BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052I12

Length=936
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786426.1|  PREDICTED: uncharacterized protein LOC104234...    407   1e-132   Nicotiana sylvestris
ref|XP_009628236.1|  PREDICTED: uncharacterized protein LOC104118...    401   9e-131   Nicotiana tomentosiformis
ref|XP_006341679.1|  PREDICTED: uncharacterized protein LOC102589286    392   8e-127   Solanum tuberosum [potatoes]
ref|XP_004235711.1|  PREDICTED: uncharacterized protein LOC101250783    389   7e-126   Solanum lycopersicum
ref|XP_011072341.1|  PREDICTED: uncharacterized protein LOC105157620    351   4e-111   Sesamum indicum [beniseed]
ref|XP_002279674.1|  PREDICTED: uncharacterized protein LOC100241173    338   1e-106   Vitis vinifera
emb|CDO98057.1|  unnamed protein product                                338   2e-106   Coffea canephora [robusta coffee]
ref|XP_002304191.2|  hypothetical protein POPTR_0003s05360g             318   1e-104   
ref|XP_010545713.1|  PREDICTED: uncharacterized protein LOC104817994    334   8e-104   Tarenaya hassleriana [spider flower]
gb|KHN32609.1|  hypothetical protein glysoja_022291                     327   3e-103   Glycine soja [wild soybean]
ref|XP_002299694.2|  hypothetical protein POPTR_0001s18130g             327   1e-102   Populus trichocarpa [western balsam poplar]
gb|KHG04451.1|  Monodehydroascorbate reductase, fruit isozyme           328   2e-102   Gossypium arboreum [tree cotton]
ref|XP_010098052.1|  hypothetical protein L484_026183                   328   2e-102   Morus notabilis
ref|XP_003542101.1|  PREDICTED: uncharacterized protein LOC100791852    327   4e-102   Glycine max [soybeans]
gb|EYU21542.1|  hypothetical protein MIMGU_mgv1a001881mg                325   3e-101   Erythranthe guttata [common monkey flower]
ref|XP_011001614.1|  PREDICTED: uncharacterized protein LOC105108845    322   1e-100   Populus euphratica
gb|AAK96499.1|  At1g52320/F19K6_7                                       313   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465528.1|  PREDICTED: uncharacterized protein LOC102613887    322   2e-100   Citrus sinensis [apfelsine]
ref|XP_006427010.1|  hypothetical protein CICLE_v10024988mg             321   1e-99    Citrus clementina [clementine]
ref|NP_001117469.1|  uncharacterized protein                            313   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|KHM98761.1|  hypothetical protein glysoja_030814                     317   2e-99    Glycine soja [wild soybean]
ref|XP_011026550.1|  PREDICTED: uncharacterized protein LOC105127120    320   2e-99    Populus euphratica
ref|XP_004305292.1|  PREDICTED: uncharacterized protein LOC101294200    318   1e-98    Fragaria vesca subsp. vesca
gb|KHN10238.1|  hypothetical protein glysoja_017842                     312   2e-98    Glycine soja [wild soybean]
ref|XP_004486732.1|  PREDICTED: uncharacterized protein LOC101506...    317   4e-98    Cicer arietinum [garbanzo]
ref|XP_006392932.1|  hypothetical protein EUTSA_v10011250mg             317   1e-97    Eutrema salsugineum [saltwater cress]
gb|KFK35788.1|  hypothetical protein AALP_AA4G036700                    316   2e-97    Arabis alpina [alpine rockcress]
ref|XP_003603595.1|  hypothetical protein MTR_3g109450                  313   3e-97    Medicago truncatula
ref|XP_002308623.2|  hypothetical protein POPTR_0006s26050g             315   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_002324252.2|  hypothetical protein POPTR_0018s00880g             314   5e-97    Populus trichocarpa [western balsam poplar]
emb|CDY52975.1|  BnaA06g01600D                                          314   5e-97    Brassica napus [oilseed rape]
ref|XP_003523728.1|  PREDICTED: formin-like protein 8-like              312   9e-97    Glycine max [soybeans]
ref|XP_007150659.1|  hypothetical protein PHAVU_005G170800g             313   9e-97    Phaseolus vulgaris [French bean]
ref|XP_007012028.1|  Golgin subfamily A member 4                        313   1e-96    
ref|XP_009147692.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    314   1e-96    Brassica rapa
ref|XP_002281782.1|  PREDICTED: uncharacterized protein LOC100259547    311   2e-96    Vitis vinifera
ref|XP_002516584.1|  conserved hypothetical protein                     311   3e-96    Ricinus communis
ref|XP_011007598.1|  PREDICTED: uncharacterized protein LOC105113217    310   3e-96    Populus euphratica
gb|KHN18210.1|  hypothetical protein glysoja_025100                     308   4e-96    Glycine soja [wild soybean]
emb|CDY61085.1|  BnaC06g41130D                                          311   5e-96    Brassica napus [oilseed rape]
ref|NP_849796.2|  uncharacterized protein                               312   7e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019684.1|  PREDICTED: uncharacterized protein LOC105122326    311   7e-96    Populus euphratica
dbj|BAF00450.1|  putative bZIP protein                                  312   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251918.1|  PREDICTED: uncharacterized protein LOC104593650    310   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008362706.1|  PREDICTED: uncharacterized protein LOC103426...    310   1e-95    
ref|XP_010462070.1|  PREDICTED: uncharacterized protein LOC104742736    311   1e-95    Camelina sativa [gold-of-pleasure]
gb|KJB54879.1|  hypothetical protein B456_009G052500                    309   2e-95    Gossypium raimondii
ref|XP_002891687.1|  hypothetical protein ARALYDRAFT_474348             311   3e-95    
ref|XP_003527819.1|  PREDICTED: uncharacterized protein LOC100807597    308   4e-95    Glycine max [soybeans]
ref|XP_003597769.1|  hypothetical protein MTR_2g102050                  309   4e-95    Medicago truncatula
ref|XP_007024146.1|  Uncharacterized protein isoform 1                  308   6e-95    
gb|KDO51231.1|  hypothetical protein CISIN_1g044677mg                   293   6e-95    Citrus sinensis [apfelsine]
ref|XP_010942485.1|  PREDICTED: uncharacterized protein LOC105060463    307   1e-94    
ref|XP_004292865.1|  PREDICTED: uncharacterized protein LOC101308445    306   2e-94    Fragaria vesca subsp. vesca
ref|XP_010479738.1|  PREDICTED: kinesin-related protein 4-like          308   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_007137162.1|  hypothetical protein PHAVU_009G105100g             306   2e-94    Phaseolus vulgaris [French bean]
ref|XP_010500831.1|  PREDICTED: uncharacterized protein LOC104778154    308   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_008447501.1|  PREDICTED: uncharacterized protein LOC103489933    305   1e-93    Cucumis melo [Oriental melon]
gb|KJB13152.1|  hypothetical protein B456_002G059600                    305   1e-93    Gossypium raimondii
ref|XP_006306796.1|  hypothetical protein CARUB_v10008333mg             306   2e-93    Capsella rubella
gb|KDP34224.1|  hypothetical protein JCGZ_07795                         303   6e-93    Jatropha curcas
ref|XP_004172478.1|  PREDICTED: uncharacterized protein LOC101231290    302   6e-93    
ref|XP_004150356.1|  PREDICTED: uncharacterized protein LOC101203914    302   1e-92    Cucumis sativus [cucumbers]
gb|KJB65700.1|  hypothetical protein B456_010G109200                    302   1e-92    Gossypium raimondii
ref|XP_006356661.1|  PREDICTED: uncharacterized protein LOC102596799    302   1e-92    
ref|XP_009383699.1|  PREDICTED: uncharacterized protein LOC103971407    302   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938806.1|  PREDICTED: uncharacterized protein LOC105057803    300   2e-92    
ref|XP_007024149.1|  Uncharacterized protein isoform 4                  301   4e-92    
ref|XP_008362707.1|  PREDICTED: uncharacterized protein LOC103426...    300   5e-92    
ref|XP_004245249.1|  PREDICTED: uncharacterized protein LOC101255018    300   5e-92    Solanum lycopersicum
ref|XP_009799127.1|  PREDICTED: uncharacterized protein LOC104245243    300   6e-92    Nicotiana sylvestris
ref|XP_004150357.1|  PREDICTED: uncharacterized protein LOC101204163    300   6e-92    
ref|XP_004169923.1|  PREDICTED: uncharacterized LOC101204163            300   7e-92    
ref|XP_007225191.1|  hypothetical protein PRUPE_ppa002131mg             300   7e-92    Prunus persica
gb|KGN58062.1|  hypothetical protein Csa_3G481220                       300   7e-92    Cucumis sativus [cucumbers]
emb|CBI36151.3|  unnamed protein product                                294   1e-91    Vitis vinifera
ref|XP_010049074.1|  PREDICTED: uncharacterized protein LOC104437750    297   1e-91    
ref|XP_008220000.1|  PREDICTED: uncharacterized protein LOC103320143    298   4e-91    Prunus mume [ume]
ref|XP_009368022.1|  PREDICTED: uncharacterized protein LOC103957563    297   5e-91    Pyrus x bretschneideri [bai li]
ref|XP_009338711.1|  PREDICTED: uncharacterized protein LOC103931028    297   5e-91    Pyrus x bretschneideri [bai li]
gb|KCW81524.1|  hypothetical protein EUGRSUZ_C02885                     297   1e-90    Eucalyptus grandis [rose gum]
emb|CDX88193.1|  BnaA06g27840D                                          297   1e-90    
ref|XP_009151092.1|  PREDICTED: uncharacterized protein LOC103874418    297   1e-90    Brassica rapa
ref|XP_008228519.1|  PREDICTED: uncharacterized protein LOC103327921    291   2e-90    Prunus mume [ume]
ref|XP_009616206.1|  PREDICTED: uncharacterized protein LOC104108786    296   2e-90    Nicotiana tomentosiformis
ref|XP_010691307.1|  PREDICTED: uncharacterized protein LOC104904665    297   2e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008462152.1|  PREDICTED: uncharacterized protein LOC103500575    295   4e-90    Cucumis melo [Oriental melon]
ref|XP_004141776.1|  PREDICTED: uncharacterized protein LOC101222402    294   8e-90    Cucumis sativus [cucumbers]
ref|XP_004501198.1|  PREDICTED: uncharacterized protein LOC101510604    294   8e-90    
ref|XP_008378117.1|  PREDICTED: uncharacterized protein LOC103441188    294   1e-89    
ref|XP_002516075.1|  conserved hypothetical protein                     293   2e-89    Ricinus communis
ref|XP_010667633.1|  PREDICTED: uncharacterized protein LOC104884...    292   4e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008393906.1|  PREDICTED: uncharacterized protein LOC103456054    292   5e-89    
ref|XP_010112163.1|  hypothetical protein L484_019902                   294   7e-89    
ref|XP_008776462.1|  PREDICTED: uncharacterized protein LOC103696569    281   3e-88    
ref|XP_009345256.1|  PREDICTED: uncharacterized protein LOC103937065    290   3e-88    
emb|CDP18480.1|  unnamed protein product                                290   4e-88    Coffea canephora [robusta coffee]
ref|XP_011089542.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    289   1e-87    
ref|XP_008775372.1|  PREDICTED: uncharacterized protein LOC103695745    283   3e-87    Phoenix dactylifera
emb|CDX80528.1|  BnaC07g29160D                                          287   6e-87    
gb|KDO79698.1|  hypothetical protein CISIN_1g004600mg                   287   7e-87    Citrus sinensis [apfelsine]
ref|XP_006450611.1|  hypothetical protein CICLE_v10007564mg             287   7e-87    Citrus clementina [clementine]
ref|XP_006476157.1|  PREDICTED: myosin-9-like                           287   7e-87    Citrus sinensis [apfelsine]
gb|KDP37214.1|  hypothetical protein JCGZ_06270                         287   8e-87    Jatropha curcas
ref|XP_008342705.1|  PREDICTED: uncharacterized protein LOC103405477    287   8e-87    
emb|CAN72109.1|  hypothetical protein VITISV_044047                     286   1e-86    Vitis vinifera
ref|XP_008447502.1|  PREDICTED: uncharacterized protein LOC103489935    286   2e-86    Cucumis melo [Oriental melon]
ref|XP_008799874.1|  PREDICTED: uncharacterized protein LOC103714416    281   3e-86    Phoenix dactylifera
emb|CDX87081.1|  BnaC09g03960D                                          278   2e-85    
ref|XP_010931963.1|  PREDICTED: uncharacterized protein LOC105052734    282   5e-85    Elaeis guineensis
ref|XP_010907260.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    280   4e-84    
ref|XP_008808244.1|  PREDICTED: uncharacterized protein LOC103720359    279   7e-84    Phoenix dactylifera
ref|XP_010519919.1|  PREDICTED: uncharacterized protein LOC104799211    279   1e-83    Tarenaya hassleriana [spider flower]
gb|EPS57690.1|  hypothetical protein M569_17127                         263   4e-83    Genlisea aurea
gb|EMT28812.1|  hypothetical protein F775_16807                         262   3e-80    
gb|KFK27812.1|  hypothetical protein AALP_AA8G433100                    269   7e-80    Arabis alpina [alpine rockcress]
gb|EYU29268.1|  hypothetical protein MIMGU_mgv1a002196mg                266   4e-79    Erythranthe guttata [common monkey flower]
gb|EMS56206.1|  hypothetical protein TRIUR3_11325                       259   1e-78    Triticum urartu
ref|XP_006658396.1|  PREDICTED: uncharacterized protein LOC102701368    258   1e-78    
ref|XP_006655291.1|  PREDICTED: uncharacterized protein LOC102706661    257   3e-77    
ref|XP_009393120.1|  PREDICTED: uncharacterized protein LOC103978894    259   1e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394813.1|  hypothetical protein EUTSA_v10003682mg             260   1e-76    Eutrema salsugineum [saltwater cress]
ref|XP_002874269.1|  hypothetical protein ARALYDRAFT_910621             260   2e-76    
ref|NP_197941.1|  uncharacterized protein                               259   4e-76    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96225.1|  predicted protein                                      258   7e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006287097.1|  hypothetical protein CARUB_v10000261mg             257   4e-75    Capsella rubella
ref|XP_010421422.1|  PREDICTED: DNA ligase 1-like isoform X3            257   4e-75    Camelina sativa [gold-of-pleasure]
ref|XP_010228227.1|  PREDICTED: formin-like protein 5                   256   4e-75    
ref|XP_010421421.1|  PREDICTED: DNA ligase 1-like isoform X2            256   6e-75    Camelina sativa [gold-of-pleasure]
ref|XP_010421420.1|  PREDICTED: DNA ligase 1-like isoform X1            256   6e-75    Camelina sativa [gold-of-pleasure]
gb|EEE63626.1|  hypothetical protein OsJ_18443                          254   6e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EEE66795.1|  hypothetical protein OsJ_23540                          251   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010454904.1|  PREDICTED: ABC transporter F family member 4...    256   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010493822.1|  PREDICTED: DNA ligase 1-like                       255   2e-74    Camelina sativa [gold-of-pleasure]
gb|EEC79170.1|  hypothetical protein OsI_19854                          253   2e-74    Oryza sativa Indica Group [Indian rice]
emb|CDM83169.1|  unnamed protein product                                246   3e-74    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006826988.1|  hypothetical protein AMTR_s00010p00207960          253   3e-74    Amborella trichopoda
gb|EAZ03209.1|  hypothetical protein OsI_25359                          251   3e-74    Oryza sativa Indica Group [Indian rice]
gb|AAT93897.1|  unknown protein                                         254   9e-74    Oryza sativa Japonica Group [Japonica rice]
dbj|BAC16409.1|  putative bZIP protein                                  251   3e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EMT10854.1|  hypothetical protein F775_26145                         247   2e-72    
gb|EMT20964.1|  hypothetical protein F775_31339                         236   2e-72    
ref|XP_010254134.1|  PREDICTED: uncharacterized protein LOC104595215    248   3e-72    Nelumbo nucifera [Indian lotus]
dbj|BAJ96409.1|  predicted protein                                      248   5e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63249.1|  hypothetical protein TRIUR3_24469                       235   6e-72    Triticum urartu
ref|XP_010033880.1|  PREDICTED: uncharacterized protein LOC104423116    247   7e-72    Eucalyptus grandis [rose gum]
gb|EMS61963.1|  hypothetical protein TRIUR3_31953                       245   2e-71    Triticum urartu
emb|CDM82883.1|  unnamed protein product                                246   4e-71    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003568507.1|  PREDICTED: ras and Rab interactor 3                244   1e-70    Brachypodium distachyon [annual false brome]
dbj|BAJ94711.1|  predicted protein                                      243   5e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010249762.1|  PREDICTED: uncharacterized protein LOC104592...    239   4e-69    Nelumbo nucifera [Indian lotus]
ref|XP_002439756.1|  hypothetical protein SORBIDRAFT_09g019490          241   5e-69    
ref|XP_002457866.1|  hypothetical protein SORBIDRAFT_03g017350          228   5e-69    
emb|CBI20923.3|  unnamed protein product                                232   8e-69    Vitis vinifera
ref|NP_001169630.1|  hypothetical protein                               239   1e-68    Zea mays [maize]
ref|XP_010667640.1|  PREDICTED: uncharacterized protein LOC104884...    236   3e-68    
ref|NP_001172370.1|  Os01g0500550                                       238   3e-68    
gb|EEC70709.1|  hypothetical protein OsI_02082                          238   4e-68    Oryza sativa Indica Group [Indian rice]
ref|NP_001168451.1|  uncharacterized protein LOC100382224               235   1e-67    Zea mays [maize]
gb|AFW82165.1|  hypothetical protein ZEAMMB73_214762                    235   5e-67    
ref|XP_004968820.1|  PREDICTED: uncharacterized protein LOC101757982    234   9e-67    Setaria italica
ref|XP_004506851.1|  PREDICTED: uncharacterized protein LOC101489547    230   9e-67    Cicer arietinum [garbanzo]
ref|XP_003567735.1|  PREDICTED: uncharacterized protein LOC100824905    233   2e-66    Brachypodium distachyon [annual false brome]
ref|XP_010249763.1|  PREDICTED: uncharacterized protein LOC104592...    229   1e-65    
ref|XP_008652191.1|  PREDICTED: uncharacterized protein LOC103632124    230   2e-65    Zea mays [maize]
gb|EPS58005.1|  hypothetical protein M569_16812                         216   1e-64    Genlisea aurea
ref|XP_006644200.1|  PREDICTED: uncharacterized protein LOC102708565    228   2e-64    
ref|XP_004955806.1|  PREDICTED: uncharacterized protein LOC101763037    227   2e-64    
ref|XP_009398982.1|  PREDICTED: uncharacterized protein LOC103983491    227   2e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461680.1|  hypothetical protein SORBIDRAFT_02g006420          226   8e-64    Sorghum bicolor [broomcorn]
ref|XP_003604444.1|  hypothetical protein MTR_4g012430                  201   2e-56    
ref|XP_010479739.1|  PREDICTED: uncharacterized protein LOC104758551    199   1e-54    Camelina sativa [gold-of-pleasure]
gb|ABR18011.1|  unknown                                                 197   8e-54    Picea sitchensis
gb|AES86641.2|  BZIP protein                                            191   2e-52    Medicago truncatula
ref|XP_008352156.1|  PREDICTED: uncharacterized protein LOC103415623    184   1e-50    
ref|XP_009786427.1|  PREDICTED: uncharacterized protein LOC104234...    174   1e-45    Nicotiana sylvestris
ref|XP_009628246.1|  PREDICTED: uncharacterized protein LOC104118...    166   5e-43    
ref|XP_009391172.1|  PREDICTED: ras and EF-hand domain-containing...    139   1e-32    
ref|XP_010941314.1|  PREDICTED: uncharacterized protein LOC105059637    137   1e-32    Elaeis guineensis
gb|KHN00204.1|  hypothetical protein glysoja_034735                     134   4e-32    Glycine soja [wild soybean]
ref|XP_007134473.1|  hypothetical protein PHAVU_010G050100g             136   6e-32    Phaseolus vulgaris [French bean]
ref|XP_011093240.1|  PREDICTED: uncharacterized protein LOC105173250    135   1e-31    Sesamum indicum [beniseed]
ref|XP_011099873.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    133   2e-31    
ref|XP_010113322.1|  hypothetical protein L484_026653                   133   4e-31    Morus notabilis
ref|XP_010935104.1|  PREDICTED: uncharacterized protein LOC105055091    132   5e-31    
gb|ABK95129.1|  unknown                                                 124   6e-31    Populus trichocarpa [western balsam poplar]
ref|XP_006576720.1|  PREDICTED: uncharacterized protein LOC100792843    133   6e-31    Glycine max [soybeans]
ref|XP_007204230.1|  hypothetical protein PRUPE_ppa002657mg             132   8e-31    
ref|XP_007139641.1|  hypothetical protein PHAVU_008G046800g             133   9e-31    Phaseolus vulgaris [French bean]
ref|XP_004492935.1|  PREDICTED: uncharacterized protein LOC101510124    132   2e-30    Cicer arietinum [garbanzo]
ref|XP_006425413.1|  hypothetical protein CICLE_v10025182mg             130   3e-30    Citrus clementina [clementine]
ref|XP_006466986.1|  PREDICTED: uncharacterized protein LOC102630487    130   3e-30    Citrus sinensis [apfelsine]
gb|EYU30808.1|  hypothetical protein MIMGU_mgv1a0195871mg               124   8e-30    Erythranthe guttata [common monkey flower]
ref|XP_004166130.1|  PREDICTED: uncharacterized LOC101224117            124   8e-30    
ref|NP_171713.2|  uncharacterized protein                               129   1e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459782.1|  PREDICTED: uncharacterized protein LOC103498813    130   1e-29    Cucumis melo [Oriental melon]
ref|XP_006464424.1|  PREDICTED: uncharacterized protein LOC102627291    129   1e-29    
gb|KDO85511.1|  hypothetical protein CISIN_1g040600mg                   129   1e-29    Citrus sinensis [apfelsine]
ref|NP_001190052.1|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1    129   1e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426683.1|  PREDICTED: uncharacterized protein LOC104711...    129   1e-29    Camelina sativa [gold-of-pleasure]
ref|XP_010426682.1|  PREDICTED: uncharacterized protein LOC104711...    129   1e-29    Camelina sativa [gold-of-pleasure]
ref|XP_010679893.1|  PREDICTED: uncharacterized protein LOC104895159    129   1e-29    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH23438.1|  BZIP transcription factor bZIP80                        129   1e-29    Medicago truncatula
ref|XP_006445430.1|  hypothetical protein CICLE_v10018930mg             129   1e-29    Citrus clementina [clementine]
ref|XP_010503820.1|  PREDICTED: uncharacterized protein LOC104780964    128   2e-29    Camelina sativa [gold-of-pleasure]
ref|XP_010515532.1|  PREDICTED: uncharacterized protein LOC104791366    128   2e-29    Camelina sativa [gold-of-pleasure]
gb|KJB22870.1|  hypothetical protein B456_004G070400                    129   2e-29    Gossypium raimondii
ref|XP_008365863.1|  PREDICTED: uncharacterized protein LOC103429493    129   2e-29    
ref|XP_010919721.1|  PREDICTED: uncharacterized protein LOC105043738    129   2e-29    Elaeis guineensis
ref|XP_006837374.1|  hypothetical protein AMTR_s00111p00120840          129   2e-29    
ref|XP_006306896.1|  hypothetical protein CARUB_v10008455mg             128   2e-29    
emb|CDX73734.1|  BnaC08g22690D                                          127   3e-29    
ref|XP_010258777.1|  PREDICTED: uncharacterized protein LOC104598423    128   3e-29    Nelumbo nucifera [Indian lotus]
gb|KGN46505.1|  hypothetical protein Csa_6G104620                       128   3e-29    Cucumis sativus [cucumbers]
ref|XP_004515356.1|  PREDICTED: uncharacterized protein LOC101490151    128   4e-29    Cicer arietinum [garbanzo]
emb|CDP09433.1|  unnamed protein product                                128   4e-29    Coffea canephora [robusta coffee]
ref|XP_009379364.1|  PREDICTED: uncharacterized protein LOC103967785    127   4e-29    Pyrus x bretschneideri [bai li]
ref|XP_006290733.1|  hypothetical protein CARUB_v10016827mg             127   4e-29    Capsella rubella
ref|XP_002511585.1|  conserved hypothetical protein                     128   4e-29    Ricinus communis
ref|XP_011008835.1|  PREDICTED: uncharacterized protein LOC105114109    127   4e-29    Populus euphratica
ref|XP_011089387.1|  PREDICTED: uncharacterized protein LOC105170351    128   5e-29    Sesamum indicum [beniseed]
ref|XP_009115808.1|  PREDICTED: uncharacterized protein LOC103841050    127   5e-29    Brassica rapa
ref|XP_006660902.1|  PREDICTED: uncharacterized protein LOC102703332    124   5e-29    
ref|XP_002529641.1|  conserved hypothetical protein                     127   6e-29    Ricinus communis
gb|KFK34370.1|  hypothetical protein AALP_AA5G136500                    126   6e-29    Arabis alpina [alpine rockcress]
ref|XP_008352431.1|  PREDICTED: uncharacterized protein LOC103415926    127   6e-29    
ref|XP_008808616.1|  PREDICTED: uncharacterized protein LOC103720605    125   6e-29    Phoenix dactylifera
gb|KDP28858.1|  hypothetical protein JCGZ_14629                         127   7e-29    Jatropha curcas
