  435



>gb|EYU43055.1| hypothetical protein MIMGU_mgv1a004561mg [Erythranthe guttata]
Length=520

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF+D +TT FG+KLREQVEERLDFYDKGVAPRKNID+MK
Sbjct  366  RNKGRMARYLANKCSIASRIDCFMDKSTTVFGDKLREQVEERLDFYDKGVAPRKNIDMMK  425

Query  591  AAIENFQSKD  562
            +AIE    KD
Sbjct  426  SAIETADGKD  435



>gb|KFK38628.1| hypothetical protein AALP_AA3G138900 [Arabis alpina]
Length=489

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCS+ASR+DCF DN+TT+FGEKL+EQVEERLDFYDKGVAPRKN+DVMK
Sbjct  352  KNKGRIARFLANKCSMASRIDCFADNSTTAFGEKLKEQVEERLDFYDKGVAPRKNVDVMK  411

Query  591  AAIENFQSKDE  559
              +E+ + KDE
Sbjct  412  EVLESLEKKDE  422



>ref|XP_007155528.1| hypothetical protein PHAVU_003G209500g [Phaseolus vulgaris]
 gb|ESW27522.1| hypothetical protein PHAVU_003G209500g [Phaseolus vulgaris]
Length=553

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DCF +  TT FGEKLREQVEERLDFYDKGVAPRKN+DVM+
Sbjct  366  KNKGRMARYLANKCSIASRIDCFSEKGTTVFGEKLREQVEERLDFYDKGVAPRKNLDVMQ  425

Query  591  AAIENFQSKDESMDVD  544
            +AIE+ +++D  M+ +
Sbjct  426  SAIESAENQDTEMETE  441



>ref|XP_010677900.1| PREDICTED: nucleolar protein 56-like [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DCF + N+T FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  363  RNKGRMARYLANKCSIASRIDCFTEKNSTIFGEKLREQVEERLDFYDKGVAPRKNIDVMK  422

Query  591  AAIENFQ  571
            AAIE  Q
Sbjct  423  AAIEVSQ  429



>ref|XP_006588283.1| PREDICTED: nucleolar protein 56-like [Glycine max]
Length=478

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKG +ARYLANKCSIAS +DCF +  TT+FGEKLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  293  KNKGPIARYLANKCSIASLIDCFSERGTTTFGEKLREQVEERLDFYDKGVAPRKNIDVMK  352

Query  591  AAIENFQSKDESMDVD  544
             AIE+ ++KD +M+++
Sbjct  353  LAIESVENKDTAMEIE  368



>ref|NP_176007.1| nucleolar protein NOP56-like protein [Arabidopsis thaliana]
 gb|AAF02835.1|AC009894_6 nucleolar protein [Arabidopsis thaliana]
 gb|AAG40838.1|AF302492_1 NOP56-like protein [Arabidopsis thaliana]
 gb|AAK62596.1| At1g56110/T6H22_9 [Arabidopsis thaliana]
 gb|AAM26718.1| At1g56110/T6H22_9 [Arabidopsis thaliana]
 gb|AAM64641.1| SAR DNA binding protein, putative [Arabidopsis thaliana]
 gb|AEE33345.1| nucleolar protein NOP56-like protein [Arabidopsis thaliana]
Length=522

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              IEN + ++E
Sbjct  426  EVIENLKQEEE  436



>ref|XP_008796174.1| PREDICTED: nucleolar protein 56-like isoform X2 [Phoenix dactylifera]
Length=559

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 4/116 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR+ARYLANKCSIASR+DCF + NT+ FGEKLREQVEERLDFYDKG+APRKN+DVMK
Sbjct  366  RNKGRLARYLANKCSIASRIDCFSEMNTSIFGEKLREQVEERLDFYDKGIAPRKNVDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDH--TNGDAS  430
             AIE+  S+D   D        + K  KKK      +GEPM+E K     T+GDAS
Sbjct  426  GAIESIGSQD--ADDGQKDEAFAKKSKKKKSKGDAVNGEPMDEDKPTELVTDGDAS  479



>ref|XP_010938674.1| PREDICTED: nucleolar protein 56-like [Elaeis guineensis]
Length=559

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR+ARYLANKCSIASR+DCF + NT+ FG KLREQVEERLDFYDKG+APRKN+DVMK
Sbjct  366  RNKGRLARYLANKCSIASRIDCFSETNTSIFGAKLREQVEERLDFYDKGIAPRKNVDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHT--NGDAS  430
            AAIE+  S+D   D       +  K  KKK      +GEPM+E K      +GDAS
Sbjct  426  AAIESIGSQD--ADDGQKDEASVKKSKKKKSKGEAVNGEPMDEDKPTEVAADGDAS  479



>ref|XP_010543116.1| PREDICTED: nucleolar protein 56-like [Tarenaya hassleriana]
Length=538

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF +  TT+FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFAERGTTAFGEKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDE  559
              +E  Q K E
Sbjct  426  EVLETLQDKGE  436



>dbj|BAH20197.1| AT1G56110 [Arabidopsis thaliana]
Length=432

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQ  571
              IEN +
Sbjct  426  EVIENLK  432



>ref|XP_010921864.1| PREDICTED: nucleolar protein 56-like [Elaeis guineensis]
Length=559

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR+ARYLANKCSIASR+DCF + NT+ FG KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRLARYLANKCSIASRIDCFSEMNTSIFGVKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGK  457
            AA+E+  S+  + DV      +  K  KKK    V +GEPM+E K
Sbjct  426  AAVESMVSQ-LTDDVPKKDEASVKKSKKKKSKGEVVNGEPMDEDK  469



>ref|XP_008796173.1| PREDICTED: nucleolar protein 56-like isoform X1 [Phoenix dactylifera]
Length=577

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR+ARYLANKCSIASR+DCF + NT+ FGEKLREQVEERLDFYDKG+APRKN+DVMK
Sbjct  366  RNKGRLARYLANKCSIASRIDCFSEMNTSIFGEKLREQVEERLDFYDKGIAPRKNVDVMK  425

Query  591  AAIENFQSKD  562
             AIE+  S+D
Sbjct  426  GAIESIGSQD  435



>ref|XP_006307187.1| hypothetical protein CARUB_v10008778mg, partial [Capsella rubella]
 gb|EOA40085.1| hypothetical protein CARUB_v10008778mg, partial [Capsella rubella]
Length=544

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCSIASR+DCF D  TT+FGEKLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  388  KNKGRIARFLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKNVDVMK  447

Query  591  AAIENFQSKDE  559
              I+N Q  D+
Sbjct  448  EVIDNLQKNDD  458