ref|XP_009363473.1|  PREDICTED: uncharacterized protein LOC103953463    126   7e-29    Pyrus x bretschneideri [bai li]
ref|XP_008370338.1|  PREDICTED: uncharacterized protein LOC103433829    126   9e-29    
ref|XP_006403933.1|  hypothetical protein EUTSA_v10010132mg             127   9e-29    
gb|ABI34654.1|  bZIP transcription factor bZIP80                        124   9e-29    Glycine max [soybeans]
ref|XP_006380598.1|  proline-rich family protein                        125   1e-28    
gb|EPS68751.1|  hypothetical protein M569_06016                         126   1e-28    Genlisea aurea
ref|XP_009383946.1|  PREDICTED: uncharacterized protein LOC103971612    126   2e-28    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH17841.1|  BZIP transcription factor bZIP80, putative              125   2e-28    Medicago truncatula
gb|KFK42583.1|  hypothetical protein AALP_AA1G014300                    125   3e-28    Arabis alpina [alpine rockcress]
gb|KDP24001.1|  hypothetical protein JCGZ_25389                         124   3e-28    Jatropha curcas
gb|KHN40553.1|  hypothetical protein glysoja_001051                     120   3e-28    Glycine soja [wild soybean]
ref|XP_010275436.1|  PREDICTED: uncharacterized protein LOC104610494    125   3e-28    Nelumbo nucifera [Indian lotus]
ref|NP_001065395.1|  Os10g0562700                                       125   4e-28    
ref|XP_010550476.1|  PREDICTED: uncharacterized protein LOC104821337    124   4e-28    Tarenaya hassleriana [spider flower]
ref|XP_010089322.1|  hypothetical protein L484_021854                   125   4e-28    
gb|EAY79532.1|  hypothetical protein OsI_34661                          125   4e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_009373242.1|  PREDICTED: uncharacterized protein LOC103962279    122   4e-28    Pyrus x bretschneideri [bai li]
ref|XP_002467482.1|  hypothetical protein SORBIDRAFT_01g028920          125   4e-28    Sorghum bicolor [broomcorn]
ref|XP_011032057.1|  PREDICTED: uncharacterized protein LOC105131006    125   4e-28    Populus euphratica
ref|XP_007052313.1|  BZIP domain class transcription factor             125   5e-28    
ref|XP_008643472.1|  PREDICTED: uncharacterized protein LOC100381...    125   5e-28    Zea mays [maize]
gb|EMT28305.1|  hypothetical protein F775_06020                         123   5e-28    
ref|XP_008813601.1|  PREDICTED: uncharacterized protein LOC103724193    124   5e-28    Phoenix dactylifera
ref|XP_002526611.1|  conserved hypothetical protein                     124   5e-28    Ricinus communis
ref|XP_002892025.1|  proline-rich family protein                        124   6e-28    
ref|XP_006856770.1|  hypothetical protein AMTR_s00055p00070380          124   6e-28    
ref|NP_001175961.1|  Os09g0538750                                       121   7e-28    
emb|CAN79228.1|  hypothetical protein VITISV_011041                     124   7e-28    Vitis vinifera
ref|XP_011043178.1|  PREDICTED: uncharacterized protein LOC105138705    123   8e-28    Populus euphratica
gb|EMT24541.1|  hypothetical protein F775_19967                         123   8e-28    
ref|XP_002273471.2|  PREDICTED: uncharacterized protein LOC100266818    124   1e-27    Vitis vinifera
ref|XP_006402594.1|  hypothetical protein EUTSA_v10005793mg             124   1e-27    
ref|XP_006587779.1|  PREDICTED: uncharacterized protein LOC778134       123   1e-27    Glycine max [soybeans]
emb|CBI37845.3|  unnamed protein product                                122   2e-27    Vitis vinifera
gb|EMS48593.1|  hypothetical protein TRIUR3_22003                       122   2e-27    Triticum urartu
ref|XP_006418489.1|  hypothetical protein EUTSA_v10006946mg             123   2e-27    Eutrema salsugineum [saltwater cress]
ref|XP_009398488.1|  PREDICTED: uncharacterized protein LOC103983...    123   2e-27    
ref|XP_010469198.1|  PREDICTED: uncharacterized protein LOC104749302    123   2e-27    Camelina sativa [gold-of-pleasure]
ref|XP_009398490.1|  PREDICTED: uncharacterized protein LOC103983...    123   2e-27    
ref|XP_002460581.1|  hypothetical protein SORBIDRAFT_02g031210          122   2e-27    
gb|EYU31892.1|  hypothetical protein MIMGU_mgv1a0019612mg               122   2e-27    Erythranthe guttata [common monkey flower]
gb|EYU42344.1|  hypothetical protein MIMGU_mgv1a020945mg                123   2e-27    Erythranthe guttata [common monkey flower]
dbj|BAK03784.1|  predicted protein                                      123   2e-27    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010512348.1|  PREDICTED: uncharacterized protein LOC104788305    123   2e-27    Camelina sativa [gold-of-pleasure]
gb|KFK35242.1|  hypothetical protein AALP_AA5G258900                    123   2e-27    Arabis alpina [alpine rockcress]
gb|EEE70131.1|  hypothetical protein OsJ_30161                          121   2e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009133690.1|  PREDICTED: uncharacterized protein LOC103858146    123   2e-27    Brassica rapa
ref|XP_009796808.1|  PREDICTED: uncharacterized protein LOC104243329    122   2e-27    Nicotiana sylvestris
ref|XP_009612588.1|  PREDICTED: uncharacterized protein LOC104105875    122   2e-27    Nicotiana tomentosiformis
ref|XP_010265980.1|  PREDICTED: uncharacterized protein LOC104603617    122   2e-27    Nelumbo nucifera [Indian lotus]
ref|XP_008347510.1|  PREDICTED: uncharacterized protein LOC103410601    120   3e-27    
gb|KHG20396.1|  Ferric uptake regulation                                122   3e-27    
ref|XP_007215312.1|  hypothetical protein PRUPE_ppa003521mg             121   3e-27    
ref|XP_003578529.1|  PREDICTED: uncharacterized protein LOC100833837    122   3e-27    
ref|XP_006397664.1|  hypothetical protein EUTSA_v10001315mg             122   3e-27    
ref|XP_010692050.1|  PREDICTED: uncharacterized protein LOC104905271    122   3e-27    
ref|XP_006383089.1|  hypothetical protein POPTR_0005s11440g             121   4e-27    
gb|EEC84963.1|  hypothetical protein OsI_32200                          121   4e-27    
ref|XP_010544575.1|  PREDICTED: uncharacterized protein LOC104817191    122   4e-27    
ref|XP_010646704.1|  PREDICTED: uncharacterized protein LOC100243514    122   5e-27    
ref|XP_006375135.1|  hypothetical protein POPTR_0014s04670g             122   5e-27    
ref|XP_011017344.1|  PREDICTED: protein virilizer homolog               122   5e-27    
ref|XP_010033513.1|  PREDICTED: uncharacterized protein LOC104422784    121   5e-27    
emb|CDY56992.1|  BnaA04g27330D                                          121   6e-27    
gb|KFK37283.1|  hypothetical protein AALP_AA4G237000                    121   6e-27    
ref|NP_001145796.1|  hypothetical protein                               121   7e-27    
emb|CDY42691.1|  BnaC04g22150D                                          121   7e-27    
ref|XP_002881983.1|  predicted protein                                  121   7e-27    
ref|XP_004229746.1|  PREDICTED: uncharacterized protein LOC101257405    122   7e-27    
ref|XP_006402593.1|  hypothetical protein EUTSA_v10005793mg             121   7e-27    
gb|AFW87853.1|  hypothetical protein ZEAMMB73_997437                    120   7e-27    
ref|XP_010479355.1|  PREDICTED: uncharacterized protein LOC104758214    121   8e-27    
ref|XP_009138843.1|  PREDICTED: uncharacterized protein LOC103862890    121   9e-27    
ref|XP_008440844.1|  PREDICTED: uncharacterized protein LOC103485...    120   9e-27    
ref|XP_007157896.1|  hypothetical protein PHAVU_002G106900g             120   9e-27    
ref|XP_002986032.1|  hypothetical protein SELMODRAFT_425043             121   9e-27    
ref|XP_011462170.1|  PREDICTED: uncharacterized protein LOC105350878    120   9e-27    
ref|XP_007046645.1|  Uncharacterized protein TCM_000170                 120   9e-27    
ref|XP_010413572.1|  PREDICTED: uncharacterized protein LOC104699875    121   1e-26    
ref|XP_008440843.1|  PREDICTED: uncharacterized protein LOC103485...    120   1e-26    
gb|KGN48936.1|  hypothetical protein Csa_6G507110                       120   1e-26    
ref|XP_004957489.1|  PREDICTED: uncharacterized protein LOC101781416    120   1e-26    
ref|XP_009373221.1|  PREDICTED: uncharacterized protein LOC103962259    121   1e-26    
ref|XP_008658472.1|  PREDICTED: uncharacterized protein LOC100279...    121   1e-26    
ref|XP_008385303.1|  PREDICTED: uncharacterized protein LOC103447...    121   1e-26    
dbj|BAJ93020.1|  predicted protein                                      119   1e-26    
gb|EMS65961.1|  hypothetical protein TRIUR3_15371                       118   2e-26    
ref|XP_010496700.1|  PREDICTED: uncharacterized protein LOC104773746    117   2e-26    
ref|NP_001280829.1|  uncharacterized LOC103447875                       120   2e-26    
ref|XP_010496466.1|  PREDICTED: uncharacterized protein LOC104773...    120   2e-26    
ref|NP_001146678.1|  uncharacterized protein LOC100280278               119   2e-26    
ref|XP_010506417.1|  PREDICTED: uncharacterized protein LOC104783037    120   2e-26    
ref|XP_010518090.1|  PREDICTED: uncharacterized protein LOC104793437    120   2e-26    
ref|XP_010524436.1|  PREDICTED: uncharacterized protein LOC104802494    120   2e-26    
ref|XP_002990611.1|  hypothetical protein SELMODRAFT_10621              119   2e-26    
ref|XP_002968724.1|  hypothetical protein SELMODRAFT_145899             119   2e-26    
emb|CBI17341.3|  unnamed protein product                                117   2e-26    
ref|XP_009355694.1|  PREDICTED: uncharacterized protein LOC103946664    120   2e-26    
ref|XP_010508243.1|  PREDICTED: uncharacterized protein LOC104784850    120   2e-26    
ref|XP_008377795.1|  PREDICTED: uncharacterized protein LOC103440873    115   3e-26    
ref|XP_006290620.1|  hypothetical protein CARUB_v10016712mg             119   3e-26    
emb|CAN62559.1|  hypothetical protein VITISV_009207                     119   3e-26    
ref|XP_008236050.1|  PREDICTED: uncharacterized protein LOC103334853    116   3e-26    
ref|XP_008651371.1|  PREDICTED: uncharacterized protein LOC100280...    119   3e-26    
dbj|BAJ88203.1|  predicted protein                                      119   3e-26    
ref|NP_190697.2|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1       119   3e-26    
ref|XP_010235002.1|  PREDICTED: uncharacterized protein LOC100823...    119   4e-26    
ref|XP_010496465.1|  PREDICTED: uncharacterized protein LOC104773...    119   4e-26    
ref|XP_009411587.1|  PREDICTED: uncharacterized protein LOC103993301    119   4e-26    
ref|XP_008232519.1|  PREDICTED: uncharacterized protein DDB_G0284...    119   5e-26    
emb|CDP01871.1|  unnamed protein product                                118   5e-26    
ref|XP_009796082.1|  PREDICTED: uncharacterized protein LOC104242706    119   6e-26    
ref|XP_010316432.1|  PREDICTED: uncharacterized protein LOC101264882    118   6e-26    
ref|XP_003574338.1|  PREDICTED: uncharacterized protein LOC100823...    119   6e-26    
gb|EPS64716.1|  hypothetical protein M569_10064                         118   6e-26    
ref|XP_010052798.1|  PREDICTED: uncharacterized protein LOC104441367    119   6e-26    
ref|XP_006573547.1|  PREDICTED: uncharacterized protein LOC102662030    117   7e-26    
ref|XP_008457723.1|  PREDICTED: uncharacterized protein LOC103497347    118   7e-26    
gb|KJB24877.1|  hypothetical protein B456_004G165900                    118   7e-26    
ref|XP_010649002.1|  PREDICTED: uncharacterized protein LOC100245...    117   8e-26    
ref|XP_009783506.1|  PREDICTED: uncharacterized protein LOC104232105    118   8e-26    
gb|KHG10277.1|  hypothetical protein F383_08644                         118   9e-26    
ref|XP_009418803.1|  PREDICTED: uncharacterized protein LOC103998915    117   9e-26    
ref|XP_009624469.1|  PREDICTED: uncharacterized protein LOC104115517    118   9e-26    
ref|XP_010649000.1|  PREDICTED: uncharacterized protein LOC100245...    117   9e-26    
ref|XP_007220261.1|  hypothetical protein PRUPE_ppa001262mg             118   1e-25    
ref|XP_002521270.1|  conserved hypothetical protein                     118   1e-25    
ref|XP_006293710.1|  hypothetical protein CARUB_v10022668mg             117   1e-25    
ref|XP_001762208.1|  predicted protein                                  117   1e-25    
ref|XP_002301229.1|  hypothetical protein POPTR_0002s13850g             117   1e-25    
ref|XP_010465886.1|  PREDICTED: uncharacterized protein LOC104746...    116   2e-25    
ref|XP_010465893.1|  PREDICTED: uncharacterized protein LOC104746...    116   2e-25    
ref|XP_006293711.1|  hypothetical protein CARUB_v10022668mg             117   2e-25    
ref|XP_002305530.1|  hypothetical protein POPTR_0004s18350g             117   2e-25    
gb|EPS68914.1|  hypothetical protein M569_05851                         116   2e-25    
emb|CDX83412.1|  BnaA03g20940D                                          116   2e-25    
ref|XP_009589344.1|  PREDICTED: uncharacterized protein LOC104086728    116   3e-25    
ref|XP_006347962.1|  PREDICTED: uncharacterized protein LOC102598946    117   3e-25    
emb|CDX95620.1|  BnaC03g25010D                                          116   3e-25    
ref|XP_002989601.1|  hypothetical protein SELMODRAFT_447743             116   3e-25    
gb|KDP33297.1|  hypothetical protein JCGZ_13084                         116   3e-25    
emb|CDX71821.1|  BnaC08g30530D                                          116   3e-25    
ref|XP_002878328.1|  DNA binding protein                                116   4e-25    
ref|XP_008344422.1|  PREDICTED: uncharacterized protein LOC103407257    116   5e-25    
gb|AAN05792.1|  unknown                                                 115   5e-25    
ref|XP_004512154.1|  PREDICTED: uncharacterized protein LOC101508512    115   6e-25    
gb|KJB17616.1|  hypothetical protein B456_003G008100                    115   6e-25    
ref|XP_011046654.1|  PREDICTED: uncharacterized protein LOC105141197    115   6e-25    
ref|XP_006367871.1|  PREDICTED: uncharacterized protein LOC102582747    115   7e-25    
ref|XP_010266884.1|  PREDICTED: uncharacterized protein LOC104604293    115   8e-25    
gb|KFK28273.1|  hypothetical protein AALP_AA8G495200                    114   8e-25    
emb|CDX77992.1|  BnaA09g31870D                                          114   8e-25    
ref|XP_010266047.1|  PREDICTED: uncharacterized protein LOC104603664    115   9e-25    
gb|KJB40156.1|  hypothetical protein B456_007G049300                    114   9e-25    
ref|XP_007201549.1|  hypothetical protein PRUPE_ppa017556mg             115   1e-24    
ref|XP_009116713.1|  PREDICTED: uncharacterized protein LOC103841881    114   2e-24    
gb|ABP88223.1|  transcription factor bZIP54                             106   2e-24    
emb|CDY41178.1|  BnaA09g38370D                                          114   2e-24    
ref|XP_010547414.1|  PREDICTED: formin-like protein 2 isoform X2        114   2e-24    
ref|XP_003635164.1|  PREDICTED: uncharacterized protein LOC100855179    114   2e-24    
ref|XP_009358153.1|  PREDICTED: uncharacterized protein LOC103948808    114   2e-24    
gb|KHG27804.1|  hypothetical protein F383_01358                         113   3e-24    
gb|KHG14505.1|  Pyridoxal-phosphate-dependent serine hydroxymethy...    113   3e-24    
ref|XP_011088630.1|  PREDICTED: uncharacterized protein LOC105169807    113   5e-24    
ref|XP_009358043.1|  PREDICTED: uncharacterized protein LOC103948707    113   5e-24    
ref|XP_009358050.1|  PREDICTED: uncharacterized protein LOC103948716    112   6e-24    
gb|KJB40973.1|  hypothetical protein B456_007G085700                    113   6e-24    
gb|KJB15855.1|  hypothetical protein B456_002G199800                    112   1e-23    
gb|KHG27172.1|  Holliday junction ATP-dependent DNA helicase RuvB       111   1e-23    
ref|XP_006448941.1|  hypothetical protein CICLE_v10014533mg             111   1e-23    
ref|XP_003612207.1|  hypothetical protein MTR_5g022530                  111   2e-23    
dbj|BAD34385.1|  hypothetical protein                                   106   2e-23    
ref|XP_004290739.2|  PREDICTED: uncharacterized protein LOC101292471    110   3e-23    
ref|XP_002530629.1|  conserved hypothetical protein                     110   3e-23    
gb|KGN61947.1|  hypothetical protein Csa_2G271390                       110   3e-23    
ref|XP_004231454.1|  PREDICTED: uncharacterized protein LOC101255743    110   3e-23    
gb|EYU37975.1|  hypothetical protein MIMGU_mgv1a026155mg                110   4e-23    
gb|KJB17572.1|  hypothetical protein B456_003G006300                    108   4e-23    
ref|XP_004147076.1|  PREDICTED: uncharacterized protein LOC101207270    110   4e-23    
ref|XP_006468274.1|  PREDICTED: uncharacterized protein LOC102624...    110   4e-23    
ref|XP_006468273.1|  PREDICTED: uncharacterized protein LOC102624...    110   4e-23    
gb|KHG24815.1|  DNA ligase                                              110   4e-23    
ref|XP_004134851.1|  PREDICTED: uncharacterized protein LOC101220098    109   6e-23    
ref|XP_007041768.1|  Uncharacterized protein isoform 1                  109   7e-23    
gb|KJB17571.1|  hypothetical protein B456_003G006300                    108   1e-22    
ref|XP_006340943.1|  PREDICTED: uncharacterized protein LOC102600978    108   1e-22    
ref|XP_011022260.1|  PREDICTED: uncharacterized protein LOC105124090    108   2e-22    
ref|XP_004969399.1|  PREDICTED: uncharacterized protein LOC101757...    108   2e-22    
gb|KJB17570.1|  hypothetical protein B456_003G006300                    108   2e-22    
ref|XP_006383045.1|  hypothetical protein POPTR_0005s11020g             107   2e-22    
ref|XP_010241199.1|  PREDICTED: uncharacterized protein LOC104585875    107   3e-22    
ref|XP_010056962.1|  PREDICTED: uncharacterized protein LOC104444883    105   1e-21    
ref|XP_002313698.2|  hypothetical protein POPTR_0009s13960g             105   1e-21    
ref|XP_006486545.1|  PREDICTED: uncharacterized protein LOC102622893    102   2e-21    
emb|CDP14548.1|  unnamed protein product                                104   3e-21    
ref|XP_004140629.1|  PREDICTED: uncharacterized protein LOC101219960    104   3e-21    
emb|CAB87869.1|  bZIP protein                                           103   3e-21    
ref|XP_007046600.1|  Uncharacterized protein TCM_000136                 104   3e-21    
gb|KDP34961.1|  hypothetical protein JCGZ_09249                         103   4e-21    
ref|XP_011045822.1|  PREDICTED: uncharacterized protein LOC105140622    104   4e-21    
gb|EYU19135.1|  hypothetical protein MIMGU_mgv1a002741mg                103   4e-21    
ref|XP_010028766.1|  PREDICTED: uncharacterized protein LOC104418979    104   4e-21    
gb|EMT31600.1|  hypothetical protein F775_01622                         104   6e-21    
gb|EAY74707.1|  hypothetical protein OsI_02600                          103   6e-21    
gb|EEE54881.1|  hypothetical protein OsJ_02382                          103   7e-21    
ref|NP_001043426.1|  Os01g0585600                                       103   7e-21    
ref|XP_006603964.1|  PREDICTED: uncharacterized protein LOC102664706  99.4    9e-21    
ref|NP_191591.2|  uncharacterized protein                               102   1e-20    
ref|XP_010941533.1|  PREDICTED: uncharacterized protein LOC105059789    102   1e-20    
ref|XP_011092957.1|  PREDICTED: uncharacterized protein LOC105173018    102   2e-20    
ref|XP_008812622.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   2e-20    
ref|XP_010935171.1|  PREDICTED: uncharacterized protein LOC105055134    102   2e-20    
ref|XP_008646006.1|  PREDICTED: uncharacterized protein LOC103627496    101   2e-20    
gb|KCW55583.1|  hypothetical protein EUGRSUZ_I01453                     101   2e-20    
ref|XP_003576784.1|  PREDICTED: uncharacterized protein LOC100844006    101   3e-20    
ref|XP_002455853.1|  hypothetical protein SORBIDRAFT_03g026230          101   3e-20    
emb|CBI16665.3|  unnamed protein product                              99.0    3e-20    
ref|XP_010540216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.8    3e-20    
ref|XP_006828819.1|  hypothetical protein AMTR_s00001p00134970          100   4e-20    
ref|XP_004289069.1|  PREDICTED: uncharacterized protein LOC101292260    101   4e-20    
ref|XP_003569275.1|  PREDICTED: uncharacterized protein LOC100827...    100   5e-20    
ref|XP_010231954.1|  PREDICTED: uncharacterized protein LOC100827...    100   6e-20    
dbj|BAD25321.1|  putative bZIP protein                                  100   6e-20    
gb|KDO71340.1|  hypothetical protein CISIN_1g014022mg                 99.0    6e-20    
ref|XP_010086828.1|  hypothetical protein L484_006057                   100   6e-20    
ref|XP_006425369.1|  hypothetical protein CICLE_v10027576mg             100   7e-20    
ref|NP_001047613.2|  Os02g0654600                                       100   7e-20    
ref|XP_008675404.1|  PREDICTED: uncharacterized protein LOC103651534    100   8e-20    
ref|XP_007041129.1|  Uncharacterized protein isoform 1                  100   9e-20    
ref|XP_007041131.1|  Uncharacterized protein isoform 3                99.8    9e-20    
ref|XP_006644314.1|  PREDICTED: uncharacterized protein LOC102718120  99.8    1e-19    
ref|XP_006467173.1|  PREDICTED: uncharacterized protein LOC102606809  99.8    1e-19    
ref|XP_008806165.1|  PREDICTED: uncharacterized protein LOC103718930  98.6    3e-19    
ref|XP_007204798.1|  hypothetical protein PRUPE_ppa018170mg           98.6    3e-19    
emb|CAC39057.1|  putative protein                                     97.8    3e-19    
gb|EEC73715.1|  hypothetical protein OsI_08319                        98.2    3e-19    
gb|AAC24369.1|  bZIP-like protein                                     98.2    4e-19    
gb|EMS55915.1|  hypothetical protein TRIUR3_26441                     97.8    4e-19    
ref|XP_011096879.1|  PREDICTED: uncharacterized protein LOC105175929  97.8    5e-19    
gb|KHN45577.1|  hypothetical protein glysoja_033556                   96.3    6e-19    
ref|XP_008444972.1|  PREDICTED: uncharacterized protein LOC103488153  97.1    9e-19    
ref|XP_010113292.1|  hypothetical protein L484_026622                 96.3    1e-18    
ref|XP_003547572.1|  PREDICTED: uncharacterized protein LOC100809...  95.9    2e-18    
gb|KDP23957.1|  hypothetical protein JCGZ_25345                       95.9    2e-18    
ref|XP_007138530.1|  hypothetical protein PHAVU_009G217000g           95.1    3e-18    
ref|XP_010540610.1|  PREDICTED: uncharacterized protein LOC104814319  95.1    4e-18    
ref|XP_004135735.1|  PREDICTED: uncharacterized protein LOC101216940  94.7    5e-18    
emb|CDP19649.1|  unnamed protein product                              94.4    7e-18    
gb|ABN08062.1|  Protein of unknown function DUF632                    92.0    7e-18    
ref|XP_010690330.1|  PREDICTED: uncharacterized protein LOC104903894  94.4    7e-18    
ref|XP_003595493.1|  hypothetical protein MTR_2g048360                91.7    8e-18    
ref|XP_002986031.1|  hypothetical protein SELMODRAFT_425042           94.7    9e-18    
gb|ABI34689.1|  bZIP transcription factor bZIP79                      91.3    9e-18    
ref|XP_002989600.1|  hypothetical protein SELMODRAFT_428168           94.0    1e-17    
gb|EAZ09934.1|  hypothetical protein OsI_32233                        93.6    1e-17    
emb|CBI30984.3|  unnamed protein product                              93.6    1e-17    
ref|XP_002274665.1|  PREDICTED: uncharacterized protein LOC100249833  93.6    1e-17    
dbj|BAC79196.1|  bzip-like transcription factor-like protein          93.6    1e-17    
ref|XP_002452818.1|  hypothetical protein SORBIDRAFT_04g033110        93.2    1e-17    
ref|XP_010519079.1|  PREDICTED: uncharacterized protein LOC104798610  93.2    1e-17    
ref|XP_006661491.1|  PREDICTED: uncharacterized protein LOC102717278  92.8    1e-17    
ref|NP_001063821.2|  Os09g0542500                                     90.1    2e-17    
gb|KDO68173.1|  hypothetical protein CISIN_1g007142mg                 92.0    3e-17    
ref|XP_003535757.1|  PREDICTED: uncharacterized protein LOC100801471  92.4    3e-17    
gb|KHN37389.1|  hypothetical protein glysoja_013604                   92.4    3e-17    
ref|XP_007142804.1|  hypothetical protein PHAVU_007G018200g           92.4    3e-17    
gb|KJB14759.1|  hypothetical protein B456_002G142000                  90.5    4e-17    
ref|XP_006486851.1|  PREDICTED: uncharacterized protein LOC102611322  92.0    4e-17    
ref|XP_006422535.1|  hypothetical protein CICLE_v10030360mg           92.0    4e-17    
gb|AAN01518.1|  bZIP-like protein                                     87.0    6e-17    
gb|AES65744.2|  DUF630 family protein                                 90.9    7e-17    
ref|XP_010275925.1|  PREDICTED: uncharacterized protein LOC104610...  90.9    8e-17    



>ref|XP_009786426.1| PREDICTED: uncharacterized protein LOC104234548 isoform X1 [Nicotiana 
sylvestris]
Length=756

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 232/268 (87%), Gaps = 0/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MWETM+G+H +Q +IV ALRSLD+SQSPKET+EHH+ERT QL VVVQE
Sbjct  485  PKLVALVDGMAIMWETMRGYHVSQSKIVQALRSLDISQSPKETTEHHHERTLQLYVVVQE  544

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQK YI+ LN+WLKLNL+PIDTNLKEKVSSPQRPQ PPIL+L+HAW D +
Sbjct  545  WHSQFDKLVTHQKHYIKALNNWLKLNLIPIDTNLKEKVSSPQRPQTPPILSLIHAWHDYL  604

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAIY+FSAV+NTI ++Q +EMKLKDRC+DTR+EL K+TRQ+EDWYHKYMQR
Sbjct  605  DKLPDELARTAIYNFSAVINTIFEYQKEEMKLKDRCEDTRRELNKKTRQYEDWYHKYMQR  664

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RTP D+ + D  HED+ V++RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPE
Sbjct  665  RTPPDEMDPDQAHEDSLVVDRQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPE  724

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNR  133
            LF AMS+FS AC+ MY+ L SI    NR
Sbjct  725  LFEAMSDFSLACADMYRDLRSIAKHRNR  752



>ref|XP_009628236.1| PREDICTED: uncharacterized protein LOC104118644 isoform X1 [Nicotiana 
tomentosiformis]
Length=739

 Score =   401 bits (1031),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 233/268 (87%), Gaps = 0/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MWETM+G+H +Q +IV A+RSLD+SQSPKET+EHH+ERT QL VVVQE
Sbjct  468  PKLVALVDGMAIMWETMRGYHVSQSKIVQAVRSLDISQSPKETTEHHHERTLQLYVVVQE  527

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQK+YI+ LN+WLKLNL+PIDTNLKEKVSSPQRPQNPPIL+L+HAW D +
Sbjct  528  WHSQFDKLVTHQKQYIKALNNWLKLNLIPIDTNLKEKVSSPQRPQNPPILSLIHAWHDYL  587

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAIY+FSAV+NTI ++Q +EMKLKDRC+DTR+EL K+TRQ+EDWY ++MQR
Sbjct  588  DKLPDELARTAIYNFSAVINTIFEYQKEEMKLKDRCEDTRRELNKKTRQYEDWYQRHMQR  647

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RTP D+ + D  H D+ V++RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPE
Sbjct  648  RTPPDEMDPDQAHVDSLVVDRQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPE  707

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNR  133
            LF AMSEFS AC+ MY+ L SI+   NR
Sbjct  708  LFGAMSEFSLACADMYRDLRSISKHRNR  735



>ref|XP_006341679.1| PREDICTED: uncharacterized protein LOC102589286 [Solanum tuberosum]
Length=755

 Score =   392 bits (1006),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 230/268 (86%), Gaps = 1/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MWETMKG+H +Q +IV AL+SLD+SQSPKET+EHH+ERT QL VVVQE
Sbjct  485  PKLVDLVNGMAIMWETMKGYHVSQSKIVQALKSLDISQSPKETTEHHHERTLQLYVVVQE  544

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++I+QK+YI+ LN WLKLNL+PIDTNLKEKVSSPQRPQNPPILAL+HAW D +
Sbjct  545  WHSQFDKLVIYQKQYIKALNSWLKLNLIPIDTNLKEKVSSPQRPQNPPILALIHAWHDYL  604

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAIY+FSAV+NTI ++Q +EMKL+DRC+DTR+EL K+TRQ+EDWYHK+MQR
Sbjct  605  EKLPDELARTAIYNFSAVINTIFEYQKEEMKLRDRCEDTRRELNKKTRQYEDWYHKHMQR  664

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            +TP D+ + +   ED  V++RQLQLEAL+++L++EE++Y RQC+QVR KSLTSLR+ LPE
Sbjct  665  KTP-DEIDPESAQEDTLVVDRQLQLEALRKKLEDEEDSYQRQCLQVRDKSLTSLRSRLPE  723

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNR  133
            LF AMSE+S AC+ MY+ L SI    NR
Sbjct  724  LFGAMSEYSLACADMYRDLRSIAKHRNR  751



>ref|XP_004235711.1| PREDICTED: uncharacterized protein LOC101250783 [Solanum lycopersicum]
Length=754

 Score =   389 bits (1000),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 228/268 (85%), Gaps = 1/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MWE MKG+H +Q +I  AL+SLD+SQSPKET+EHH+ERT QL VVVQE
Sbjct  484  PKLVDLVNGMAIMWENMKGYHVSQSKIAQALKSLDISQSPKETTEHHHERTLQLYVVVQE  543

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++I+QK+YI+ LN+WLKLNL+PIDTNLKEKVSSPQRPQNPPILAL+HAW D +
Sbjct  544  WHSQFDKLVIYQKQYIKALNNWLKLNLIPIDTNLKEKVSSPQRPQNPPILALIHAWHDDL  603

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAIY+FSAV+NTI ++Q +EMKL+DRC+DTR+EL K+TRQ+EDWYHK+MQR
Sbjct  604  EKLPDELARTAIYNFSAVINTIFEYQKEEMKLRDRCEDTRRELNKKTRQYEDWYHKHMQR  663

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P D+ + +   ED  V++RQLQLEAL++RL++EE++Y RQC+QVR KSLTSLR+ LPE
Sbjct  664  RIP-DEMDPESAQEDTLVVDRQLQLEALRKRLEDEEDSYQRQCLQVRDKSLTSLRSRLPE  722

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNR  133
            LF AMSEFS AC+ MY+ L SI    NR
Sbjct  723  LFGAMSEFSLACADMYRDLRSIAKHRNR  750