>ref|XP_002461161.1| hypothetical protein SORBIDRAFT_02g042030 [Sorghum bicolor]
 gb|EER97682.1| hypothetical protein SORBIDRAFT_02g042030 [Sorghum bicolor]
Length=565

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + NT+ FG+KLR+QVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSELNTSIFGQKLRDQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMD  550
            AAIE   +  E +D
Sbjct  426  AAIEGISAVSEDVD  439



>ref|XP_006297501.1| hypothetical protein CARUB_v10013523mg [Capsella rubella]
 gb|EOA30399.1| hypothetical protein CARUB_v10013523mg [Capsella rubella]
Length=497

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+AR+LANKCSIASR+DCF D+++T+FGEKL+EQVEERL+FYDKGVAPRK +DVMK
Sbjct  366  KNKGRIARFLANKCSIASRIDCFADSSSTAFGEKLKEQVEERLEFYDKGVAPRKTVDVMK  425

Query  591  AAIENFQSKDE  559
              +EN + KDE
Sbjct  426  EVMENLEKKDE  436



>ref|XP_006650085.1| PREDICTED: nucleolar protein 56-like [Oryza brachyantha]
Length=545

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D+ TT FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDSATTVFGQKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAI++ 
Sbjct  426  AAIDSM  431



>gb|EPS72848.1| hypothetical protein M569_01909, partial [Genlisea aurea]
Length=496

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYL+NKCSIASR+DCF+++N+ +FGEKLREQVEERL+FYDKGVAPRKNIDVM 
Sbjct  366  RNKGRMARYLSNKCSIASRIDCFMESNSNAFGEKLREQVEERLEFYDKGVAPRKNIDVML  425

Query  591  AAIENFQSKDES  556
            +A++  ++K+ S
Sbjct  426  SALKTIEAKESS  437



>gb|AFK36574.1| unknown [Lotus japonicus]
Length=546

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARY ANKCSIASR+DCF ++++T+FG KLREQVEERLDFYDKGVAPRKNIDVMK
Sbjct  367  KNKGRMARYPANKCSIASRIDCFSESSSTAFGLKLREQVEERLDFYDKGVAPRKNIDVMK  426

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHTNGDA  433
            +AIE+  + D  M+ +  P  AS+KKSKKK+  A ++G+ M   K   TNGDA
Sbjct  427  SAIESAANNDAEMETEEVPVEASSKKSKKKQKAA-DEGDEMAVDKPTVTNGDA  478



>ref|XP_009386842.1| PREDICTED: nucleolar protein 56-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF + NT+ FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFSEVNTSIFGQKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIEN  577
            AAIE+
Sbjct  426  AAIES  430



>gb|EMS66462.1| hypothetical protein TRIUR3_03326 [Triticum urartu]
Length=548

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDMSSSIFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIE  580
            AAIE
Sbjct  426  AAIE  429



>ref|XP_010534767.1| PREDICTED: nucleolar protein 56 [Tarenaya hassleriana]
Length=500

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR+ARYLANKCSIASR+DCF + +T +FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRIARYLANKCSIASRIDCFAERSTAAFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDE  559
              +E  Q++ E
Sbjct  426  DVLETLQNQGE  436



>ref|XP_003562510.1| PREDICTED: nucleolar protein 56-like [Brachypodium distachyon]
Length=534

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDLSSSIFGQKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQS  568
            AAIE   S
Sbjct  426  AAIEGMTS  433



>dbj|BAK00100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDMSSSIFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQS  568
            AAI+   S
Sbjct  426  AAIDGMTS  433



>gb|EMT17366.1| hypothetical protein F775_05055 [Aegilops tauschii]
Length=577

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  395  KNKGRMARYLANKCSIASRIDCYSDMSSSIFGEKLREQVEERLDFYDKGVAPRKNLDVMK  454

Query  591  AAIE  580
            AAIE
Sbjct  455  AAIE  458



>gb|EMS45652.1| hypothetical protein TRIUR3_03792 [Triticum urartu]
Length=469

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  296  KNKGRMARYLANKCSIASRIDCYSDMSSSIFGEKLREQVEERLDFYDKGVAPRKNLDVMK  355

Query  591  AAIENF  574
            AAI+  
Sbjct  356  AAIDGL  361



>ref|XP_003563386.1| PREDICTED: nucleolar protein 56-like [Brachypodium distachyon]
Length=547

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDLSSSIFGQKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIE  580
            AAIE
Sbjct  426  AAIE  429



>ref|XP_002465270.1| hypothetical protein SORBIDRAFT_01g035290 [Sorghum bicolor]
 gb|EER92268.1| hypothetical protein SORBIDRAFT_01g035290 [Sorghum bicolor]
Length=550

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVDtapspastkkskkkkskAVEDGEPMEEGKLDHT  445
            AAI++  + D SMD D   + AS KKSKKKK+KA  DG+ M+  K  H 
Sbjct  426  AAIDSMVN-DTSMDDDNHKTDASAKKSKKKKTKAEADGDAMDVDKPSHV  473



>dbj|BAK00655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDMSSSIFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAI+  
Sbjct  426  AAIDGL  431



>ref|XP_009399980.1| PREDICTED: nucleolar protein 56-like [Musa acuminata subsp. malaccensis]
Length=556

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR+ARYLANKCSIASR+DCF + NT+ FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRIARYLANKCSIASRIDCFSEVNTSVFGQKLREQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQS  568
             AIE+  S
Sbjct  426  VAIESVLS  433



>ref|XP_001766920.1| predicted protein [Physcomitrella patens]
 gb|EDQ68322.1| predicted protein, partial [Physcomitrella patens]
Length=478

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF + NT++FGEKLREQVEERL+FYDKG+APRKNIDVMK
Sbjct  364  KNKGRISRYLANKCSIASRIDCFSEVNTSAFGEKLREQVEERLEFYDKGIAPRKNIDVMK  423

Query  591  AAIEN  577
             AI+N
Sbjct  424  DAIKN  428



>gb|EMT05996.1| hypothetical protein F775_30288 [Aegilops tauschii]
Length=537

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ D +++ FGEKLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSDMSSSIFGEKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAI+  
Sbjct  426  AAIDGL  431



>ref|XP_008811770.1| PREDICTED: nucleolar protein 56-like [Phoenix dactylifera]
Length=559

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR+ARYLANKCSIA R+DCF + NT+ FGEKLR QVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  RNKGRLARYLANKCSIACRIDCFSEMNTSIFGEKLRGQVEERLDFYDKGVAPRKNVDVMK  425

Query  591  AAIENFQSK  565
            AA+EN  S+
Sbjct  426  AAVENMVSQ  434



>gb|EAY90010.1| hypothetical protein OsI_11580 [Oryza sativa Indica Group]
Length=552