>ref|XP_011072341.1| PREDICTED: uncharacterized protein LOC105157620 [Sesamum indicum]
Length=743

 Score =   351 bits (900),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 213/268 (79%), Gaps = 0/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MWET++ HHENQ +IV ALR LD+SQ+PKETS+HH+ERT QLG VVQE
Sbjct  473  PKLVALVDGMATMWETIRIHHENQSKIVQALRLLDISQAPKETSDHHHERTRQLGGVVQE  532

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++ F +++  QKEYI+ LN WLKLNL+PIDTN KEKVSSP RPQNPPI  LLHAW D +
Sbjct  533  WYTNFSELMSQQKEYIKALNSWLKLNLIPIDTNWKEKVSSPGRPQNPPIQILLHAWHDYL  592

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE AK +I +F+A++ TI Q+Q +E+  ++RC D+RK+L ++TR FE+WY+KYMQ+
Sbjct  593  EKLPDEPAKASINNFAAIIKTIWQYQKEELDFRNRCADSRKDLIRKTRDFENWYNKYMQK  652

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RTP DD + D  H+ + + E+QL +EA KQ+L+E+EEAY RQC+QVR KSL SL++ LPE
Sbjct  653  RTPPDDMDPDRTHDKDLIAEKQLMVEAAKQKLEEDEEAYQRQCIQVREKSLMSLKSHLPE  712

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNR  133
            LF A+S+FS ACS MY TL SI+   NR
Sbjct  713  LFRALSDFSLACSDMYSTLRSISRSRNR  740



>ref|XP_002279674.1| PREDICTED: uncharacterized protein LOC100241173 [Vitis vinifera]
Length=722

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 209/266 (79%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MW TM  HH++Q +  +AL+SLD+SQSPKETSEHH++RT QL +VVQE
Sbjct  450  PKLVALVDGMATMWGTMLEHHKSQSKTAMALKSLDISQSPKETSEHHHKRTIQLWIVVQE  509

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ +QK YI  L  WL+LNL+PI++NLKEKVSSP RPQNPPI ALL AW D +
Sbjct  510  WHSQFDKLVTNQKNYITALKKWLRLNLIPIESNLKEKVSSPPRPQNPPIQALLQAWNDHL  569

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAKT+I +F+A++ TI+QHQ DEM+LK +C++T KELE++TRQF DW+ KYMQ+
Sbjct  570  EKLPDELAKTSISNFAAIIETIMQHQQDEMRLKAKCEETAKELERKTRQFNDWHSKYMQK  629

Query  396  RTPNDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P+++  +   D PH D  VIER+L +E L  RLK+EEE Y ++C+ VR KSL SL+  
Sbjct  630  RIPDENDREHSGDDPH-DEVVIERKLVVETLSNRLKDEEETYQKECVLVRDKSLASLKNH  688

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF A+SEFS ACS MY  L SI+
Sbjct  689  LPELFRALSEFSYACSDMYSRLRSIS  714



>emb|CDO98057.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/271 (62%), Positives = 219/271 (81%), Gaps = 0/271 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MWE+M+GHHE+Q +IV AL SL +SQ PKETSEHH+ERT+QL +VV+E
Sbjct  479  PKLVALVDGMAFMWESMRGHHESQSKIVQALSSLHISQFPKETSEHHHERTFQLLLVVKE  538

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+K+I +Q +YIR LN+WLKLNL+PIDTNLKEKVSSPQRP NPPI  LLHAW D +
Sbjct  539  WHMQFDKLIKNQLDYIRALNNWLKLNLIPIDTNLKEKVSSPQRPANPPICVLLHAWHDYL  598

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             K PDELA++AI +F+ VV+ IV++Q+DEMKL+++C+DTR+EL K+T QF+DWY KYMQR
Sbjct  599  EKAPDELARSAINNFAHVVDHIVEYQIDEMKLRNKCEDTRRELAKKTEQFKDWYRKYMQR  658

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RTP D+ + +   + + ++ERQ+Q+E L+++L+EEE  Y +QC+QVR KSL SLRTGLP 
Sbjct  659  RTPPDELDPERAQDKDLIVERQIQVETLEKKLEEEEAEYKKQCIQVREKSLASLRTGLPN  718

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNREST  124
            LF AMS FS ACS MY+ L SI+   +R  +
Sbjct  719  LFLAMSGFSLACSDMYRNLRSISQKRSRSES  749



>ref|XP_002304191.2| hypothetical protein POPTR_0003s05360g [Populus trichocarpa]
 gb|EEE79170.2| hypothetical protein POPTR_0003s05360g [Populus trichocarpa]
Length=261

 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 205/254 (81%), Gaps = 4/254 (2%)
 Frame = -1

Query  900  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  721
            MW+TM  HHE+Q +IV ALR LD+SQS KETSEHH++RT+QL VVVQEW SQF K+I +Q
Sbjct  1    MWKTMLVHHEDQSKIVNALRFLDISQSSKETSEHHHDRTFQLLVVVQEWQSQFCKLIDNQ  60

Query  720  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  541
            K YI+ LN WLKLNL+PI++NLKEKVSSP R +NPPI  LL AW D + KLPDE+A+TAI
Sbjct  61   KAYIKSLNSWLKLNLIPIESNLKEKVSSPPRVRNPPIQPLLIAWHDFLDKLPDEVARTAI  120

Query  540  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DTE--Q  370
             +F+AV++TI+QHQ +EMKLK++C++TRKEL ++ R++EDW+ KYMQ+RTP++ D E  +
Sbjct  121  NNFAAVIHTILQHQEEEMKLKEKCEETRKELSQKMRKYEDWWRKYMQQRTPDELDPERTE  180

Query  369  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  190
            D  H D  + ERQ  ++A+K RLKEEEEAY +QC+QVR KS+ SL+T LPELF AMSE +
Sbjct  181  DNSHND-AIAERQSVVDAVKNRLKEEEEAYRKQCLQVREKSMASLKTRLPELFRAMSEVA  239

Query  189  RACSIMYQTLESIT  148
             ACS MY+ L SI+
Sbjct  240  HACSEMYKNLRSIS  253



>ref|XP_010545713.1| PREDICTED: uncharacterized protein LOC104817994 [Tarenaya hassleriana]
Length=834

 Score =   334 bits (856),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 208/264 (79%), Gaps = 9/264 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV++MA+MWE M+ HH+ Q ++  ALRSLD+SQ+ KET++HH+ERT QL  VVQE
Sbjct  538  PKLVQLVDAMAKMWELMQIHHQRQAEVSKALRSLDISQAVKETNDHHHERTIQLLAVVQE  597

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF +MI HQKEYI+ LN WLKLNL+PI++ LKEKVSSP R  NPPI  LL AW D +
Sbjct  598  WHTQFCRMIDHQKEYIKFLNSWLKLNLIPIESTLKEKVSSPPRVPNPPIQRLLIAWYDRL  657

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A+TAI +F+AV++TI+Q Q +EMKL+D+C++TR+EL ++TR FEDWYHKYMQ+
Sbjct  658  DKLPDEMARTAIINFAAVISTIMQQQEEEMKLRDKCEETRRELARKTRNFEDWYHKYMQK  717

Query  396  RTPNDDTEQDGPHEDNN-----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            R P    E+  P EDN+     VIERQL +E +++RL+EEEE Y RQC+QVR KSL SLR
Sbjct  718  RIP----EEINPEEDNDAHKDVVIERQLAVEQVRKRLEEEEEVYQRQCVQVREKSLASLR  773

Query  231  TGLPELFHAMSEFSRACSIMYQTL  160
            T LPELF AMSE + ACS MY+ L
Sbjct  774  TRLPELFQAMSEVAYACSDMYRAL  797



>gb|KHN32609.1| hypothetical protein glysoja_022291 [Glycine soja]
Length=640

 Score =   327 bits (839),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 204/274 (74%), Gaps = 3/274 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ MA MW+TM  HH  Q   V +LR+LD+SQSPK TSEHHY+RTYQL +VVQ+
Sbjct  367  PRLIQLVDGMATMWKTMLEHHVKQSDTVTSLRNLDISQSPKTTSEHHYDRTYQLVLVVQQ  426

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ HQK YI+ LN WLKLN++PI++NLKEKVSSP R ++PPI  LL+AW D +
Sbjct  427  WHSHFEKLVNHQKGYIKALNTWLKLNIIPIESNLKEKVSSPPRVRSPPIQGLLNAWNDRL  486

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAI +F  V+ TI   Q +E+ LK +C+DTRKEL ++TRQFEDWY+KYMQ+
Sbjct  487  DKLPDELARTAIGNFVNVIETIYHQQEEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQK  546

Query  396  RTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            + P   N D  +D    D  V ERQ  +E +K+RL++EEEAY RQC+QVR K+L SL+  
Sbjct  547  KIPDEYNPDRAEDANAPDEVVTERQFAVELVKKRLEDEEEAYARQCLQVRQKTLGSLKNR  606

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLNREST  124
            +PELF AMS+FS  CS MY  L SI+  L + S+
Sbjct  607  MPELFRAMSDFSLECSRMYSELRSISQHLGQSSS  640



>ref|XP_002299694.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
 gb|EEE84499.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
Length=696

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/269 (60%), Positives = 214/269 (80%), Gaps = 2/269 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW+TM+ HHE Q ++V ALR+LD+SQSPKETSEHH++RT+QL VVVQ 
Sbjct  426  PKLVELVDGMATMWDTMRYHHEAQSKVVNALRALDISQSPKETSEHHHDRTFQLLVVVQG  485

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQF K+I +QK YIR LN WLKLNL+PI+++LKEKVSSP R QNPPI +LL AW D +
Sbjct  486  WQSQFCKLIDNQKGYIRALNSWLKLNLIPIESSLKEKVSSPPRVQNPPIQSLLIAWHDFL  545

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A+TAI +F++V++TI+QHQ +EMKLK++C++TRKEL ++TR+FEDWYHKYMQ+
Sbjct  546  DKLPDEVARTAINNFASVIHTILQHQEEEMKLKEKCEETRKELFQKTRKFEDWYHKYMQQ  605

Query  396  RTPND-DTEQDGPHEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            + P + D E      DN+ I +RQ  ++A+K+RL+EEEEAY +Q +QVR KSL S++T L
Sbjct  606  KMPAEFDPELTEDKSDNDAIADRQFVVDAVKKRLEEEEEAYKKQRLQVREKSLASIKTCL  665

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLN  136
            PELF AM + ++ACS MY+ L  I+   N
Sbjct  666  PELFRAMFDIAQACSEMYRNLRFISQRRN  694



>gb|KHG04451.1| Monodehydroascorbate reductase, fruit isozyme [Gossypium arboreum]
Length=741

 Score =   328 bits (841),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 207/270 (77%), Gaps = 3/270 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRS-LDMSQSPKETSEHHYERTYQLGVVVQ  760
            PKL  LVE M  MWETM+  H++QC+I   LR  LD+SQSPKETSEHH+ERT+QL  +VQ
Sbjct  467  PKLVDLVEKMVIMWETMREEHDSQCRIADILRDHLDLSQSPKETSEHHHERTFQLLAIVQ  526

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
            +WH QF K+I HQKEYI+ LN+WL+LNL+PI+++LKEK SSP R ++PPI  L+ AWQD 
Sbjct  527  DWHMQFCKLIDHQKEYIKALNNWLRLNLIPIESSLKEKGSSPPRVESPPIQRLILAWQDK  586

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
            + KLPDE+A+TAI +F+ V++ I+QHQ DEMKLK++C+++RKEL K+ RQFEDWY+KYMQ
Sbjct  587  LDKLPDEIARTAINNFAHVIDAIMQHQRDEMKLKEKCEESRKELAKKQRQFEDWYNKYMQ  646

Query  399  RRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RRTP   D T  D    ++ V ERQ  +EA+K+RL EEEEAY   C+QVR KSL SL+T 
Sbjct  647  RRTPEELDPTRTDDNPNNDAVTERQFMVEAVKRRLGEEEEAYRILCIQVREKSLVSLKTR  706

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLN  136
            LPELF AMS  + ACS MY  L +I+H  N
Sbjct  707  LPELFRAMSTIAVACSKMYGELRAISHSRN  736



>ref|XP_010098052.1| hypothetical protein L484_026183 [Morus notabilis]
 gb|EXB74489.1| hypothetical protein L484_026183 [Morus notabilis]
Length=743

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 205/267 (77%), Gaps = 0/267 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWETM+ HHENQ +IV  LR LD+SQSPKETSEHH+ERT QL  VV E
Sbjct  471  PKLVQLVDGMATMWETMQYHHENQSKIVQKLRYLDISQSPKETSEHHHERTVQLYAVVNE  530

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++  QK+Y++ L  WLKLNL+P +++LKEKVSSP R Q PPI  LL AWQ+ +
Sbjct  531  WHLQFEKLVFKQKDYMKALTTWLKLNLIPTESSLKEKVSSPPRQQTPPIQKLLMAWQEHL  590

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA++AI++F+AV++TIV  Q++EM+L+++CKDT KEL ++ RQFEDWY KYM+R
Sbjct  591  EKLPDELARSAIFNFAAVIDTIVHQQVEEMRLREKCKDTEKELSRKKRQFEDWYRKYMER  650

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            + PN+    +    +N + ERQ  +++L++RL+EE+E Y R C+ VR KSL S++T LPE
Sbjct  651  QIPNEGEPAEDTTSNNGLAERQFMVDSLEKRLEEEQEDYQRHCLHVREKSLASVKTRLPE  710

Query  216  LFHAMSEFSRACSIMYQTLESITHPLN  136
            LF A+S+F+ ACS MY+ L S + P N
Sbjct  711  LFRALSDFAVACSEMYRDLRSRSPPQN  737



>ref|XP_003542101.1| PREDICTED: uncharacterized protein LOC100791852 [Glycine max]
Length=749

 Score =   327 bits (839),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 204/274 (74%), Gaps = 3/274 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ MA MW+TM  HH  Q   V +LR+LD+SQSPK TSEHHY+RTYQL +VVQ+
Sbjct  476  PRLIQLVDGMATMWKTMLEHHVKQSDTVTSLRNLDISQSPKTTSEHHYDRTYQLVLVVQQ  535

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ HQK YI+ LN WLKLN++PI++NLKEKVSSP R ++PPI  LL+AW D +
Sbjct  536  WHSHFEKLVNHQKGYIKALNTWLKLNIIPIESNLKEKVSSPPRVRSPPIQGLLNAWNDRL  595

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAI +F  V+ TI   Q +E+ LK +C+DTRKEL ++TRQFEDWY+KYMQ+
Sbjct  596  DKLPDELARTAIGNFVNVIETIYHQQEEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQK  655

Query  396  RTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            + P   N D  +D    D  V ERQ  +E +K+RL++EEEAY RQC+QVR K+L SL+  
Sbjct  656  KIPDEYNPDRAEDANAPDEVVTERQFAVELVKKRLEDEEEAYARQCLQVRQKTLGSLKNR  715

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLNREST  124
            +PELF AMS+FS  CS MY  L SI+  L + S+
Sbjct  716  MPELFRAMSDFSLECSRMYSELRSISQHLGQSSS  749



>gb|EYU21542.1| hypothetical protein MIMGU_mgv1a001881mg [Erythranthe guttata]
Length=745

 Score =   325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 204/268 (76%), Gaps = 0/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MWET++   ENQ  IV ALRSLD SQSPKETS+HH+ERT QLG VVQ+
Sbjct  475  PKLVALVDGMATMWETIRIQQENQSNIVQALRSLDTSQSPKETSDHHHERTRQLGGVVQD  534

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F +++  QKEYIR LN WLKLNLVPIDTN KEK +SP R  +PPI  LL+AW D +
Sbjct  535  WFTNFTELMSQQKEYIRALNTWLKLNLVPIDTNWKEKPTSPNRHHSPPIQTLLNAWHDHL  594

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE A+  I +F+A+V TI Q+Q +E++ +++C D+RK+L ++TR+FE WY+K+MQ+
Sbjct  595  EKLPDEPARATINNFAAIVKTIWQYQKEELEFRNKCSDSRKDLVRKTREFESWYNKFMQK  654

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P DDT+ D  H+ +++ ERQL +E  K +L+E+EE Y + C+QVR KSL SL++ LPE
Sbjct  655  RGPPDDTDPDRVHDSDHIAERQLIVEIAKHKLEEDEEGYRKLCVQVREKSLVSLKSHLPE  714

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNR  133
            LF A+SEFS ACS MY  L SI+HP +R
Sbjct  715  LFRALSEFSLACSDMYSNLRSISHPRHR  742



>ref|XP_011001614.1| PREDICTED: uncharacterized protein LOC105108845 [Populus euphratica]
Length=698

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 210/266 (79%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW+TM  HHE+Q +IV ALR LD+SQS KETSEHH++RT+QL VVVQE
Sbjct  426  PKLVQLVDGMATMWKTMLVHHEDQSKIVNALRFLDISQSSKETSEHHHDRTFQLLVVVQE  485

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQF K+I +QK YI+ LN WL+LNL+PI+++LKEKVSSP R +NPPI  L+ AW D +
Sbjct  486  WQSQFCKLIDNQKAYIKALNSWLRLNLIPIESSLKEKVSSPPRVRNPPIQPLIIAWHDFL  545

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A+TAI +F+AV++ I+QHQ +EMKLK++C++TRKEL ++TR+FE+W  KYM++
Sbjct  546  DKLPDEVARTAINTFAAVIHAILQHQEEEMKLKEKCEETRKELSQKTRKFEEWRRKYMRQ  605

Query  396  RTPND-DTE--QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP++ D E  +D  H D  + ERQ  ++A+K RLKEEEEAY + C+QVR KS+ SL+  
Sbjct  606  RTPDELDPERTEDNSHND-AIAERQSVVDAVKNRLKEEEEAYWKHCLQVREKSMASLKAR  664

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + ACS MY+ L SI+
Sbjct  665  LPELFRAMSEVAHACSEMYKNLRSIS  690



>gb|AAK96499.1| At1g52320/F19K6_7 [Arabidopsis thaliana]
 gb|AAN18183.1| At1g52320/F19K6_7 [Arabidopsis thaliana]
 dbj|BAD94485.1| bZIP protein [Arabidopsis thaliana]
Length=398

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 203/271 (75%), Gaps = 6/271 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  118  KLVHLVEAMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEW  177

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct  178  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD  237

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R
Sbjct  238  KIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKR  297

Query  393  TPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
             P   +  E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LP
Sbjct  298  GPEGMNPDEADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLP  356

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLNRES  127
            ELF AMSE + +CS MY+   +IT+   R+S
Sbjct  357  ELFQAMSEVAYSCSDMYR---AITYASKRQS  384



>ref|XP_006465528.1| PREDICTED: uncharacterized protein LOC102613887 [Citrus sinensis]
Length=736

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 210/267 (79%), Gaps = 1/267 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW TM+ HH++Q ++V AL+SLD+SQSPKETSEHH+ERT QL  VVQE
Sbjct  465  PKLVQLVDGMALMWGTMQFHHKSQSKVVTALKSLDISQSPKETSEHHHERTIQLWAVVQE  524

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+SQF K+I HQK YI+ LN WLKLNL+PI+++L+EKVSSP R Q PPI  LL AWQDL+
Sbjct  525  WNSQFCKLIDHQKAYIKALNSWLKLNLIPIESSLREKVSSPPRIQTPPIQRLLLAWQDLL  584

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A++AI +F+A++NTI+ HQ +EMKLK+RC++T+KEL ++TRQFEDWY+KY+ R
Sbjct  585  QKLPDEIARSAIGNFAALINTIMHHQEEEMKLKERCEETKKELSRKTRQFEDWYNKYITR  644

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RT  ++ + D     + V ER+  ++ LK+RL+EEEEAY RQC  VR KSLTSLR  LPE
Sbjct  645  RT-QEELDADDTTLKDAVTERKFVVDVLKKRLEEEEEAYQRQCGAVREKSLTSLRNHLPE  703

Query  216  LFHAMSEFSRACSIMYQTLESITHPLN  136
            LF AMSE S ACS MY+ L++I    N
Sbjct  704  LFKAMSEISFACSGMYRDLKNIAQHKN  730



>ref|XP_006427010.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
 gb|ESR40250.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
Length=736

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 209/267 (78%), Gaps = 1/267 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW TM+ HH++Q ++V AL+SLD+SQSPKETSEHH+ERT QL  VVQE
Sbjct  465  PKLVQLVDGMALMWGTMQFHHKSQSKVVTALKSLDISQSPKETSEHHHERTIQLWAVVQE  524

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+SQF K+I HQK YI+ LN WLKLNL+PI+++L+EKVSSP R Q PPI  LL AW DL+
Sbjct  525  WNSQFCKLIDHQKAYIKALNSWLKLNLIPIESSLREKVSSPPRIQTPPIQRLLLAWHDLL  584

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A++AI +F+A++NTI+ HQ +EMKLK+RC++T+KEL ++TRQFEDWY+KY+ R
Sbjct  585  QKLPDEIARSAIGNFAALINTIMHHQEEEMKLKERCEETKKELSRKTRQFEDWYNKYITR  644

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RT  ++ + D     + V ER+  ++ LK+RL+EEEEAY RQC  VR KSLTSLR  LPE
Sbjct  645  RT-QEELDADDTTLKDAVTERKFVVDVLKKRLEEEEEAYQRQCGAVREKSLTSLRNHLPE  703

Query  216  LFHAMSEFSRACSIMYQTLESITHPLN  136
            LF AMSE S ACS MY+ L++I    N
Sbjct  704  LFKAMSEISFACSGMYRDLKNIAQHKN  730



>ref|NP_001117469.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001117470.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_564604.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32782.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
 gb|AEE32784.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
 gb|AEE32785.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=472

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 203/271 (75%), Gaps = 6/271 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  192  KLVHLVEAMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEW  251

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct  252  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD  311

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R
Sbjct  312  KIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKR  371

Query  393  TPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
             P   +  E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LP
Sbjct  372  GPEGMNPDEADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLP  430

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLNRES  127
            ELF AMSE + +CS MY+   +IT+   R+S
Sbjct  431  ELFQAMSEVAYSCSDMYR---AITYASKRQS  458



>gb|KHM98761.1| hypothetical protein glysoja_030814 [Glycine soja]
Length=636

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 200/270 (74%), Gaps = 4/270 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ MA MW+TM  HH  Q + V  LR+LD+SQSPK TSEHHY+RTYQL +VVQ+
Sbjct  364  PRLVQLVDGMATMWKTMLEHHVKQSETVTLLRNLDISQSPKTTSEHHYDRTYQLFLVVQQ  423

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FE ++ HQK YI+ LN WLKLN++PI+++LKEKVSSP R ++PPI  LL+AW D +
Sbjct  424  WHSHFENLVNHQKGYIKALNTWLKLNIIPIESSLKEKVSSPPRVRSPPIQGLLYAWNDRL  483

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAI +F AV+ TI   Q +E+ LK +C+DTRKEL ++TRQFEDWY+KYMQ+
Sbjct  484  DKLPDELARTAIGNFVAVIETIYHQQQEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQK  543

Query  396  RTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            + P   N D  +D    D  V+ RQ  +E +K+RL++EEEAY RQC+QVR K+L SL+  
Sbjct  544  KIPDEYNPDRAEDANAPD-EVVTRQSAVEQVKKRLEDEEEAYARQCLQVRQKTLVSLKNR  602

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLN  136
            +PELF AMS+FS  CS MY  L  I+  L 
Sbjct  603  MPELFRAMSDFSLECSRMYSELRPISQNLG  632



>ref|XP_011026550.1| PREDICTED: uncharacterized protein LOC105127120 [Populus euphratica]
Length=755

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/266 (59%), Positives = 206/266 (77%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH++Q +IV  L+SLD++ + KET++HH+ERT QL  VVQ 
Sbjct  481  PKLVDLVDGMAKMWASMCLHHDSQLKIVTNLKSLDVNHAIKETTKHHHERTIQLLKVVQG  540

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ HQK+YI  L  WLKLNL+PI++NLKEK+SSP R QNPPI ALLH+W D +
Sbjct  541  WHSHFEKLVTHQKQYIHTLTSWLKLNLIPIESNLKEKISSPPRAQNPPIQALLHSWHDYL  600

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AVV TIV HQ +EMKLK++C++TR+E  ++++ FE+WY KYMQR
Sbjct  601  EKLPDELAKSAISSFAAVVETIVHHQEEEMKLKEKCEETRREFLRKSQAFEEWYQKYMQR  660

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D+T+ D   ED N   V ERQ  +E+LK+RL+EE EA+ + C+QVR KS+ SL+  
Sbjct  661  RTPTDETDADRG-EDANPNPVSERQFVVESLKKRLEEEIEAHGKHCLQVREKSVGSLKIR  719

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMS+++ ACS  Y+ L SIT
Sbjct  720  LPELFRAMSDYAHACSDAYEKLRSIT  745



>ref|XP_004305292.1| PREDICTED: uncharacterized protein LOC101294200 [Fragaria vesca 
subsp. vesca]
Length=733

 Score =   318 bits (814),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 203/264 (77%), Gaps = 4/264 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MWE M+ HHE+Q +IV ALRS D+SQ PK T++HH+ERT QL  VVQE
Sbjct  458  PKLVQLVAGMATMWEAMRCHHESQSKIVTALRSFDISQCPKYTTDHHHERTVQLWYVVQE  517

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF K++  QKEY++ L +WLKLNL+PI++NLKEKVSSP R QNPPI  LL  W D +
Sbjct  518  WHSQFVKLVSKQKEYVKALRNWLKLNLIPIESNLKEKVSSPPRIQNPPIQGLLLEWNDHL  577

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A+TAI++F+ +++TI+  Q +EMK+K++C+D+RKEL+++ RQFEDWYHKYM +
Sbjct  578  DKLPDEVARTAIHNFAGIIHTIMLKQEEEMKMKEKCEDSRKELDRKKRQFEDWYHKYMNK  637

Query  396  RTPNDDTEQDGPHED---NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
              P D+ + + P  +   + V E+Q  +E +++RL+EEEEAY R C+QVR KS+TSL+TG
Sbjct  638  NIP-DEVDPERPESNVRGDVVAEKQFNVEVVQKRLEEEEEAYARLCLQVREKSITSLKTG  696

Query  225  LPELFHAMSEFSRACSIMYQTLES  154
            LPELF A+  F+ +CS MY+ L S
Sbjct  697  LPELFRALVAFAVSCSEMYKHLNS  720



>gb|KHN10238.1| hypothetical protein glysoja_017842 [Glycine soja]
Length=547

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 205/272 (75%), Gaps = 2/272 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +L+  MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+QE
Sbjct  276  PKLVALIIEMANMWENMCIHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVIQE  335

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D +
Sbjct  336  WHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYV  395

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ R
Sbjct  396  DKLPDELAKSAISSFVAVIKTIILQQEEEMKLKERCEETRKEYFKKKQAFEEWYQKHLMR  455

Query  396  RTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P++   + G   + +N V ERQ  +E+LK+RL+EE E++ + C+QVR KSL SL+T L
Sbjct  456  RGPDEAEHERGEEVNANNPVSERQFVVESLKKRLEEEIESHQKHCVQVREKSLQSLKTRL  515

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNRES  127
            PELF A+S+++ AC+  Y+ L+ IT     E+
Sbjct  516  PELFRALSDYAHACADAYEKLKLITQSRGGEA  547



>ref|XP_004486732.1| PREDICTED: uncharacterized protein LOC101506888 isoform X1 [Cicer 
arietinum]
 ref|XP_004486733.1| PREDICTED: uncharacterized protein LOC101506888 isoform X2 [Cicer 
arietinum]
Length=753

 Score =   317 bits (812),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 205/274 (75%), Gaps = 3/274 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ MA MW+ M  HHE Q + V  L+SLD SQSPK+TSEHH+ERTYQL VVVQ+
Sbjct  480  PRLVQLVDEMATMWKKMLSHHEKQSETVTLLKSLDPSQSPKQTSEHHHERTYQLLVVVQQ  539

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ +QK YI+ LN+WLKLNL+PI++NLKEKVSSP R ++PP+  LLHAW D +
Sbjct  540  WHSQFEKLVNNQKGYIKSLNNWLKLNLIPIESNLKEKVSSPPRVRSPPVQGLLHAWHDRL  599

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+TAI +F+AV++TI   Q +EM  K +C+D+RKEL ++TRQF+DWYHKYMQR
Sbjct  600  EKLPDELARTAIGNFAAVLDTIFNQQDEEMIKKRKCEDSRKELARKTRQFDDWYHKYMQR  659

Query  396  RTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            +TP +   D  +D    D  V E+Q+ +E +++RL+ EE  Y +QC+QVR K+L SL+  
Sbjct  660  KTPEEFDPDKAEDPNAPDEVVTEKQILVEQVRKRLEAEEADYEKQCLQVRQKTLGSLKNR  719

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLNREST  124
            +PELF AM +FS  CS MY  L SI   L + S+
Sbjct  720  MPELFRAMCDFSLECSKMYIELCSIAQHLGQNSS  753



>ref|XP_006392932.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
 gb|ESQ30218.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
Length=790

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 202/266 (76%), Gaps = 5/266 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+MA+MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  508  KLVHLVEAMAKMWEMMQMHHQRQAEISKVLKSLDVSQAVKETNDHHHERTIQLLAVVQEW  567

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + 
Sbjct  568  HTQFCRMIDHQKAYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHIWYDRLD  627

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AV++TI+Q Q +E+KL+DRC++TRKEL ++ RQFEDWY+KYMQ+R
Sbjct  628  KIPDEMARTAIINFAAVISTIMQQQEEEIKLRDRCEETRKELGRKIRQFEDWYYKYMQKR  687

Query  393  TPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P +D   DG   DN+    V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT 
Sbjct  688  GP-EDMNPDGSEADNDHKDEVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSLASLRTR  746

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + +CS MY+ +  +T
Sbjct  747  LPELFQAMSEVAYSCSDMYRAVVYVT  772



>gb|KFK35788.1| hypothetical protein AALP_AA4G036700 [Arabis alpina]
Length=807

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 203/263 (77%), Gaps = 2/263 (1%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  488  KLVHLVEAMGKMWEMMQMHHQRQAEISKILKSLDVSQAVKETNDHHHERTIQLLAVVQEW  547

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct  548  HTQFCRMIDHQKEYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD  607

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AV++TI+Q Q +EMKL+DRC++T+KEL ++ RQFE+WY+KYMQ+R
Sbjct  608  KIPDEMARTAIINFAAVISTIMQQQEEEMKLRDRCEETKKELARKIRQFEEWYYKYMQKR  667

Query  393  TPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
             P +DT  DG   D + V+ RQ  +E +K+RL+EEEE+Y RQ  QVR KSL SLRT LPE
Sbjct  668  GP-EDTNPDGTEVDKDEVVVRQFNVEQIKKRLEEEEESYHRQSHQVREKSLASLRTRLPE  726

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF AMSE + +CS MY+ +  +T
Sbjct  727  LFQAMSEVAYSCSDMYRAVAYVT  749



>ref|XP_003603595.1| hypothetical protein MTR_3g109450 [Medicago truncatula]
 gb|AES73846.1| BZIP protein [Medicago truncatula]
Length=712

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 205/264 (78%), Gaps = 1/264 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  MA MWE M  HH++Q +IV  L+SLD+SQ  KET++HHY+RT QL  V+QE
Sbjct  443  PKLVALVIGMANMWENMFMHHDSQLKIVTDLKSLDISQDHKETTKHHYDRTVQLWNVIQE  502

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQFEK++  QK YI+ L  WLKLNL+PI++NLKEK+SSP R QNPPI ALL+AW D +
Sbjct  503  WESQFEKLVTQQKHYIQALFSWLKLNLIPIESNLKEKISSPPRAQNPPIQALLYAWHDYL  562

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+  Q +EMKLK++C++TRKE  ++ + FE+WY K++QR
Sbjct  563  DKLPDELAKSAITSFAAVIKTIILQQEEEMKLKEKCEETRKEFLRKNQAFEEWYQKHLQR  622

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P DD E+D  + +N V E+Q  +E+LK+RL+EE E++ + C+QVR KSL SL+T LPE
Sbjct  623  RGP-DDPERDDVNTNNPVSEKQFVVESLKKRLEEETESHKKLCVQVREKSLQSLKTRLPE  681

Query  216  LFHAMSEFSRACSIMYQTLESITH  145
            LF A+S++++ACS  Y+ L+SI H
Sbjct  682  LFRALSDYTQACSDAYEKLKSIAH  705



>ref|XP_002308623.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
 gb|EEE92146.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
Length=767

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 206/267 (77%), Gaps = 5/267 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH++Q  IV  L+SLD++ + KETS+HH+ERT QL  VVQ 
Sbjct  493  PKLVCLVDGMAKMWASMCMHHDSQLNIVTDLKSLDVNHAIKETSKHHHERTIQLWKVVQG  552

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ HQK+YI  L  WLKLNL+PI+++LKEK SSP R QNPPI ALLH+W D +
Sbjct  553  WHSQFEKLVTHQKQYIHTLTSWLKLNLIPIESSLKEKTSSPLRAQNPPIQALLHSWHDNL  612

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAK+AI+SF+AV+ TIV+HQ +EMKLK++C++TRKEL ++ + FE+W+ KYMQR
Sbjct  613  EKLPDDLAKSAIFSFAAVIETIVRHQEEEMKLKEKCEETRKELLRKNQAFEEWHQKYMQR  672

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D T+ D   ED N   V ERQL +E+L  RLKEE EA+ + C+QVR KS+ SL+  
Sbjct  673  RTP-DGTDADRG-EDTNPNPVSERQLAVESLNIRLKEELEAHQKHCLQVREKSVGSLKLR  730

Query  225  LPELFHAMSEFSRACSIMYQTLESITH  145
            LPELF A+S+++ ACS  Y+ L SITH
Sbjct  731  LPELFRALSDYAHACSDSYEKLRSITH  757



>ref|XP_002324252.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
 gb|EEF02817.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
Length=764

 Score =   314 bits (805),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 204/266 (77%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH++Q +IV  L+SLD++ + KET++HH+ERT QL  VVQ 
Sbjct  490  PKLVDLVDGMAKMWASMCMHHDSQLKIVTNLKSLDVNHAIKETTKHHHERTIQLLKVVQG  549

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W S FEK++ HQK+YI  L  WLKLNL+PI+++LKEK+SSP R QNPPI ALLH+W D +
Sbjct  550  WLSHFEKLVTHQKQYIHTLTSWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHSWHDYL  609

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AVV TIV HQ +EMKLK++C++TR+E  ++ + FE+WY KYMQR
Sbjct  610  EKLPDELAKSAISSFAAVVETIVHHQEEEMKLKEKCEETRREFMRKNQAFEEWYQKYMQR  669

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D+T+ D   ED N   V ERQ  +E+LK+RL+EE EA+ + C+QVR KS+ SL+  
Sbjct  670  RTPTDETDADR-GEDANPNPVSERQFVVESLKKRLEEEIEAHGKHCLQVREKSVGSLKIR  728

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMS+++ ACS  Y+ L SIT
Sbjct  729  LPELFRAMSDYAHACSDAYEKLRSIT  754



>emb|CDY52975.1| BnaA06g01600D [Brassica napus]
Length=747

 Score =   314 bits (804),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 199/262 (76%), Gaps = 5/262 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  455  KLLHLVEAMGKMWEMMQMHHQRQAEISKVLRSLDISQAVKETNDHHHERTIQLLAVVQEW  514

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI +QK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + 
Sbjct  515  HTQFCRMIDNQKMYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHVWYDRLD  574

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AVV+TI+Q Q +EMKL+DRC++TRKEL ++ RQFEDWYHKYMQ+R
Sbjct  575  KIPDEMARTAIINFAAVVSTIMQQQEEEMKLRDRCEETRKELGRKIRQFEDWYHKYMQKR  634

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KS+ SLRT 
Sbjct  635  GPEDMNADGSEGDNEHKD-EVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSIASLRTR  693

Query  225  LPELFHAMSEFSRACSIMYQTL  160
            LPELF AMSE + +CS MY+ +
Sbjct  694  LPELFQAMSEVAYSCSGMYRAV  715



>ref|XP_003523728.1| PREDICTED: formin-like protein 8-like [Glycine max]
Length=699

 Score =   312 bits (800),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 205/272 (75%), Gaps = 2/272 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +L+  MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+QE
Sbjct  428  PKLVALIIEMANMWENMCIHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVIQE  487

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D +
Sbjct  488  WHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYV  547

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ R
Sbjct  548  DKLPDELAKSAISSFVAVIKTIILQQEEEMKLKERCEETRKEYFKKKQAFEEWYQKHLMR  607

Query  396  RTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P++   + G   + +N V ERQ  +E+LK+RL+EE E++ + C+QVR KSL SL+T L
Sbjct  608  RGPDEAEHERGEEVNANNPVSERQFVVESLKKRLEEEIESHQKHCVQVREKSLQSLKTRL  667

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNRES  127
            PELF A+S+++ AC+  Y+ L+ IT     E+
Sbjct  668  PELFRALSDYAHACADAYEKLKLITQSRGGEA  699



>ref|XP_007150659.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
 gb|ESW22653.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
Length=744

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/274 (56%), Positives = 202/274 (74%), Gaps = 3/274 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +A MW+ M  +HE Q   V  L+ LD+SQSPK+TS+HH++RTYQL +VVQ+
Sbjct  471  PRLVQLVDGIAEMWKLMLEYHEKQSDTVKLLKMLDISQSPKQTSDHHHDRTYQLLLVVQQ  530

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFE +  HQK YI  LN WLKLNL+PI+++LKEKVSSP R ++ PI  LL AW D +
Sbjct  531  WHSQFEMLANHQKGYIMALNTWLKLNLIPIESSLKEKVSSPPRVRSTPIQGLLLAWNDRL  590

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAKT I +F AV++TI   Q DE+ +K +C+DTRKEL ++TRQFEDWY+KYMQ+
Sbjct  591  EKLPDELAKTNIGNFVAVIDTIFHQQADEITMKRKCEDTRKELSRKTRQFEDWYNKYMQK  650

Query  396  RTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            + P   N DT +D    D  V ERQ+ +E +K+RL++EEEAY RQC+QVR K+L SL+  
Sbjct  651  KIPDEYNPDTAEDSNGPDEAVTERQVAVEQVKKRLEDEEEAYARQCLQVRQKTLGSLKNL  710