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ ++ T  FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSESATAVFGQKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI++  + D + DVD
Sbjct  426  AAIDSMVN-DATNDVD  440



>ref|NP_001050122.1| Os03g0352300 [Oryza sativa Japonica Group]
 gb|ABF95947.1| Nucleolar protein Nop56, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12036.1| Os03g0352300 [Oryza sativa Japonica Group]
 gb|EAZ26922.1| hypothetical protein OsJ_10851 [Oryza sativa Japonica Group]
Length=552

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ ++ T  FG+KLREQVEERLDFYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSESATAVFGQKLREQVEERLDFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI++  + D + DVD
Sbjct  426  AAIDSMVN-DATNDVD  440



>tpg|DAA45392.1| TPA: hypothetical protein ZEAMMB73_921810 [Zea mays]
Length=376

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  197  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  256

Query  591  AAIENF  574
            AAI++ 
Sbjct  257  AAIDSM  262



>ref|XP_001754987.1| predicted protein [Physcomitrella patens]
 gb|EDQ80441.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF + NT++FGEKLREQVEERL+FYDKG+APRKNIDVMK
Sbjct  366  KNKGRISRYLANKCSIASRIDCFSEVNTSAFGEKLREQVEERLEFYDKGIAPRKNIDVMK  425

Query  591  AAIEN  577
             AI+N
Sbjct  426  DAIKN  430



>ref|XP_004958597.1| PREDICTED: nucleolar protein 56-like [Setaria italica]
Length=548

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGRMARYLANKCSIASR+DC+ + NT+ FG+KLREQVEERLDFYD GVAPRKN+DVMK
Sbjct  366  RNKGRMARYLANKCSIASRIDCYSELNTSIFGQKLREQVEERLDFYDNGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAIE  
Sbjct  426  AAIEGI  431



>gb|AFW88375.1| hypothetical protein ZEAMMB73_553591 [Zea mays]
Length=495

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI++  + D  MD D
Sbjct  426  AAIDSMVN-DTLMDDD  440



>ref|XP_008677944.1| PREDICTED: LOC100283975 isoform X1 [Zea mays]
 gb|ACR36205.1| unknown [Zea mays]
 tpg|DAA45393.1| TPA: nucleolar protein Nop56 [Zea mays]
Length=545

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAI++ 
Sbjct  426  AAIDSM  431



>ref|NP_001150345.1| LOC100283975 [Zea mays]
 gb|ACG38753.1| nucleolar protein Nop56 [Zea mays]
Length=544

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAI++ 
Sbjct  426  AAIDSM  431



>ref|XP_004984360.1| PREDICTED: nucleolar protein 56-like [Setaria italica]
Length=552

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENF  574
            AAI++ 
Sbjct  426  AAIDSM  431



>ref|XP_008660150.1| PREDICTED: nucleolar protein 56-like isoform X2 [Zea mays]
 gb|AFW88374.1| hypothetical protein ZEAMMB73_553591 [Zea mays]
Length=566

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI++  + D  MD D
Sbjct  426  AAIDSMVN-DTLMDDD  440



>ref|XP_008660149.1| PREDICTED: nucleolar protein 56-like isoform X1 [Zea mays]
 gb|AFW88376.1| hypothetical protein ZEAMMB73_553591 [Zea mays]
Length=569

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGRMARYLANKCSIASR+DC+ + +T+ FG+KLREQVEERL+FYDKGVAPRKN+DVMK
Sbjct  366  KNKGRMARYLANKCSIASRIDCYSEASTSVFGQKLREQVEERLEFYDKGVAPRKNLDVMK  425

Query  591  AAIENFQSKDESMDVD  544
            AAI++  + D  MD D
Sbjct  426  AAIDSMVN-DTLMDDD  440



>ref|XP_006845152.1| hypothetical protein AMTR_s00005p00226680 [Amborella trichopoda]
 gb|ERN06827.1| hypothetical protein AMTR_s00005p00226680 [Amborella trichopoda]
Length=556

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCF--LDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDV  598
            +NKGR+ARYLANKCSIASR+DCF  +D  T+ FGEKLREQVEERL+FYDKGVAPRKN+DV
Sbjct  366  RNKGRLARYLANKCSIASRIDCFSEMDTRTSVFGEKLREQVEERLEFYDKGVAPRKNVDV  425

Query  597  MKAAIENFQSK  565
            MK A+   +S+
Sbjct  426  MKEALNGTKSE  436



>ref|XP_002964924.1| hypothetical protein SELMODRAFT_167367 [Selaginella moellendorffii]
 ref|XP_002986505.1| hypothetical protein SELMODRAFT_124256 [Selaginella moellendorffii]
 gb|EFJ12362.1| hypothetical protein SELMODRAFT_124256 [Selaginella moellendorffii]
 gb|EFJ33762.1| hypothetical protein SELMODRAFT_167367 [Selaginella moellendorffii]
Length=513

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANK S+A+RLDC+L+ +T +FG+KL+EQVEERLDFYDKGVAPRKNIDVMK
Sbjct  375  KNKGRISRYLANKASLATRLDCYLETSTNAFGQKLKEQVEERLDFYDKGVAPRKNIDVMK  434

Query  591  AA  586
             A
Sbjct  435  LA  436



>gb|AFB34246.1| hypothetical protein CL3321Contig1_03, partial [Abies alba]
 gb|AFB34247.1| hypothetical protein CL3321Contig1_03, partial [Abies alba]
 gb|AFB34248.1| hypothetical protein CL3321Contig1_03, partial [Abies alba]
 gb|AFB34249.1| hypothetical protein CL3321Contig1_03, partial [Larix decidua]
Length=67

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNID  601
            +NKGR++RYLANKCSIASR+DCF + NT  FGEKLREQVEERL+FYDKG+APRKN+D
Sbjct  11   RNKGRISRYLANKCSIASRIDCFSEVNTNIFGEKLREQVEERLEFYDKGIAPRKNLD  67



>ref|XP_003058762.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57217.1| predicted protein [Micromonas pusilla CCMP1545]
Length=486

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF D  TT+FGEKL+EQVEERL+FYDKG AP+KNI +M+
Sbjct  366  RNKGRISRYLANKCSIASRIDCFSDFQTTAFGEKLKEQVEERLEFYDKGTAPKKNIAMMQ  425

Query  591  AAIE  580
            AA+E
Sbjct  426  AALE  429



>gb|AEW09033.1| hypothetical protein CL3321Contig1_03, partial [Pinus lambertiana]
 gb|AEW09034.1| hypothetical protein CL3321Contig1_03, partial [Pinus radiata]
 gb|AFB34250.1| hypothetical protein CL3321Contig1_03, partial [Pinus cembra]
 gb|AFB34251.1| hypothetical protein CL3321Contig1_03, partial [Pinus cembra]
 gb|AFB34252.1| hypothetical protein CL3321Contig1_03, partial [Pinus cembra]
 gb|AFB34253.1| hypothetical protein CL3321Contig1_03, partial [Pinus mugo]
 gb|AFG47448.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47449.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47450.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47451.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47452.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47453.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47454.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47455.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47456.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47457.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47458.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47459.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47460.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47461.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47462.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47463.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
 gb|AFG47464.1| hypothetical protein CL3321Contig1_03, partial [Pinus taeda]
Length=67

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNID  601
            +NKGR++RYLANKCSIASR+DCF + NT  FGEKLREQVEERL+FYDKG+APRKN+D
Sbjct  11   RNKGRISRYLANKCSIASRIDCFSEVNTNIFGEKLREQVEERLEFYDKGIAPRKNLD  67



>ref|XP_003080616.1| nucleolar protein Nop56, putative (ISS) [Ostreococcus tauri]
Length=187

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF D  TT FGEKL+EQVEERL FYDKG APRKNI +M+
Sbjct  80   RNKGRISRYLANKCSIASRIDCFSDFQTTLFGEKLKEQVEERLAFYDKGTAPRKNIAMMQ  139

Query  591  AAIENFQSKD  562
              I     +D
Sbjct  140  EVIAEIGPQD  149



>ref|XP_002114548.1| hypothetical protein TRIADDRAFT_28215 [Trichoplax adhaerens]
 gb|EDV22682.1| hypothetical protein TRIADDRAFT_28215, partial [Trichoplax adhaerens]
Length=543

 Score =   108 bits (269),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  ++ FG KLREQVE+RL FYD G AP+KN+DVM+
Sbjct  363  KNKGRISRYLANKCSIASRIDCFTETTSSVFGNKLREQVEDRLKFYDSGEAPKKNVDVMR  422

Query  591  AAIENFQSKDESMDV  547
             A++   S  ES D+
Sbjct  423  EALQEVSSLQESKDI  437


 Score = 28.9 bits (63),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = -1

Query  823  PSMVLFFHSSFIGRASXQKQ  764
            P   L FHSSFIGRAS + +
Sbjct  346  PKYGLLFHSSFIGRASKKNK  365



>ref|XP_001697006.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP00698.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=498

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF+D NT  FGEK+REQVEERL FY++GVAPRKN  VM 
Sbjct  365  RNKGRISRYLANKCSIASRIDCFMDGNTNVFGEKMREQVEERLRFYEEGVAPRKNASVMG  424

Query  591  AAIE  580
             A+E
Sbjct  425  EAME  428



>ref|XP_004469207.1| PREDICTED: nucleolar protein 56 isoform 3 [Dasypus novemcinctus]
Length=294

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  63   KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  122

Query  591  AAI  583
             A+
Sbjct  123  EAM  125



>emb|CEG01347.1| NOSIC [Ostreococcus tauri]
Length=473

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF D  TT FGEKL+EQVEERL FYDKG APRKNI +M+
Sbjct  366  RNKGRISRYLANKCSIASRIDCFSDFQTTLFGEKLKEQVEERLAFYDKGTAPRKNIAMMQ  425

Query  591  AAIENFQSKD  562
              I     +D
Sbjct  426  EVIAEIGPQD  435



>ref|XP_002502983.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64241.1| predicted protein [Micromonas sp. RCC299]
Length=617

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF D  T +FG+KL+EQVEERL+FYDKG APRKNI +M+
Sbjct  501  RNKGRISRYLANKCSIASRIDCFSDFQTDAFGQKLKEQVEERLEFYDKGTAPRKNIAMMQ  560

Query  591  AAIE  580
            AA+E
Sbjct  561  AALE  564



>ref|XP_002953396.1| hypothetical protein VOLCADRAFT_105910 [Volvox carteri f. nagariensis]
 gb|EFJ45369.1| hypothetical protein VOLCADRAFT_105910 [Volvox carteri f. nagariensis]
Length=503

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF+D  T  FGEK+REQVEERL FY++GVAPRKN +VM 
Sbjct  365  RNKGRISRYLANKCSIASRIDCFMDAATNVFGEKMREQVEERLRFYEEGVAPRKNANVMG  424

Query  591  AAIENFQSK  565
             A+E  +++
Sbjct  425  EAMEVLKTQ  433



>ref|XP_008119824.1| PREDICTED: nucleolar protein 56 [Anolis carolinensis]
Length=550

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKC+IASR+DCF +  T+ FGEKLREQVEERL FY+ G APRKN+DVMK
Sbjct  363  KNKGRISRYLANKCTIASRVDCFSEVPTSVFGEKLREQVEERLAFYETGQAPRKNLDVMK  422

Query  591  AAIE  580
             A+E
Sbjct  423  EAVE  426



>ref|XP_005828248.1| hypothetical protein GUITHDRAFT_74893 [Guillardia theta CCMP2712]
 gb|EKX41268.1| hypothetical protein GUITHDRAFT_74893 [Guillardia theta CCMP2712]
Length=483

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +   T FGEKL+EQVEERL FYD GVAPRKN+DVM+
Sbjct  368  KNKGRISRYLANKCSIASRIDCFSETPNTIFGEKLKEQVEERLAFYDTGVAPRKNLDVMR  427

Query  591  AAIE  580
             A++
Sbjct  428  DAMK  431



>ref|XP_007513547.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16072.1| predicted protein [Bathycoccus prasinos]
Length=481

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF D  T+ FGEKL+EQVEERL+FYDKG APR+N+ VM+
Sbjct  366  RNKGRISRYLANKCSIASRIDCFADVQTSLFGEKLKEQVEERLEFYDKGTAPRRNVAVMQ  425

Query  591  AAIE  580
              +E
Sbjct  426  EVVE  429



>gb|KDR23556.1| Nucleolar protein 56, partial [Zootermopsis nevadensis]
Length=436

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF D  T  FGEKLR+QVE+RL FY+ G  PRKNIDVMK
Sbjct  373  KNKGRISRYLANKCSIASRIDCFSDQMTNVFGEKLRQQVEDRLKFYETGEIPRKNIDVMK  432

Query  591  AAIE  580
             A+E
Sbjct  433  EAVE  436



>ref|XP_006874908.1| PREDICTED: nucleolar protein 56 [Chrysochloris asiatica]
Length=430

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAIENFQSKDESMDV  547
             A+   Q+++ ++++
Sbjct  257  EAM--VQAEEAAVEI  269



>ref|XP_003494005.1| PREDICTED: nucleolar protein 56-like [Bombus impatiens]
Length=493