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLNREST  124
            +P+LF AMS+FS  CS MY  L SI+  L + S+
Sbjct  711  MPDLFRAMSDFSLECSKMYSELRSISQNLGQSSS  744



>ref|XP_007012028.1| Golgin subfamily A member 4 [Theobroma cacao]
 gb|EOY29647.1| Golgin subfamily A member 4 [Theobroma cacao]
Length=741

 Score =   313 bits (802),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 202/266 (76%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MW +M  HH +Q QIV  L+ LD++ + KET++HH+ERT QL  VVQE
Sbjct  466  PKLVVLVHGMANMWASMCIHHNSQLQIVEKLKPLDIAHASKETTKHHHERTIQLHNVVQE  525

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+K++ HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R QNPPI ALLHAW D +
Sbjct  526  WHLQFDKLVTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHAWHDYL  585

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK++I SF+AV+ TI+ HQ +EMKLK++C++TRKE  ++ + FE+WY KY QR
Sbjct  586  EKLPDEVAKSSILSFAAVIKTIIIHQDEEMKLKEKCEETRKEFFRKNQAFEEWYQKYKQR  645

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RT +D+ + +   + N    V ERQ  +++LK+RL+EE EAY + C+QVR KSL SL+  
Sbjct  646  RTASDEIDAERGEDANAKDPVSERQFAVDSLKKRLEEEVEAYQKHCIQVREKSLGSLKIR  705

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMS++SRACS  Y+ L +IT
Sbjct  706  LPELFRAMSDYSRACSDAYEKLRTIT  731



>ref|XP_009147692.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103871216 
[Brassica rapa]
Length=800

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 199/262 (76%), Gaps = 5/262 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  508  KLLHLVEAMGKMWEMMQMHHQRQAEISKVLRSLDISQAVKETNDHHHERTIQLLAVVQEW  567

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI +QK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + 
Sbjct  568  HTQFCRMIDNQKMYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHVWYDRLD  627

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AVV+TI+Q Q +EMKL+DRC++TRKEL ++ RQFEDWYHKYMQ+R
Sbjct  628  KIPDEMARTAIINFAAVVSTIMQQQEEEMKLRDRCEETRKELGRKIRQFEDWYHKYMQKR  687

Query  393  TPND----DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P D     +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KS+ SLRT 
Sbjct  688  GPEDMNAEGSEGDNEHKD-EVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSIASLRTR  746

Query  225  LPELFHAMSEFSRACSIMYQTL  160
            LPELF AMSE + +CS MY+ +
Sbjct  747  LPELFQAMSEVAYSCSGMYRAV  768



>ref|XP_002281782.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
 ref|XP_010648551.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
Length=707

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 207/266 (78%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA+MW  M   H +Q ++V  L+S+D+SQ+PKETS+HH+ERT QL   +Q 
Sbjct  432  PKLVALVDGMAKMWNDMCMQHNSQLKMVTDLKSIDISQAPKETSKHHHERTIQLWNEIQG  491

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ H+K+YI+ LN WLKLNL+PI+++LKEK+SSP RPQ+PPI ALLH+W D +
Sbjct  492  WHSQFEKLVTHEKQYIQALNSWLKLNLIPIESSLKEKISSPPRPQHPPIQALLHSWHDSL  551

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLP ELAK+AI SF+AV+ TI+ HQ +EMKLK++C++T+KE  ++ + F+DWY KYMQR
Sbjct  552  EKLPHELAKSAISSFAAVIKTIILHQEEEMKLKEKCEETQKEYSRKHQAFQDWYQKYMQR  611

Query  396  RTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D+T+ +   E N    + E+Q  +E+LK++L+EE EA+ R C+QVR KSL SL+  
Sbjct  612  RTPPDETDPEKGDEANPKDPISEKQFVVESLKKKLEEEVEAHQRHCVQVREKSLGSLKLR  671

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF A+++++ ACS  YQ L++IT
Sbjct  672  LPELFRALTDYTHACSDAYQRLKAIT  697



>ref|XP_002516584.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45925.1| conserved hypothetical protein [Ricinus communis]
Length=728

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 204/267 (76%), Gaps = 3/267 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M+ HH++Q +IV  L+SLD+S + KET+ HH+ RT QL  VVQE
Sbjct  453  PKLVDLVDGMAKMWASMRVHHDSQLKIVTDLKSLDVSHAVKETTNHHHARTKQLYNVVQE  512

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF+K++ HQK+YI+ L  WLKLNL+PI+++LKEK+SSP +  NPPI ALL++W D +
Sbjct  513  WHTQFDKLLTHQKQYIQILKSWLKLNLIPIESSLKEKISSPPKIPNPPIQALLYSWHDHL  572

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI  HQ +EMKLK++C++TRKE  ++ + F+DWY K+MQR
Sbjct  573  EKLPDEVAKSAISSFAAVIKTIELHQEEEMKLKEKCEETRKEFLRKNQAFDDWYQKHMQR  632

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P D+TE D   + N+   V ERQ  +E+LK+RL+EE E Y R C+QVR KSL SL+  
Sbjct  633  RNPTDETEADRGEDANSRDLVSERQFAVESLKKRLEEEVETYQRHCLQVREKSLGSLKIR  692

Query  225  LPELFHAMSEFSRACSIMYQTLESITH  145
            LPELF AMS+++ ACS  Y+ L ++TH
Sbjct  693  LPELFRAMSDYAYACSDAYEKLRALTH  719



>ref|XP_011007598.1| PREDICTED: uncharacterized protein LOC105113217 [Populus euphratica]
Length=688

 Score =   310 bits (795),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 212/269 (79%), Gaps = 2/269 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW+TM+ HHE Q +IV ALR+LD+SQSPKETSEHH++RT+QL VVVQ 
Sbjct  418  PKLVELVDGMATMWDTMRYHHEAQSKIVNALRALDISQSPKETSEHHHDRTFQLLVVVQG  477

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQF K+I +QK Y++ LN WLKLNL+PI+++LKEKVSSP R QNPPI +LL AW D +
Sbjct  478  WQSQFCKLIDNQKGYVKALNCWLKLNLIPIESSLKEKVSSPPRVQNPPIQSLLIAWHDFL  537

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A++AI +F++V++ I+Q+Q +EMKLK++C++TRKEL ++T++F+ WY K+MQ+
Sbjct  538  DKLPDEVARSAINNFASVIHAILQNQEEEMKLKEKCEETRKELSQKTKKFQSWYRKHMQQ  597

Query  396  RTPND-DTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            + P + D E      DN+ V +RQ  ++A+K+RL+EEEEAY +Q +QVR KSL SL+T L
Sbjct  598  KMPAEFDPELTEDKSDNDAVADRQFAVDAVKKRLEEEEEAYKKQRIQVREKSLASLKTRL  657

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLN  136
            P+LF AM + ++ACS MY+ L+ I+   N
Sbjct  658  PDLFRAMFDIAQACSEMYRNLKFISQRRN  686



>gb|KHN18210.1| hypothetical protein glysoja_025100 [Glycine soja]
Length=625

 Score =   308 bits (790),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 203/265 (77%), Gaps = 2/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+ E
Sbjct  354  PKLVALVIEMANMWENMCLHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVILE  413

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D +
Sbjct  414  WHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYV  473

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ R
Sbjct  474  DKLPDELAKSAISSFAAVIKTILLQQEEEMKLKERCEETRKEYLKKKQAFEEWYQKHLMR  533

Query  396  RTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P++   + G   + +N V ERQ  +E+L++RL+EE E++ + C+QVR KSL SL+T L
Sbjct  534  RGPDEAEHERGEEVNTNNPVSERQFVVESLQKRLEEEIESHQKHCIQVREKSLQSLKTRL  593

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PELF A+S+++ AC+  Y+ L+ IT
Sbjct  594  PELFRALSDYAHACAEAYEKLKLIT  618



>emb|CDY61085.1| BnaC06g41130D [Brassica napus]
Length=746

 Score =   311 bits (797),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 198/262 (76%), Gaps = 5/262 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  454  KLLHLVEAMGKMWEMMQMHHQRQAEISKLLKSLDISQAVKETNDHHHERTIQLLAVVQEW  513

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI +QK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + 
Sbjct  514  HTQFCRMIDNQKMYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHIWYDRLD  573

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AVV+TI+Q Q +EMKL+DRC +TRKEL ++ RQFEDWYHKYMQ+R
Sbjct  574  KIPDEMARTAIINFAAVVSTIMQQQEEEMKLRDRCGETRKELGRKIRQFEDWYHKYMQKR  633

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KS+ SLRT 
Sbjct  634  GPEDMNADGSEADNEHKD-EVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSIASLRTR  692

Query  225  LPELFHAMSEFSRACSIMYQTL  160
            LPELF AMSE + +CS MY+ +
Sbjct  693  LPELFQAMSEVAYSCSGMYRAV  714



>ref|NP_849796.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51544.1|AC037424_9 bZIP protein, putative; 48652-45869 [Arabidopsis thaliana]
 gb|AEE32783.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=798

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 204/272 (75%), Gaps = 8/272 (3%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  518  KLVHLVEAMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEW  577

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct  578  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD  637

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R
Sbjct  638  KIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKR  697

Query  393  TP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
             P   N D E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT L
Sbjct  698  GPEGMNPD-EADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRL  755

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNRES  127
            PELF AMSE + +CS MY+   +IT+   R+S
Sbjct  756  PELFQAMSEVAYSCSDMYR---AITYASKRQS  784



>ref|XP_011019684.1| PREDICTED: uncharacterized protein LOC105122326 [Populus euphratica]
Length=763

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 204/267 (76%), Gaps = 5/267 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH++Q  IV  L+SLD++ + KETS+HH+ERT QL  VVQ 
Sbjct  489  PKLVYLVDGMAKMWASMCMHHDSQLNIVTDLKSLDVNHAIKETSKHHHERTIQLWKVVQG  548

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ HQK+YI  L  WLKLNL+PI+++LKEK SSP R QNPPI ALLH+W D +
Sbjct  549  WHSQFEKLVTHQKQYIHTLTSWLKLNLIPIESSLKEKTSSPPRAQNPPIQALLHSWHDNL  608

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAK+AI SF+AV  TIV HQ +EMKLK++C++TRKEL ++ + F++W+ KYMQR
Sbjct  609  EKLPDDLAKSAILSFAAVKETIVHHQEEEMKLKEKCEETRKELLRKNQAFKEWHQKYMQR  668

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D T+ D   ED N   V ERQL +E+L  RLKEE EA+ + C+QVR KS+ SL+  
Sbjct  669  RTP-DGTDADRG-EDTNPDPVSERQLAVESLNIRLKEEVEAHQKHCLQVREKSVGSLKLR  726

Query  225  LPELFHAMSEFSRACSIMYQTLESITH  145
            LPELF A+S+++RACS  Y+ L SITH
Sbjct  727  LPELFRALSDYARACSDSYEKLRSITH  753



>dbj|BAF00450.1| putative bZIP protein [Arabidopsis thaliana]
Length=798

 Score =   312 bits (799),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 204/272 (75%), Gaps = 8/272 (3%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  518  KLVHLVEAMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEW  577

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct  578  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD  637

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R
Sbjct  638  KIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKR  697

Query  393  TP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
             P   N D E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT L
Sbjct  698  GPEGMNPD-EADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRL  755

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNRES  127
            PELF AMSE + +CS MY+   +IT+   R+S
Sbjct  756  PELFQAMSEVAYSCSDMYR---AITYASKRQS  784



>ref|XP_010251918.1| PREDICTED: uncharacterized protein LOC104593650 [Nelumbo nucifera]
Length=740

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 203/266 (76%), Gaps = 5/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SLV++MA MWE+M  HH++Q +IV  LR+LD+S +PKETSEHH+ERT QL  VVQE
Sbjct  465  PKLVSLVDAMANMWESMHAHHDSQLKIVSDLRALDLSHAPKETSEHHHERTVQLCRVVQE  524

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQKEYIR LN+WLKLNL+PI+++LKEKVSSP R   PPI +LLHAW D +
Sbjct  525  WHSQFQKLVTHQKEYIRALNNWLKLNLIPIESSLKEKVSSPLRVHRPPIQSLLHAWHDNL  584

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLP ELA TAI +F+AV+ TI+ HQ DEMKLK++ ++T KE  ++ + FE+W+ KYMQR
Sbjct  585  EKLPYELAGTAISTFAAVIKTIIVHQEDEMKLKEKWEETNKEYIRKKQAFEEWHQKYMQR  644

Query  396  RTPNDDTE----QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            RT +D+ +    +D  H+D  V E+Q  +E L++RL+EE EA+ + C QVR KS  SL+ 
Sbjct  645  RTQSDEMDPERAEDANHKD-PVTEKQFVVETLRKRLEEEIEAHQKLCRQVREKSAGSLKM  703

Query  228  GLPELFHAMSEFSRACSIMYQTLESI  151
             LPELF AMS+F+ ACS MY  L SI
Sbjct  704  HLPELFRAMSDFAFACSDMYNRLRSI  729



>ref|XP_008362706.1| PREDICTED: uncharacterized protein LOC103426389 isoform X1 [Malus 
domestica]
Length=744

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 205/263 (78%), Gaps = 2/263 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE M  MW TM+ HHE Q +IV ALRSLD+SQ PK TSEHH+ERT QL  VVQ 
Sbjct  469  PKLVQLVEGMXSMWGTMRAHHETQSKIVTALRSLDISQCPKHTSEHHHERTIQLFGVVQG  528

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH +FEK++  QKEYI+ LN+WLKLNL+PI++NLKEKVSSP R Q PPI  LL AW D +
Sbjct  529  WHGEFEKLVSQQKEYIKALNNWLKLNLIPIESNLKEKVSSPPRIQRPPIQELLLAWHDHL  588

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD++A+ AI++F+AV+NTI+ HQ +E+K+K++C+DTRKEL ++ RQFEDWY+K M +
Sbjct  589  EKLPDDVARMAIHNFAAVINTIMIHQEEEIKMKEKCEDTRKELSRKARQFEDWYNKNMHK  648

Query  396  RTPND-DTEQDGPHEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
              P++ DT++   H  ++V+ E+Q  +E +K+RL+EEEE+Y R C+QVR KS+ SL+T L
Sbjct  649  TIPDEGDTDRPEGHTRSDVVAEKQFAVETVKKRLEEEEESYERLCLQVREKSIASLKTRL  708

Query  222  PELFHAMSEFSRACSIMYQTLES  154
            PELF  +S+F+ +CS MY++L S
Sbjct  709  PELFGVLSDFAYSCSEMYRSLRS  731



>ref|XP_010462070.1| PREDICTED: uncharacterized protein LOC104742736 [Camelina sativa]
Length=808

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/266 (57%), Positives = 201/266 (76%), Gaps = 5/266 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LV++M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  526  KLLHLVDAMGKMWEMMQKHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEW  585

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +M+ HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LLH W D + 
Sbjct  586  HTQFCRMVDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHVWYDRLD  645

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWY+KYMQ+R
Sbjct  646  KIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRKIRQFEDWYYKYMQKR  705

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT 
Sbjct  706  GPEGMNPDGSEADNNHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTR  764

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + +CS MY+ +  +T
Sbjct  765  LPELFQAMSEVAYSCSDMYRAVTYVT  790



>gb|KJB54879.1| hypothetical protein B456_009G052500 [Gossypium raimondii]
Length=736

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW  M  HH++Q +IV  L+SLD++ + KET++HH+ERT QL  VVQE
Sbjct  460  PKLFMLVDGMANMWARMCMHHDSQLKIVEKLKSLDIAFASKETTKHHHERTIQLHNVVQE  519

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQK+YI+ LN+WLKLNL+PI+++LKEKVSSP R QNPPI  LLH W D +
Sbjct  520  WHSQFDKLVTHQKQYIQALNNWLKLNLIPIESSLKEKVSSPPRAQNPPIQKLLHTWHDYL  579

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TRKE  ++++ FE+WYHKY QR
Sbjct  580  EKLPDEVAKSAISSFAAVIKTIIIHQEEEMKLKEKCEETRKEFLRKSQAFEEWYHKYRQR  639

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R+ +D+ + +   + N    V ERQ  +E+LK+RL+EE EA+ + C+QVR KSL SL+  
Sbjct  640  RSGSDEMDAERGEDANAKDPVSERQFAVESLKKRLEEEVEAHEKHCIQVREKSLGSLKIR  699

Query  225  LPELFHAMSEFSRACSIMYQTLESI  151
            LPELF AMS++S ACS  Y+ L ++
Sbjct  700  LPELFRAMSDYSHACSDAYEKLRTV  724



>ref|XP_002891687.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67946.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
Length=800

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 202/266 (76%), Gaps = 5/266 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  514  KLILLVEAMGKMWEMMQMHHQRQAEISKVLKSLDVSQAVKETNDHHHERTIQLLAVVQEW  573

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D I 
Sbjct  574  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRID  633

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AVV+TI+Q Q DE+ L+++C++T+KEL ++ RQFE+WY+KYMQ+R
Sbjct  634  KIPDEMARTAIINFAAVVSTIMQQQEDEINLRNKCEETKKELGRKIRQFEEWYYKYMQKR  693

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     + +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT 
Sbjct  694  GPEGMNPEGSEADNDHKD-EVMVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTR  752

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + +CS MY+ +  +T
Sbjct  753  LPELFQAMSEVAYSCSDMYRAVTYVT  778



>ref|XP_003527819.1| PREDICTED: uncharacterized protein LOC100807597 [Glycine max]
Length=711

 Score =   308 bits (789),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 203/265 (77%), Gaps = 2/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+ E
Sbjct  440  PKLVALVIEMANMWENMCLHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVILE  499

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D +
Sbjct  500  WHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYV  559

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ R
Sbjct  560  DKLPDELAKSAISSFAAVIKTILLQQEEEMKLKERCEETRKEYLKKKQAFEEWYQKHLMR  619

Query  396  RTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P++   + G   + +N V ERQ  +E+L++RL+EE E++ + C+QVR KSL SL+T L
Sbjct  620  RGPDEAEHERGEEVNTNNPVSERQFVVESLQKRLEEEIESHQKHCIQVREKSLQSLKTRL  679

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PELF A+S+++ AC+  Y+ L+ IT
Sbjct  680  PELFRALSDYAHACAEAYEKLKLIT  704



>ref|XP_003597769.1| hypothetical protein MTR_2g102050 [Medicago truncatula]
 gb|AES68020.1| BZIP protein [Medicago truncatula]
Length=760

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 201/273 (74%), Gaps = 2/273 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LVE MA MW+ M   HE Q + V  LRSLD SQSPK+TSEHH+ERTYQL VVVQ+
Sbjct  488  PRLVKLVEEMAAMWKKMLSEHEKQSETVTLLRSLDPSQSPKQTSEHHHERTYQLLVVVQQ  547

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFE ++ +QK YI+ L++WLKLNL+PI+++LKEKVSSP R ++PP+  LLHAW D +
Sbjct  548  WHLQFEMLVNNQKGYIKSLSNWLKLNLIPIESSLKEKVSSPPRVRSPPVQGLLHAWHDRL  607

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             K+PD+LA+TAI +F+AV++TI   Q DEM LK +C+++RKEL ++TRQFEDWYHKYMQR
Sbjct  608  EKIPDDLARTAIGNFAAVIDTIFNQQEDEMVLKRKCEESRKELSRKTRQFEDWYHKYMQR  667