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF D  T  FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  365  KNKGRISRYLANKCSIASRIDCFTDTPTKVFGEKLRQQVEDRLKFYETGEVPKKNIDVMK  424

Query  591  AAIENFQSKDESMD  550
             A+E       SM+
Sbjct  425  EALEEAAQVIASME  438



>ref|XP_004469206.1| PREDICTED: nucleolar protein 56 isoform 2 [Dasypus novemcinctus]
Length=428

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAI  583
             A+
Sbjct  257  EAM  259



>ref|XP_003393259.1| PREDICTED: nucleolar protein 56-like [Bombus terrestris]
Length=495

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF D  T  FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  365  KNKGRISRYLANKCSIASRIDCFTDTPTKVFGEKLRQQVEDRLKFYETGEVPKKNIDVMK  424

Query  591  AAIENFQSKDESMD  550
             A+E       SM+
Sbjct  425  EALEEAAQVIASME  438



>ref|XP_001748935.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86265.1| predicted protein [Monosiga brevicollis MX1]
Length=504

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF D+ T+ FGE+LR+QVEERL FY+ G  PRKN+DVM 
Sbjct  369  KNKGRISRYLANKCSIASRIDCFSDSLTSKFGEELRDQVEERLSFYETGATPRKNVDVMH  428

Query  591  AAIENFQS  568
              +E  +S
Sbjct  429  KVMEGLKS  436



>ref|XP_001110561.2| PREDICTED: nucleolar protein 56-like [Macaca mulatta]
Length=428

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAI  583
             A+
Sbjct  257  EAM  259



>ref|XP_011299290.1| PREDICTED: nucleolar protein 56 [Fopius arisanus]
Length=506

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF D  TT FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  365  KNKGRISRYLANKCSIASRIDCFTDIPTTVFGEKLRQQVEDRLKFYETGDIPKKNIDVMK  424

Query  591  AAIE  580
             A+E
Sbjct  425  EALE  428



>ref|XP_003773512.1| PREDICTED: nucleolar protein 56 [Sarcophilus harrisii]
Length=538

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  TT FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTTVFGEKLREQVEERLSFYETGDPPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAV  425



>ref|XP_007496986.1| PREDICTED: nucleolar protein 56 [Monodelphis domestica]
Length=538

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  TT FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTTVFGEKLREQVEERLSFYETGDPPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAV  425



>gb|EAX10585.1| nucleolar protein 5A (56kDa with KKE/D repeat), isoform CRA_b 
[Homo sapiens]
Length=428

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAI  583
             A+
Sbjct  257  EAM  259



>gb|AAX61126.1| XNop56 [Oreochromis mossambicus]
Length=116

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKC+IASR+DCF +  T+ FG+KLREQVEERL FY+ G  PRKN+DVMK
Sbjct  13   KNKGRISRYLANKCTIASRIDCFSELPTSVFGDKLREQVEERLSFYETGDVPRKNVDVMK  72

Query  591  AA  586
            ++
Sbjct  73   SS  74



>ref|XP_006187183.1| PREDICTED: nucleolar protein 56 [Camelus ferus]
Length=429

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAI  583
             A+
Sbjct  257  EAM  259



>ref|XP_006207381.1| PREDICTED: nucleolar protein 56 [Vicugna pacos]
Length=429

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAI  583
             A+
Sbjct  257  EAM  259



>dbj|BAK08040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKG+MARYLANKCSIASR+DC+ D +++  GEK+REQVEERLDF +KGVAP KN+ VMK
Sbjct  366  KNKGKMARYLANKCSIASRVDCYSDMSSSILGEKMREQVEERLDFLEKGVAPCKNLVVMK  425

Query  591  AAIE  580
            AA+E
Sbjct  426  AAVE  429



>ref|XP_006758084.1| PREDICTED: nucleolar protein 56 isoform X1 [Myotis davidii]
Length=594

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ GV PRKN++VMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGVIPRKNLEVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004469205.1| PREDICTED: nucleolar protein 56 isoform 1 [Dasypus novemcinctus]
Length=436

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  205  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  264

Query  591  AAI  583
             A+
Sbjct  265  EAM  267



>ref|XP_006096440.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 56 [Myotis 
lucifugus]
Length=594

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ GV PRKN++VMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGVIPRKNLEVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_008139230.1| PREDICTED: nucleolar protein 56 [Eptesicus fuscus]
Length=594

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ GV PRKN++VMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGVIPRKNLEVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_003251769.1| PREDICTED: nucleolar protein 56-like [Apis mellifera]
Length=468

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCS+ASR+DCF+D  T  FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  339  KNKGRISRYLANKCSLASRIDCFIDIPTNVFGEKLRQQVEDRLKFYETGEIPKKNIDVMK  398

Query  591  AAIENFQSKDESMD  550
             A+E       SM+
Sbjct  399  EALEEAAQVIASME  412



>gb|ELK34501.1| Nucleolar protein 56 [Myotis davidii]
Length=600

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ GV PRKN++VMK
Sbjct  369  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGVIPRKNLEVMK  428

Query  591  AAI  583
             A+
Sbjct  429  EAM  431



>ref|XP_005874824.1| PREDICTED: nucleolar protein 56, partial [Myotis brandtii]
Length=582

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ GV PRKN++VMK
Sbjct  351  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGVIPRKNLEVMK  410

Query  591  AAI  583
             A+
Sbjct  411  EAM  413



>gb|EPQ13011.1| Nucleolar protein 56 [Myotis brandtii]
Length=588

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ GV PRKN++VMK
Sbjct  357  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGVIPRKNLEVMK  416

Query  591  AAI  583
             A+
Sbjct  417  EAM  419



>gb|AAK93068.1| GM14238p [Drosophila melanogaster]
Length=246

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFL+  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  114  KNKGRISRFLANKCSIASRIDCFLEQPTSVFGETLKQQVEDRLKFYESGDVPRKNIEVMK  173

Query  591  AAIE  580
             AIE
Sbjct  174  EAIE  177



>gb|AAH02231.1| Nop56 protein, partial [Mus musculus]
Length=384

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  167  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  226



>ref|XP_011144657.1| PREDICTED: nucleolar protein 56-like, partial [Harpegnathos saltator]
Length=181

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            K+KGR++RYLANKCS+ASR+DCFLD  T  FGEKLR+QVE+RL F++ G  P+KNIDVMK
Sbjct  117  KDKGRISRYLANKCSMASRIDCFLDIPTNVFGEKLRQQVEDRLKFFETGEIPKKNIDVMK  176