Query  396  RTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            + P   D   +D    D  V E+Q  +E +++RL+ EE  Y +QC+QVR K+L SL+  +
Sbjct  668  KMPEEVDPEAEDANAPDEVVTEKQFLVEQVRKRLEHEEAEYEKQCIQVRQKTLGSLKNRM  727

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNREST  124
            PELF AM +FS  CS MY  L SI+  L + S+
Sbjct  728  PELFRAMCDFSLECSKMYMELGSISQHLGQNSS  760



>ref|XP_007024146.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024147.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024148.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26768.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26769.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26770.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=736

 Score =   308 bits (790),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 214/269 (80%), Gaps = 2/269 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWETMK  H++Q +IV  L+ LD+SQSPKETSEHH+ERT QL  +VQ+
Sbjct  463  PKLVQLVDGMATMWETMKVQHDSQFRIVTVLKDLDLSQSPKETSEHHHERTIQLLAIVQD  522

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF K++ HQK YI  LN+WL+LNLVPI+++LKEKVSSP R + PPIL LL AWQ+ +
Sbjct  523  WHMQFCKLVDHQKGYIIALNNWLRLNLVPIESSLKEKVSSPPRVETPPILGLLTAWQNQL  582

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A++AI +F+ V++TI+QHQLDEMKLK++C+++ KEL+++ RQF+DWYHKYMQR
Sbjct  583  EKLPDEIARSAINNFAHVLDTIMQHQLDEMKLKEKCEESEKELQRKERQFKDWYHKYMQR  642

Query  396  RTPND-DTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            RTP + D E+   + +N  V ERQ+ +EA+K+R +EE+EAY R C+QVR KS+ SL+T L
Sbjct  643  RTPEELDPERTEANPNNEAVTERQVMVEAVKKRWEEEKEAYQRLCIQVREKSMVSLKTRL  702

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLN  136
            PELF+AM+  ++ACS +Y  L SI+H  N
Sbjct  703  PELFNAMTGIAKACSKLYGELRSISHSKN  731



>gb|KDO51231.1| hypothetical protein CISIN_1g044677mg, partial [Citrus sinensis]
Length=250

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 193/245 (79%), Gaps = 1/245 (0%)
 Frame = -1

Query  870  NQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDW  691
            +Q ++V AL+SLD+SQSPKETSEHH+ERT QL  VVQEW+SQF K+I HQK YI+ LN W
Sbjct  1    SQSKVVTALKSLDISQSPKETSEHHHERTIQLWAVVQEWNSQFCKLIDHQKAYIKALNSW  60

Query  690  LKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTI  511
            LKLNL+PI+++L+EKVSSP R Q PPI  LL AW DL+ KLPDE+A++AI +F+A++NTI
Sbjct  61   LKLNLIPIESSLREKVSSPPRIQTPPIQRLLLAWHDLLQKLPDEIARSAIGNFAALINTI  120

Query  510  VQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ  331
            + HQ +EMKLK+RC++T+KEL ++TRQFEDWY+KY+ RRT  ++ + D     + V ER+
Sbjct  121  MHHQEEEMKLKERCEETKKELSRKTRQFEDWYNKYITRRT-QEELDADDTTLKDAVTERK  179

Query  330  LQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
              ++ LK+RL+EEEEAY RQC  VR KSLTSLR  LPELF AMSE S ACS MY+ L++I
Sbjct  180  FVVDVLKKRLEEEEEAYQRQCGAVREKSLTSLRNHLPELFKAMSEISFACSGMYRDLKNI  239

Query  150  THPLN  136
                N
Sbjct  240  AQHKN  244



>ref|XP_010942485.1| PREDICTED: uncharacterized protein LOC105060463 [Elaeis guineensis]
Length=734

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 199/271 (73%), Gaps = 4/271 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MWE M  HH+NQ + VL L+ LD+S +PKETS+HHY+RT QL  VV+ 
Sbjct  460  PKLVDLVDGMAKMWEAMYVHHDNQLKTVLNLKILDISNAPKETSQHHYKRTMQLFDVVKG  519

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQK+YI+ L+ WLK N++PI+++LKEKVSSP RP  PPI ALLHAW D +
Sbjct  520  WHSQFDKLVSHQKDYIQALSSWLKSNVIPIESSLKEKVSSPPRPHQPPIQALLHAWHDHL  579

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SFSAV+NTI+  Q +E+K K++C +TRKE  K+TR FEDWY KY  R
Sbjct  580  EKLPDELAKSAILSFSAVINTIMTLQQEELKQKEKCNETRKEYLKKTRAFEDWYSKYSHR  639

Query  396  RTP----NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R            +G  + + V+ER++ +E +K RL EEEE + + C QVR KS  SL+T
Sbjct  640  RAALSEEAGQEGGEGADQKDPVVERKIAVETVKSRLDEEEENHEKLCKQVREKSFGSLKT  699

Query  228  GLPELFHAMSEFSRACSIMYQTLESITHPLN  136
             LPELF AMS+F+ ACS MY+ L+SI+ P N
Sbjct  700  HLPELFRAMSDFAHACSEMYKMLKSISQPQN  730



>ref|XP_004292865.1| PREDICTED: uncharacterized protein LOC101308445 [Fragaria vesca 
subsp. vesca]
Length=722

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 201/268 (75%), Gaps = 4/268 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL ++M +MWE M  HH +Q  IV  L++LD+S +P ET++HH+ERT QL  VVQ 
Sbjct  447  PKLVSLADAMGKMWENMGAHHSSQLTIVTDLKALDISHTPMETTKHHHERTEQLFNVVQH  506

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS+FEK+++HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q PPI  LL AW D +
Sbjct  507  WHSEFEKLVLHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQRPPIQPLLLAWHDFL  566

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+A  SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++ + F+DWY KYMQR
Sbjct  567  EKLPDELAKSATSSFAAVIKTILLHQEEEMKLKEQFENTRKEFLRKNQAFDDWYQKYMQR  626

Query  396  RTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
              P +   +  +D  H+D  + ERQ  +E+LK++++EE EA+ R C+QVR KSL SL+T 
Sbjct  627  HGPGEADQERSEDANHKD-PIAERQFAVESLKKKMEEEAEAHQRHCIQVREKSLGSLKTR  685

Query  225  LPELFHAMSEFSRACSIMYQTLESITHP  142
            LPELF AMS+++ AC+  Y  L+S+T P
Sbjct  686  LPELFRAMSDYAHACADAYGKLKSVTMP  713



>ref|XP_010479738.1| PREDICTED: kinesin-related protein 4-like [Camelina sativa]
Length=804

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/266 (57%), Positives = 199/266 (75%), Gaps = 5/266 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LV++M +MWE M  HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  522  KLLHLVDAMGKMWEMMHLHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEW  581

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +M+ HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LL  W D + 
Sbjct  582  HTQFCRMVDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLTVWYDRLD  641

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKYMQ+R
Sbjct  642  KIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRKIRQFEDWYHKYMQKR  701

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT 
Sbjct  702  GPEGMNPDGSEADNDHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTR  760

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + +CS MY+ +  +T
Sbjct  761  LPELFQAMSEVAYSCSDMYRAVTYVT  786



>ref|XP_007137162.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
 gb|ESW09156.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
Length=694

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 200/265 (75%), Gaps = 2/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  M  MWE M  +H++Q +IV  ++SLD+SQ+PKET++HHYERT QL  V+QE
Sbjct  423  PKLVALVVEMGNMWEHMCSYHDSQLKIVTDIKSLDISQAPKETTKHHYERTVQLWNVIQE  482

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++  QK YI+ LN WLKLNL+PI+ NLKEK+SSP + QNPPI ALLHAW D +
Sbjct  483  WHLQFEKLVSQQKHYIKALNSWLKLNLIPIERNLKEKISSPPKAQNPPIQALLHAWHDYV  542

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ R
Sbjct  543  DKLPDELAKSAISSFAAVIKTIILQQEEEMKLKERCEETRKEYLKKKQAFEEWYQKHLMR  602

Query  396  RTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            + P D   + G   +  N V +RQ  +E+L+++L+EE E++ +QC+QVR KSL S +T L
Sbjct  603  KGPEDAEHERGEEVNTHNPVSDRQFVVESLQKKLEEEIESHQKQCVQVREKSLQSFKTRL  662

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PELF A+S++S AC   Y+ L+SIT
Sbjct  663  PELFRALSDYSHACFDAYEKLKSIT  687



>ref|XP_010500831.1| PREDICTED: uncharacterized protein LOC104778154 [Camelina sativa]
Length=809

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/266 (57%), Positives = 200/266 (75%), Gaps = 5/266 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LV++M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  527  KLLHLVDAMGKMWEMMQKHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEW  586

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LL  W D + 
Sbjct  587  HTQFCRMIDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLTVWYDRLD  646

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWY+KYMQ+R
Sbjct  647  KIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRKIRQFEDWYYKYMQKR  706

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT 
Sbjct  707  GPEGMNPDGSEADNDHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTR  765

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + +CS MY+ +  +T
Sbjct  766  LPELFQAMSEVAYSCSDMYRAVTYVT  791



>ref|XP_008447501.1| PREDICTED: uncharacterized protein LOC103489933 [Cucumis melo]
Length=736

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 200/264 (76%), Gaps = 2/264 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+E
Sbjct  470  PKLVQLVNGMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVRE  529

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++  QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D +
Sbjct  530  WHSQFEKLVRCQKDYIKSLNSWLKLNLIPIESSLKEKVSSPPRVQNPPIQKLLLAWHDQL  589

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LPDE  +TAI++F AV+NTI+  Q +E KLK + ++T KEL+++ R F+DW++KY QR
Sbjct  590  ERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELDRKQRHFDDWHYKYQQR  649

Query  396  RTPND-DTEQDGPH-EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P+D D E+     +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+  L
Sbjct  650  RIPDDMDPERSEERTQDAAVTEKSIAVESLKKRLEEEKETHAKQCLHVREKSLVSLKNQL  709

Query  222  PELFHAMSEFSRACSIMYQTLESI  151
            PELF A+SEFS A S MY++L SI
Sbjct  710  PELFRALSEFSFASSEMYKSLSSI  733



>gb|KJB13152.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
 gb|KJB13153.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
Length=742

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/270 (59%), Positives = 207/270 (77%), Gaps = 3/270 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRS-LDMSQSPKETSEHHYERTYQLGVVVQ  760
            PKL  LVE M  MWETM+  H++QC+IV  LR  LD+SQS +ETSEHH+ERT QL  +VQ
Sbjct  468  PKLVELVEKMVIMWETMREEHDSQCRIVAILRDHLDLSQSAQETSEHHHERTIQLLAIVQ  527

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
            +WH QF K+I HQKEYI+ LN+WL+LNL+PI+++LKEKVSSP R ++PPI  L+ AWQD 
Sbjct  528  DWHMQFCKLIDHQKEYIKALNNWLRLNLIPIESSLKEKVSSPPRVESPPIQRLIFAWQDK  587

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
            + KLPDE+A++AI +F+ V++ I+QHQLDEMKLK++C+ ++KEL+K+ +QFEDWY+KYMQ
Sbjct  588  LDKLPDEIARSAINNFAHVIDAIMQHQLDEMKLKEKCEGSQKELKKKQQQFEDWYNKYMQ  647

Query  399  RRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RRTP   D T  D    ++ V ERQL ++A+K+RL EEEEAY    +QVR KSL SL+T 
Sbjct  648  RRTPEELDPTRTDDNSNNDAVTERQLMVDAVKKRLGEEEEAYRILRIQVREKSLVSLKTR  707

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLN  136
            LPELF AMS  + ACS MY  L +I+   N
Sbjct  708  LPELFRAMSTIAVACSKMYGELRAISRSRN  737



>ref|XP_006306796.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
 gb|EOA39694.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
Length=801

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 201/266 (76%), Gaps = 5/266 (2%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  519  KLLHLVEAMGKMWEMMQMHHQRQAEISKVLRSLDISQAVKETNDHHHERTIQLLAVVQEW  578

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LL  W D + 
Sbjct  579  HTQFCRMIDHQKEYIKALLGWLKLNLIPIESTLKEKVSSPPRVPNPAIHKLLTIWYDRLD  638

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR  394
            K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFE+WY+KYMQ+R
Sbjct  639  KIPDEMARTAIINFAAVISTIMQQQEDEISLRNKCEETRKELGRKIRQFEEWYYKYMQKR  698

Query  393  TPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
             P     D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT 
Sbjct  699  GPEGMNPDGSEADNDHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTR  757

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMSE + +CS MY+++  +T
Sbjct  758  LPELFQAMSEVAYSCSDMYRSVTYMT  783



>gb|KDP34224.1| hypothetical protein JCGZ_07795 [Jatropha curcas]
Length=751

 Score =   303 bits (777),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 201/266 (76%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE MA+MW +M  HH++Q +IV  L+SLD+S S KET+  H++RT QL  VVQE
Sbjct  476  PKLVDLVEGMAKMWASMCAHHDSQLKIVTDLKSLDVSHSAKETTRQHHDRTKQLHNVVQE  535

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ +QK+YI+ LN WLKLNL+PI+++LKEK+SSP +  NPPI  LLH W D +
Sbjct  536  WHSHFEKLVTYQKQYIQILNSWLKLNLIPIESSLKEKISSPPKVPNPPIQPLLHTWHDYL  595

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI  HQ +EMKLK++C++TRKE  +R++ F++WY K+MQR
Sbjct  596  EKLPDEVAKSAISSFAAVIKTIELHQEEEMKLKEKCEETRKEFLRRSQAFDEWYQKHMQR  655

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D+ + +   + N    V ERQ  +E+LK+RL+EE EA+ R C+QVR KSL SL+  
Sbjct  656  RTPTDEIDAERGEDANAKDPVYERQSAVESLKKRLEEEIEAHQRHCVQVREKSLGSLKIR  715

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMS+++ ACS  Y+ L ++T
Sbjct  716  LPELFRAMSDYAHACSDAYEKLRALT  741



>ref|XP_004172478.1| PREDICTED: uncharacterized protein LOC101231290 [Cucumis sativus]
Length=696

 Score =   302 bits (773),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 196/264 (74%), Gaps = 2/264 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  M  MW+TM+ HHE Q +IV ALR LD+SQSPKETS HH+ERT QL  VV+E
Sbjct  430  PKLVQLVHGMMLMWDTMRMHHEEQLKIVNALRYLDLSQSPKETSLHHHERTVQLCNVVRE  489

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK+   QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D +
Sbjct  490  WHSQFEKLAYRQKDYIKALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQRLLTAWHDQL  549

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE  +TAI SFSAV++TI+  Q +EMKLK RC +T KEL ++ RQF+DW++KY QR
Sbjct  550  EKLPDEHLRTAISSFSAVISTIMLQQEEEMKLKLRCDETEKELMRKQRQFDDWHYKYQQR  609

Query  396  RTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P+  D  + +   +D  V ER + +E+LK+RL+EE+E + +QC+ VR KSL SL+  L
Sbjct  610  RMPDELDPEKSEENSQDAAVTERLVVVESLKKRLEEEKETHAKQCLHVREKSLVSLKNQL  669

Query  222  PELFHAMSEFSRACSIMYQTLESI  151
            PELF A+SEFS A S MY+ L  I
Sbjct  670  PELFRALSEFSSAGSDMYKNLRLI  693



>ref|XP_004150356.1| PREDICTED: uncharacterized protein LOC101203914 [Cucumis sativus]
 gb|KGN58063.1| hypothetical protein Csa_3G481230 [Cucumis sativus]
Length=722

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 196/264 (74%), Gaps = 2/264 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  M  MW+TM+ HHE Q +IV ALR LD+SQSPKETS HH+ERT QL  VV+E
Sbjct  456  PKLVQLVHGMMLMWDTMRMHHEEQLKIVNALRYLDLSQSPKETSLHHHERTVQLCNVVRE  515

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK+   QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D +
Sbjct  516  WHSQFEKLAYRQKDYIKALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQRLLTAWHDQL  575

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE  +TAI SFSAV++TI+  Q +EMKLK RC +T KEL ++ RQF+DW++KY QR
Sbjct  576  EKLPDEHLRTAISSFSAVISTIMLQQEEEMKLKLRCDETEKELMRKQRQFDDWHYKYQQR  635

Query  396  RTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P+  D  + +   +D  V ER + +E+LK+RL+EE+E + +QC+ VR KSL SL+  L
Sbjct  636  RMPDELDPEKSEENSQDAAVTERLVVVESLKKRLEEEKETHAKQCLHVREKSLVSLKNQL  695

Query  222  PELFHAMSEFSRACSIMYQTLESI  151
            PELF A+SEFS A S MY+ L  I
Sbjct  696  PELFRALSEFSSAGSDMYKNLRLI  719



>gb|KJB65700.1| hypothetical protein B456_010G109200 [Gossypium raimondii]
Length=726

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW +M  HH+ Q ++V  L+SLD++ S KET++ H++ T QL  VVQE
Sbjct  453  PKLVMLVDGMANMWASMCIHHDRQLKVVEKLKSLDVALSSKETTKQHHDWTIQLHNVVQE  512

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF K++ +QK+YI  LN+WLKLNL+PI+++LKEK+SSP R QNPPI ALLHAW D +
Sbjct  513  WHSQFNKLVTNQKQYILALNNWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHAWHDCL  572

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TRKE  ++++ FE+WYHKY QR
Sbjct  573  EKLPDEVAKSAISSFAAVIKTIIIHQDEEMKLKEKCEETRKEFLRKSQAFEEWYHKYKQR  632

Query  396  RTPND--DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R+  D  D  +D   +D  V ERQL +E+LK+RL+EE EA+ + C+QVR KS+ SL+  L
Sbjct  633  RSALDEIDAGEDANAKD-PVSERQLVVESLKKRLEEEAEAHKKHCIQVREKSIGSLKIRL  691

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PE+F A+S++S ACS  Y+ L S+T
Sbjct  692  PEIFRALSDYSHACSEAYEKLRSVT  716



>ref|XP_006356661.1| PREDICTED: uncharacterized protein LOC102596799 [Solanum tuberosum]
Length=719

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 197/266 (74%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ M  MWE M  HH+NQ Q+   L+++++S  P ETS+HH+ERT QLG V++E
Sbjct  442  PKLAALVQGMVSMWEFMFSHHKNQLQLATDLKAIEISGFPLETSKHHHERTIQLGNVIKE  501

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F+ ++ +QK YI+ L+ WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+WQ+L+
Sbjct  502  WHDHFDNLVKNQKLYIQTLHSWLKLNLIPIESSLKEKISSPPRAQSPPIQALLHSWQELL  561

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA++AI SF AV+ TI+ HQ +EMKLKD+C++T+KE  ++ + FEDWY KYMQR
Sbjct  562  EKLPDELARSAIASFEAVIRTIIIHQEEEMKLKDKCEETKKEYIRKRQAFEDWYQKYMQR  621

Query  396  RTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D T+ D   E N    V+E+QL ++ LK+RL EE EA+ R C+QVR KSL SL+  
Sbjct  622  RTPPDMTDTDRATESNPKDPVVEKQLLVDTLKKRLDEETEAHQRLCIQVREKSLGSLKIR  681

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF  MSE+S AC   Y  L  I 
Sbjct  682  LPELFRVMSEYSYACLEAYGRLRLIV  707



>ref|XP_009383699.1| PREDICTED: uncharacterized protein LOC103971407 [Musa acuminata 
subsp. malaccensis]
Length=751