Query  591  AAIE  580
             A+E
Sbjct  177  EALE  180



>gb|AAX13146.1| Nop56 [Drosophila pseudoobscura]
Length=424

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFLD  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  316  KNKGRISRFLANKCSIASRIDCFLDQPTSVFGESLKQQVEDRLKFYESGDVPRKNIEVMK  375

Query  591  AAIE  580
             AIE
Sbjct  376  EAIE  379



>dbj|BAM20699.1| hypothetical protein [Papilio polytes]
Length=292

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  TT +GEKLR+QVE+RL FY+ G  P KNIDVMK
Sbjct  197  KNKGRISRYLANKCSIASRIDCFSETQTTIYGEKLRQQVEDRLKFYETGDIPMKNIDVMK  256

Query  591  AAIENFQSKDE  559
             A+E    +++
Sbjct  257  QAMEEAMQQEQ  267



>gb|EFN81118.1| Nucleolar protein 5A [Harpegnathos saltator]
Length=183

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            K+KGR++RYLANKCS+ASR+DCFLD  T  FGEKLR+QVE+RL F++ G  P+KNIDVMK
Sbjct  118  KDKGRISRYLANKCSMASRIDCFLDIPTNVFGEKLRQQVEDRLKFFETGEIPKKNIDVMK  177

Query  591  AAIE  580
             A+E
Sbjct  178  EALE  181



>gb|EHB04280.1| Nucleolar protein 56, partial [Heterocephalus glaber]
Length=595

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAIENFQSKDESMDV  547
             A+   Q K+ + ++
Sbjct  423  EAV--VQVKEAAAEI  435



>ref|XP_005998724.1| PREDICTED: nucleolar protein 56 [Latimeria chalumnae]
Length=473

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKC+IASR+DCF +  T+ FG+KLREQVEERL FY+ G APRKN+DVMK
Sbjct  276  KNKGRISRYLANKCTIASRIDCFSEVPTSVFGDKLREQVEERLAFYETGEAPRKNLDVMK  335

Query  591  AAI  583
             A+
Sbjct  336  EAV  338



>gb|EHJ74314.1| putative nucleolar KKE/D repeat protein DmNOP56 [Danaus plexippus]
Length=457

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +N ++ FGEKLR+QVE+RL FY+ G  P KNIDVMK
Sbjct  364  KNKGRISRYLANKCSIASRIDCFSENLSSVFGEKLRQQVEDRLKFYETGDIPMKNIDVMK  423

Query  591  AAIENFQSKDES  556
             AIE    ++++
Sbjct  424  QAIEEITQQEDA  435



>ref|XP_011186011.1| PREDICTED: nucleolar protein 56 [Bactrocera cucurbitae]
Length=507

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFL+  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  364  KNKGRISRFLANKCSIASRIDCFLEKPTSVFGETLKQQVEDRLKFYESGEVPRKNIEVMK  423

Query  591  AAIENFQSKDES  556
             AIE  + +D S
Sbjct  424  EAIEAAEKEDNS  435



>gb|AAH18421.1| NOP56 protein, partial [Homo sapiens]
Length=447

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  359  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  418

Query  591  AAI  583
             A+
Sbjct  419  EAM  421



>ref|XP_001419274.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97567.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=471

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            +NKGR++RYLANKCSIASR+DCF D  TT FGEKL++QVEERL FYDKG APRKNI +M+
Sbjct  366  RNKGRISRYLANKCSIASRIDCFSDFQTTLFGEKLKDQVEERLAFYDKGTAPRKNIAMMQ  425

Query  591  AAI  583
              I
Sbjct  426  EVI  428



>gb|EDL25415.1| mCG51800 [Mus musculus]
Length=325

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  73   KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  132



>gb|AAX13147.1| Nop56 [Drosophila miranda]
Length=469

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFLD  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  351  KNKGRISRFLANKCSIASRIDCFLDQPTSVFGESLKQQVEDRLKFYESGDVPRKNIEVMK  410

Query  591  AAIE  580
             AIE
Sbjct  411  EAIE  414



>ref|XP_006616125.1| PREDICTED: nucleolar protein 56-like [Apis dorsata]
Length=494

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCS+ASR+DCF D  T  FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  365  KNKGRISRYLANKCSLASRIDCFTDTPTNVFGEKLRQQVEDRLKFYETGEIPKKNIDVMK  424

Query  591  AAIENFQSKDESMD  550
             A+E       SM+
Sbjct  425  EALEEAAQVIASME  438



>gb|ELV12810.1| Nucleolar protein 56, partial [Tupaia chinensis]
Length=540

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  309  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  368

Query  591  AAI  583
             A+
Sbjct  369  EAM  371



>ref|XP_003973642.1| PREDICTED: nucleolar protein 56-like [Takifugu rubripes]
Length=540

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKC+IASR+DCF +  T+ FG+KLREQVEERL FY+ G  PRKN+DVMK
Sbjct  366  KNKGRISRYLANKCTIASRIDCFSELPTSVFGDKLREQVEERLSFYETGAMPRKNVDVMK  425

Query  591  AAIE  580
             A++
Sbjct  426  EAVQ  429



>ref|XP_005855181.1| nucleolar protein 56 [Nannochloropsis gaditana CCMP526]
 gb|EKU21184.1| nucleolar protein 56 [Nannochloropsis gaditana CCMP526]
Length=310

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+D F +  TT +GEKL+EQVEERL FYD G APRKN+DVM 
Sbjct  197  KNKGRISRYLANKCSIASRIDTFAEEPTTRYGEKLKEQVEERLRFYDTGAAPRKNVDVMN  256

Query  591  A  589
            A
Sbjct  257  A  257



>ref|XP_004383061.1| PREDICTED: nucleolar protein 56 [Trichechus manatus latirostris]
Length=598

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAIENFQSKDESMDV  547
             A+   Q+++ ++++
Sbjct  423  EAM--VQAEEAAVEI  435



>ref|XP_010609331.1| PREDICTED: nucleolar protein 56 isoform X2 [Fukomys damarensis]
Length=478

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  QAM  425



>ref|XP_005568575.1| PREDICTED: nucleolar protein 56 isoform X2 [Macaca fascicularis]
 ref|XP_007960449.1| PREDICTED: nucleolar protein 56 isoform X3 [Chlorocebus sabaeus]
Length=478

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_008972994.1| PREDICTED: nucleolar protein 56 isoform X2 [Pan paniscus]
Length=478

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_007656687.1| PREDICTED: nucleolar protein 56 [Ornithorhynchus anatinus]
Length=499

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIA+R+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  327  KNKGRISRYLANKCSIAARIDCFSEVPTSVFGEKLREQVEERLSFYETGEPPRKNLDVMK  386

Query  591  AAI  583
             A+
Sbjct  387  EAV  389



>ref|XP_001358724.2| Nop56 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL27867.2| Nop56 [Drosophila pseudoobscura pseudoobscura]
Length=503

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFLD  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  364  KNKGRISRFLANKCSIASRIDCFLDQPTSVFGESLKQQVEDRLKFYESGDVPRKNIEVMK  423

Query  591  AAIE  580
             AIE
Sbjct  424  EAIE  427



>ref|XP_007958209.1| PREDICTED: nucleolar protein 56 isoform X2 [Orycteropus afer 
afer]
Length=596

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEVPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_007958208.1| PREDICTED: nucleolar protein 56 isoform X1 [Orycteropus afer 
afer]
Length=599

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEVPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_002013567.1| GL23339 [Drosophila persimilis]
 gb|EDW24553.1| GL23339 [Drosophila persimilis]
Length=500

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFLD  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  364  KNKGRISRFLANKCSIASRIDCFLDQPTSVFGESLKQQVEDRLKFYESGDVPRKNIEVMK  423

Query  591  AAIE  580
             AIE
Sbjct  424  EAIE  427



>gb|EWM24566.1| Pre-mRNA processing ribonucleoprotein, snoRNA-binding domain 
protein [Nannochloropsis gaditana]
Length=330

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+D F +  TT +GEKL+EQVEERL FYD G APRKN+DVM 
Sbjct  197  KNKGRISRYLANKCSIASRIDTFAEEPTTRYGEKLKEQVEERLRFYDTGAAPRKNVDVMN  256

Query  591  A  589
            A
Sbjct  257  A  257



>ref|XP_007960441.1| PREDICTED: nucleolar protein 56 isoform X2 [Chlorocebus sabaeus]
Length=548

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>emb|CAB92783.1| nucleolar protein [Drosophila subobscura]
Length=503

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFLD  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  364  KNKGRISRFLANKCSIASRIDCFLDQPTSVFGESLKQQVEDRLKFYESGDVPRKNIEVMK  423

Query  591  AAIE  580
             AIE
Sbjct  424  EAIE  427



>ref|XP_010609330.1| PREDICTED: nucleolar protein 56 isoform X1 [Fukomys damarensis]
Length=597

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  QAM  425



>ref|XP_003706024.1| PREDICTED: nucleolar protein 56 [Megachile rotundata]
Length=518

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF D  T  FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  387  KNKGRISRYLANKCSIASRIDCFTDIPTNIFGEKLRQQVEDRLKFYETGEIPKKNIDVMK  446

Query  591  AAIENFQSKDESMD  550
             A+E   +   SM+
Sbjct  447  EALEEAANVIASME  460



>ref|XP_006984579.1| PREDICTED: nucleolar protein 56 isoform X2 [Peromyscus maniculatus 
bairdii]
Length=477

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_007960434.1| PREDICTED: nucleolar protein 56 isoform X1 [Chlorocebus sabaeus]
Length=594

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_003821337.1| PREDICTED: nucleolar protein 56 isoform X1 [Pan paniscus]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|NP_001231603.1| nucleolar protein 56 [Pan troglodytes]
 dbj|BAK62924.1| nucleolar protein Nop56 [Pan troglodytes]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>dbj|BAJ21047.1| NOP56 ribonucleoprotein homolog [synthetic construct]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|NP_001271483.1| nucleolar protein 56 [Macaca fascicularis]
 ref|XP_003905026.1| PREDICTED: nucleolar protein 56 [Papio anubis]
 sp|Q95K50.1|NOP56_MACFA RecName: Full=Nucleolar protein 56; AltName: Full=Nucleolar protein 
5A [Macaca fascicularis]
 dbj|BAB62217.1| hypothetical protein [Macaca fascicularis]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_003695473.1| PREDICTED: nucleolar protein 56 [Apis florea]
Length=456

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCS+ASR+DCF D  T  FGEKLR+QVE+RL FY+ G  P+KNIDVMK
Sbjct  365  KNKGRISRYLANKCSLASRIDCFTDIPTNVFGEKLRQQVEDRLKFYETGEIPKKNIDVMK  424

Query  591  AAIENFQSKDESMD  550
             A+E       SM+
Sbjct  425  EALEEAAQVIASME  438



>emb|CAA72789.1| hNop56 [Homo sapiens]
Length=602

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  369  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  428

Query  591  AAI  583
             A+
Sbjct  429  EAM  431



>ref|XP_004585734.1| PREDICTED: nucleolar protein 56 [Ochotona princeps]
Length=596

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|NP_006383.2| nucleolar protein 56 [Homo sapiens]
 sp|O00567.4|NOP56_HUMAN RecName: Full=Nucleolar protein 56; AltName: Full=Nucleolar protein 
5A [Homo sapiens]
 gb|AAI04792.1| NOP56 ribonucleoprotein homolog (yeast) [Homo sapiens]
 gb|AAI04794.1| NOP56 ribonucleoprotein homolog (yeast) [Homo sapiens]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004061753.1| PREDICTED: nucleolar protein 56 [Gorilla gorilla gorilla]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>gb|EAX10587.1| nucleolar protein 5A (56kDa with KKE/D repeat), isoform CRA_d 
[Homo sapiens]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_011212587.1| PREDICTED: nucleolar protein 56 [Bactrocera dorsalis]
Length=507

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKCSIASR+DCFL+  T+ FGE L++QVE+RL FY+ G  PRKNI+VMK
Sbjct  364  KNKGRISRFLANKCSIASRIDCFLEKPTSVFGETLKQQVEDRLKFYESGEVPRKNIEVMK  423

Query  591  AAIENFQSKDE  559
             AIE  + +D+
Sbjct  424  EAIEAAEKEDK  434



>gb|EHH19861.1| Nucleolar protein 5A, partial [Macaca mulatta]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>gb|EAX10589.1| nucleolar protein 5A (56kDa with KKE/D repeat), isoform CRA_f 
[Homo sapiens]
Length=601

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>dbj|BAF85410.1| unnamed protein product [Homo sapiens]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_002287003.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED96644.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=530

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIA+R+D F D  ++++G+KLREQVEERL FY+ G APRKNIDVM+
Sbjct  394  KNKGRISRYLANKCSIATRIDSFADEPSSAYGQKLREQVEERLKFYETGAAPRKNIDVME  453

Query  591  AAIENFQ----SKDESMDV  547
                + +    ++DE+MDV
Sbjct  454  EVARHLKAGKDAEDEAMDV  472



>gb|EFB15471.1| hypothetical protein PANDA_007374 [Ailuropoda melanoleuca]
Length=597

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEMPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_010377311.1| PREDICTED: nucleolar protein 56 [Rhinopithecus roxellana]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_008254455.1| PREDICTED: nucleolar protein 56 [Oryctolagus cuniculus]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_006163996.1| PREDICTED: nucleolar protein 56 [Tupaia chinensis]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|NP_001125816.1| nucleolar protein 56 [Pongo abelii]
 sp|Q5RA29.1|NOP56_PONAB RecName: Full=Nucleolar protein 56; AltName: Full=Nucleolar protein 
5A [Pongo abelii]
 emb|CAH91381.1| hypothetical protein [Pongo abelii]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_003273471.1| PREDICTED: nucleolar protein 56 [Nomascus leucogenys]
Length=594

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004634291.1| PREDICTED: nucleolar protein 56 [Octodon degus]
Length=598

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004687397.1| PREDICTED: nucleolar protein 56 [Condylura cristata]
Length=594

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_006984578.1| PREDICTED: nucleolar protein 56 isoform X1 [Peromyscus maniculatus 
bairdii]
Length=591

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_011367718.1| PREDICTED: nucleolar protein 56 isoform X2 [Pteropus vampyrus]
Length=494

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G+ PRKN+ VMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGIFPRKNLQVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_007635385.1| PREDICTED: nucleolar protein 56 [Cricetulus griseus]
 ref|XP_007636105.1| PREDICTED: nucleolar protein 56 [Cricetulus griseus]
 gb|EGV92443.1| Nucleolar protein 56 [Cricetulus griseus]
Length=592

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_005893993.1| PREDICTED: nucleolar protein 56 [Bos mutus]
Length=596

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004014434.1| PREDICTED: nucleolar protein 56 [Ovis aries]
Length=596

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_005974822.1| PREDICTED: nucleolar protein 56 [Pantholops hodgsonii]
Length=596

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_010834818.1| PREDICTED: nucleolar protein 56 [Bison bison bison]
 tpg|DAA23145.1| TPA: nucleolar protein 56 [Bos taurus]
Length=596

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_010589876.1| PREDICTED: nucleolar protein 56 [Loxodonta africana]
Length=599

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAIENFQSKDESMDV  547
             A+   Q+++ ++++
Sbjct  423  EAM--VQAEEVAVEI  435



>ref|XP_010986588.1| PREDICTED: nucleolar protein 56 [Camelus dromedarius]
Length=595

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|NP_001028794.1| nucleolar protein 56 [Bos taurus]
 sp|Q3SZ63.1|NOP56_BOVIN RecName: Full=Nucleolar protein 56; AltName: Full=Nucleolar protein 
5A [Bos taurus]
 gb|AAI03115.1| NOP56 ribonucleoprotein homolog (yeast) [Bos taurus]
Length=596

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004433888.1| PREDICTED: nucleolar protein 56 isoform 2 [Ceratotherium simum 
simum]
Length=598

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>gb|ERE69819.1| nucleolar protein 56 [Cricetulus griseus]
Length=600

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  371  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  430

Query  591  AAI  583
             A+
Sbjct  431  EAM  433



>ref|XP_008587878.1| PREDICTED: nucleolar protein 56 [Galeopterus variegatus]
Length=596

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_003476468.2| PREDICTED: nucleolar protein 56 [Cavia porcellus]
Length=626

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  391  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  450

Query  591  AAI  583
             A+
Sbjct  451  EAM  453



>ref|XP_010971089.1| PREDICTED: nucleolar protein 56 [Camelus bactrianus]
Length=595

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_008505981.1| PREDICTED: nucleolar protein 56 [Equus przewalskii]
Length=598

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_007127210.1| PREDICTED: nucleolar protein 56 isoform X1 [Physeter catodon]
Length=594

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_007195878.1| PREDICTED: nucleolar protein 56 [Balaenoptera acutorostrata scammoni]
Length=596

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004285382.1| PREDICTED: nucleolar protein 56 [Orcinus orca]
Length=595

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_005068672.1| PREDICTED: nucleolar protein 56 [Mesocricetus auratus]
Length=590

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004318042.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 56 [Tursiops 
truncatus]
Length=598

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_011367711.1| PREDICTED: nucleolar protein 56 isoform X1 [Pteropus vampyrus]
Length=595

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G+ PRKN+ VMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGIFPRKNLQVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>gb|EAX10584.1| nucleolar protein 5A (56kDa with KKE/D repeat), isoform CRA_a 
[Homo sapiens]
Length=654

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  423  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  482

Query  591  AAIENFQSKDESMDV  547
             A+   Q K+ + ++
Sbjct  483  EAM--VQVKEAAAEI  495



>ref|XP_006921729.1| PREDICTED: nucleolar protein 56 [Pteropus alecto]
Length=595

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G+ PRKN+ VMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGIFPRKNLQVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_004433887.1| PREDICTED: nucleolar protein 56 isoform 1 [Ceratotherium simum 
simum]
Length=603

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  368  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  427

Query  591  AAI  583
             A+
Sbjct  428  EAM  430



>ref|XP_007465444.1| PREDICTED: nucleolar protein 56 [Lipotes vexillifer]
Length=595

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  363  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  422

Query  591  AAI  583
             A+
Sbjct  423  EAM  425



>ref|XP_005604787.1| PREDICTED: nucleolar protein 56 [Equus caballus]
Length=619

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  384  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  443

Query  591  AAI  583
             A+
Sbjct  444  EAM  446



>gb|ELK04028.1| Nucleolar protein 56 [Pteropus alecto]
Length=615

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIASR+DCF +  T+ FGEKLREQVEERL FY+ G+ PRKN+ VMK
Sbjct  383  KNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGIFPRKNLQVMK  442

Query  591  AAI  583
             A+
Sbjct  443  EAM  445



>ref|XP_005688279.1| PREDICTED: nucleolar protein 56 [Capra hircus]
Length=430

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++RYLANKCSIA R+DCF +  T+ FGEKLREQVEERL FY+ G  PRKN+DVMK
Sbjct  197  KNKGRISRYLANKCSIALRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMK  256

Query  591  AAI  583
             A+
Sbjct  257  EAM  259



>gb|KFB36904.1| AGAP002063-PA-like protein [Anopheles sinensis]
Length=521

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  771  KNKGRMARYLANKCSIASRLDCFLDNNTTSFGEKLREQVEERLDFYDKGVAPRKNIDVMK  592
            KNKGR++R+LANKC+IASR+DCF +  T  FGE L++QVE+RL FY+ G  PRKN+DVMK
Sbjct  361  KNKGRISRFLANKCTIASRIDCFTETPTQVFGEALKQQVEDRLKFYESGAVPRKNLDVMK  420

Query  591  AAIENFQSK  565
             AIE  QS+
Sbjct  421  EAIEVVQSE  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1686516490435