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 194/266 (73%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE MA+MW  M  HH+ Q +IV  L+SLD++ SP+ETSEHH++ T+QL  + +E
Sbjct  479  PKLVELVEGMAQMWYAMYMHHQAQLKIVEGLKSLDVTNSPRETSEHHHKHTFQLLEIAKE  538

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF K++ HQK+Y+  LN WLKL L+PI+++LKEKVSSPQRP + PI +LLHAW + +
Sbjct  539  WHTQFNKLVSHQKDYVESLNSWLKLTLIPIESSLKEKVSSPQRPAHAPIQSLLHAWHEYL  598

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDELAK+AI SFSAV+NTIV  Q +E K K++C++  KE  K+ R F+DW+ KY QR
Sbjct  599  GKLPDELAKSAILSFSAVINTIVTLQQEERKQKEKCEEAHKEYSKKNRAFDDWFQKYSQR  658

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R  +   E DG    N    V ER+  +E+LK +  EE EA+ R C QVR KSL+SL+T 
Sbjct  659  RMGSSVGEPDGGEGSNQKDPVEERRFMVESLKSKFDEEVEAHRRLCKQVREKSLSSLKTH  718

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF AMS+F+ ACS MY +L+ IT
Sbjct  719  LPELFRAMSDFANACSKMYASLKMIT  744



>ref|XP_010938806.1| PREDICTED: uncharacterized protein LOC105057803 [Elaeis guineensis]
Length=670

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/272 (55%), Positives = 199/272 (73%), Gaps = 5/272 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MWE M  HH+NQ +IV  L+ LD++ +PKETSEHHY+RT QL  +V+E
Sbjct  395  PKLVELVDEMAKMWEAMYVHHDNQLKIVSNLKILDITNAPKETSEHHYKRTLQLFEIVKE  454

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQK YI+ LN+WLKLN++PI+++LKE+VSSP RP  PPI ALL AW++ +
Sbjct  455  WHSQFDKLVSHQKVYIQALNNWLKLNVIPIESSLKERVSSPPRPHQPPIQALLLAWREHL  514

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SFSAV+NTIV  Q +E+K K++C +TRKE  K+TR FEDWY KY QR
Sbjct  515  EKLPDELAKSAILSFSAVINTIVTLQQEELKQKEKCDETRKEYLKKTRAFEDWYSKYSQR  574

Query  396  RTPNDDTEQ-----DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            R      E      +G  + + V ER+  +E++K RL +EE+ + + C QVR KS  SL+
Sbjct  575  RATALSEEAMQEGTEGATQKDPVAERKFAVESVKLRLDDEEDNHRKLCKQVREKSFGSLK  634

Query  231  TGLPELFHAMSEFSRACSIMYQTLESITHPLN  136
            T LPELF AMS+F+ A S MY  L+S++   N
Sbjct  635  THLPELFRAMSDFAYASSDMYMKLKSVSQGQN  666



>ref|XP_007024149.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY26771.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=743

 Score =   301 bits (771),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 217/282 (77%), Gaps = 9/282 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWETMK  H++Q +IV  L+ LD+SQSPKETSEHH+ERT QL  +VQ+
Sbjct  463  PKLVQLVDGMATMWETMKVQHDSQFRIVTVLKDLDLSQSPKETSEHHHERTIQLLAIVQD  522

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF K++ HQK YI  LN+WL+LNLVPI+++LKEKVSSP R + PPIL LL AWQ+ +
Sbjct  523  WHMQFCKLVDHQKGYIIALNNWLRLNLVPIESSLKEKVSSPPRVETPPILGLLTAWQNQL  582

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+A++AI +F+ V++TI+QHQLDEMKLK++C+++ KEL+++ RQF+DWYHKYMQR
Sbjct  583  EKLPDEIARSAINNFAHVLDTIMQHQLDEMKLKEKCEESEKELQRKERQFKDWYHKYMQR  642

Query  396  RTPND-DTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            RTP + D E+   + +N  V ERQ+ +EA+K+R +EE+EAY R C+QVR KS+ SL+T L
Sbjct  643  RTPEELDPERTEANPNNEAVTERQVMVEAVKKRWEEEKEAYQRLCIQVREKSMVSLKTRL  702

Query  222  PELFHAMSEFSRACSIMYQTLE-SITHPLNREST*PGNVWPH  100
            PELF+AM+  ++ACS +Y  L   ++ P   +      +WPH
Sbjct  703  PELFNAMTGIAKACSKLYGELRYCVSEPFLPQ------LWPH  738



>ref|XP_008362707.1| PREDICTED: uncharacterized protein LOC103426389 isoform X2 [Malus 
domestica]
Length=711

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 199/254 (78%), Gaps = 2/254 (1%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  730
            M  MW TM+ HHE Q +IV ALRSLD+SQ PK TSEHH+ERT QL  VVQ WH +FEK++
Sbjct  445  MXSMWGTMRAHHETQSKIVTALRSLDISQCPKHTSEHHHERTIQLFGVVQGWHGEFEKLV  504

Query  729  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  550
              QKEYI+ LN+WLKLNL+PI++NLKEKVSSP R Q PPI  LL AW D + KLPD++A+
Sbjct  505  SQQKEYIKALNNWLKLNLIPIESNLKEKVSSPPRIQRPPIQELLLAWHDHLEKLPDDVAR  564

Query  549  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DTE  373
             AI++F+AV+NTI+ HQ +E+K+K++C+DTRKEL ++ RQFEDWY+K M +  P++ DT+
Sbjct  565  MAIHNFAAVINTIMIHQEEEIKMKEKCEDTRKELSRKARQFEDWYNKNMHKTIPDEGDTD  624

Query  372  QDGPHEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  196
            +   H  ++V+ E+Q  +E +K+RL+EEEE+Y R C+QVR KS+ SL+T LPELF  +S+
Sbjct  625  RPEGHTRSDVVAEKQFAVETVKKRLEEEEESYERLCLQVREKSIASLKTRLPELFGVLSD  684

Query  195  FSRACSIMYQTLES  154
            F+ +CS MY++L S
Sbjct  685  FAYSCSEMYRSLRS  698



>ref|XP_004245249.1| PREDICTED: uncharacterized protein LOC101255018 [Solanum lycopersicum]
Length=725

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 197/266 (74%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ M  MWE M  HH+NQ Q+   L+++++S  P ETS+HH+ERT QLG V++E
Sbjct  451  PKLAALVQGMVSMWEFMFSHHKNQLQLATDLKAIEISGFPLETSKHHHERTIQLGNVIKE  510

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F+ ++ +QK YI+ L+ WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+WQ+L+
Sbjct  511  WHDHFDNLVKNQKLYIQTLHSWLKLNLIPIESSLKEKISSPPRAQSPPIQALLHSWQELL  570

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA++AI SF AV+ TI+ HQ +EMKLKD+C++T+KE  ++ + FEDWY KYMQR
Sbjct  571  EKLPDELARSAIASFEAVIRTIIIHQEEEMKLKDKCEETKKEYIRKRQAFEDWYQKYMQR  630

Query  396  RTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D T+ D   + N    V+E+QL ++ LK+RL EE EA+ R C+QVR KSL SL+  
Sbjct  631  RTPPDMTDPDRAADSNPKDPVVEKQLLVDTLKKRLDEETEAHQRLCIQVREKSLGSLKIR  690

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF  MSE+S AC   Y  L  I 
Sbjct  691  LPELFRVMSEYSYACLEAYGRLRLIV  716



>ref|XP_009799127.1| PREDICTED: uncharacterized protein LOC104245243 [Nicotiana sylvestris]
Length=726

 Score =   300 bits (768),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 196/265 (74%), Gaps = 3/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ M  M E M  HH+NQ ++   L+++++S  P ETS+HH+ERT QLG VV+E
Sbjct  452  PKLAALVQGMVNMSEFMYSHHKNQLEMATDLKAIEISGFPLETSKHHHERTIQLGNVVKE  511

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F+ ++ +QK YI+ L++WLKLNL+PI+++LKEK+SSP R QNPPI ALLH+WQ+L+
Sbjct  512  WHDHFDNLVKNQKLYIQTLHNWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHSWQELL  571

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF AV+ TI+ HQ +EMKLK++C++TRKE  ++ + FEDWY KYMQR
Sbjct  572  EKLPDELAKSAIASFEAVIRTIIIHQEEEMKLKEKCEETRKEYIRKRQAFEDWYQKYMQR  631

Query  396  RTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D  + D   E N    V E+Q  +EALK+RL EE EA+ + C+QVR KSL SL+  
Sbjct  632  RTPPDVADPDRATESNPKDPVAEKQFLVEALKKRLDEETEAHQKHCIQVREKSLGSLKIR  691

Query  225  LPELFHAMSEFSRACSIMYQTLESI  151
            LPELF AMSE+S AC   Y  L  I
Sbjct  692  LPELFRAMSEYSYACLEAYGRLRVI  716



>ref|XP_004150357.1| PREDICTED: uncharacterized protein LOC101204163 [Cucumis sativus]
Length=707

 Score =   300 bits (767),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 201/266 (76%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+E
Sbjct  439  PKLVQLVNGMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVRE  498

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKV--SSPQRPQNPPILALLHAWQD  583
            WHSQFEK++  QKEYI+ LN WLKLNL+PI+++LKEKV  SSP R QNPPI  LL AW D
Sbjct  499  WHSQFEKLVRCQKEYIKSLNSWLKLNLIPIESSLKEKVSLSSPPRVQNPPIQKLLLAWHD  558

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM  403
             + +LPDE  +TAI++F AV+NTI+  Q +E KLK + ++T KELE++ R F++W++KY 
Sbjct  559  QLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELERKQRHFDEWHYKYQ  618

Query  402  QRRTPND-DTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            QRR P+D D E+ +   +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+ 
Sbjct  619  QRRMPDDVDPERSEAGMQDAAVTEKLIAVESLKKRLEEEKETHGKQCLHVREKSLVSLKN  678

Query  228  GLPELFHAMSEFSRACSIMYQTLESI  151
             LPELF A+SEFS A S MY++L SI
Sbjct  679  QLPELFRALSEFSFASSEMYKSLSSI  704



>ref|XP_004169923.1| PREDICTED: uncharacterized LOC101204163 [Cucumis sativus]
Length=715

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 201/266 (76%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+E
Sbjct  447  PKLVQLVNGMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVRE  506

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKV--SSPQRPQNPPILALLHAWQD  583
            WHSQFEK++  QKEYI+ LN WLKLNL+PI+++LKEKV  SSP R QNPPI  LL AW D
Sbjct  507  WHSQFEKLVRCQKEYIKSLNSWLKLNLIPIESSLKEKVSLSSPPRVQNPPIQKLLLAWHD  566

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM  403
             + +LPDE  +TAI++F AV+NTI+  Q +E KLK + ++T KELE++ R F++W++KY 
Sbjct  567  QLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELERKQRHFDEWHYKYQ  626

Query  402  QRRTPND-DTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            QRR P+D D E+ +   +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+ 
Sbjct  627  QRRMPDDVDPERSEAGMQDAAVTEKLIAVESLKKRLEEEKETHGKQCLHVREKSLVSLKN  686

Query  228  GLPELFHAMSEFSRACSIMYQTLESI  151
             LPELF A+SEFS A S MY++L SI
Sbjct  687  QLPELFRALSEFSFASSEMYKSLSSI  712



>ref|XP_007225191.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
 gb|EMJ26390.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
Length=711

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 198/265 (75%), Gaps = 0/265 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QE
Sbjct  445  PKLVSLADGMAKMWENMCTHHGSQLKIVTDLKSLDIAHTPMETTKHHHDRTVQLYNVLQE  504

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQF+K++ HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI  LLH+W D +
Sbjct  505  WLSQFDKLVTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQVLLHSWHDFL  564

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++++ F+DWY KY QR
Sbjct  565  EKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEYLRKSQAFDDWYQKYAQR  624

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D    +  +  + V ER+  +E+LK++L+EE EA+ R C+QVR KSL SLRT LPE
Sbjct  625  HAEMDQERGEDANPKDPVAERKFIVESLKKKLEEEVEAHQRHCIQVREKSLGSLRTRLPE  684

Query  216  LFHAMSEFSRACSIMYQTLESITHP  142
            +F AMS+++  CS  Y  L S+T P
Sbjct  685  IFRAMSDYAHTCSESYGKLRSLTEP  709



>gb|KGN58062.1| hypothetical protein Csa_3G481220 [Cucumis sativus]
Length=736

 Score =   300 bits (768),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 201/266 (76%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+E
Sbjct  468  PKLVQLVNGMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVRE  527

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKV--SSPQRPQNPPILALLHAWQD  583
            WHSQFEK++  QKEYI+ LN WLKLNL+PI+++LKEKV  SSP R QNPPI  LL AW D
Sbjct  528  WHSQFEKLVRCQKEYIKSLNSWLKLNLIPIESSLKEKVSLSSPPRVQNPPIQKLLLAWHD  587

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM  403
             + +LPDE  +TAI++F AV+NTI+  Q +E KLK + ++T KELE++ R F++W++KY 
Sbjct  588  QLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELERKQRHFDEWHYKYQ  647

Query  402  QRRTPND-DTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            QRR P+D D E+ +   +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+ 
Sbjct  648  QRRMPDDVDPERSEAGMQDAAVTEKLIAVESLKKRLEEEKETHGKQCLHVREKSLVSLKN  707

Query  228  GLPELFHAMSEFSRACSIMYQTLESI  151
             LPELF A+SEFS A S MY++L SI
Sbjct  708  QLPELFRALSEFSFASSEMYKSLSSI  733



>emb|CBI36151.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 185/263 (70%), Gaps = 35/263 (13%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MW TM  HH++Q +  +AL+SLD+SQSPKETSEHH++RT QL +VVQE
Sbjct  294  PKLVALVDGMATMWGTMLEHHKSQSKTAMALKSLDISQSPKETSEHHHKRTIQLWIVVQE  353

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ +QK YI  L  WL+LNL+PI++NLKEKVSSP RPQNPPI ALL AW D +
Sbjct  354  WHSQFDKLVTNQKNYITALKKWLRLNLIPIESNLKEKVSSPPRPQNPPIQALLQAWNDHL  413

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAKT+I +F+A++ TI+QHQ DEM+LK +C++T KELE++TRQF DW+ K    
Sbjct  414  EKLPDELAKTSISNFAAIIETIMQHQQDEMRLKAKCEETAKELERKTRQFNDWHSK----  469

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                                           LK+EEE Y ++C+ VR KSL SL+  LPE
Sbjct  470  -------------------------------LKDEEETYQKECVLVRDKSLASLKNHLPE  498

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF A+SEFS ACS MY  L SI+
Sbjct  499  LFRALSEFSYACSDMYSRLRSIS  521



>ref|XP_010049074.1| PREDICTED: uncharacterized protein LOC104437750 [Eucalyptus grandis]
Length=650

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 194/263 (74%), Gaps = 0/263 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWE M+ HH+ Q  IV  L SLD S +PKET++HHY+RT QL   V E
Sbjct  378  PKLAQLVDGMANMWEKMRMHHDKQESIVRDLMSLDSSNAPKETTKHHYDRTDQLHKYVLE  437

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W  QF+K+I HQK+YI+ L+ WLKLNL+PI+++LKEK+SSP R QNPPI AL+ +W D +
Sbjct  438  WQLQFDKLITHQKQYIQALHSWLKLNLIPIESSLKEKISSPPRAQNPPIQALIVSWHDYL  497

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI++F+AV++ I+ HQ +EMKLKD+C++TR+E  ++ + FEDWY KY  R
Sbjct  498  EKLPDELAKSAIFAFAAVIHNIIAHQEEEMKLKDKCEETRREYLRKKQAFEDWYQKYEHR  557

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P++   +D  H D  VIERQ  +E+L ++L+++ EA+ R C+QVR KSL +L+  LPE
Sbjct  558  RVPDETRTEDANHHDPVVIERQAVVESLYKKLEDDVEAHRRLCIQVREKSLGNLKNRLPE  617

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF AM+ +S+ C+  Y  L  IT
Sbjct  618  LFRAMAAYSQHCADAYGNLRFIT  640



>ref|XP_008220000.1| PREDICTED: uncharacterized protein LOC103320143 [Prunus mume]
Length=713

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 198/265 (75%), Gaps = 0/265 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QE
Sbjct  447  PKLVSLADGMAKMWENMCTHHGSQLKIVTDLKSLDIAYTPMETTKHHHDRTVQLYNVLQE  506

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQF+K++ HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI  LLH+W D +
Sbjct  507  WLSQFDKLVTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQVLLHSWHDFL  566

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++++ F+DWY KY QR
Sbjct  567  EKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEYLRKSQAFDDWYQKYTQR  626

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D    +  +  + V ER+  +E+LK++L+EE EA+ R C+QVR KSL SL+T LPE
Sbjct  627  HAEMDQERGEDANPKDPVAERKFIVESLKKKLEEEVEAHQRHCIQVREKSLGSLKTRLPE  686

Query  216  LFHAMSEFSRACSIMYQTLESITHP  142
            +F AMS+++  CS  Y  L S+T P
Sbjct  687  IFRAMSDYAHTCSESYGKLRSLTEP  711



>ref|XP_009368022.1| PREDICTED: uncharacterized protein LOC103957563 [Pyrus x bretschneideri]
Length=709

 Score =   297 bits (761),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 196/263 (75%), Gaps = 0/263 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL E MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QE
Sbjct  443  PKLVSLAEGMAKMWENMCTHHGSQLEIVTDLKSLDIAHTPMETTKHHHDRTVQLWNVLQE  502

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ HQK+YI+ LN W+KLNL+PI+++LKEK+SSP R Q PPI ALLH+W D +
Sbjct  503  WHSHFEKLVTHQKQYIQALNSWVKLNLIPIESSLKEKISSPPRVQRPPIQALLHSWHDSL  562

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++ + FEDWY KY QR
Sbjct  563  EKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEFLRKNQAFEDWYQKYAQR  622

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D    +     + V E++  +E+LK+R+++E EA+ R C+QVR KSL SL+T LPE
Sbjct  623  HAEMDQERGEDAIPKDPVSEKKFIVESLKKRMEDECEAHQRHCIQVREKSLGSLKTRLPE  682

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            +F AM++++ ACS +Y  L S T
Sbjct  683  IFRAMTDYAHACSEVYGKLRSTT  705



>ref|XP_009338711.1| PREDICTED: uncharacterized protein LOC103931028 [Pyrus x bretschneideri]
Length=709

 Score =   297 bits (761),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 196/263 (75%), Gaps = 0/263 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL E MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QE
Sbjct  443  PKLVSLAEGMAKMWENMCTHHGSQLEIVTDLKSLDIAHTPMETTKHHHDRTVQLWNVLQE  502

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ HQK+YI+ LN W+KLNL+PI+++LKEK+SSP R Q PPI ALLH+W D +
Sbjct  503  WHSHFEKLVTHQKQYIQALNSWVKLNLIPIESSLKEKISSPPRVQRPPIQALLHSWHDSL  562

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++ + FEDWY KY QR
Sbjct  563  EKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEFLRKNQAFEDWYQKYAQR  622

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D    +     + V E++  +E+LK+R+++E EA+ R C+QVR KSL SL+T LPE
Sbjct  623  HAEMDQERGEDAIPKDPVSEKKFIVESLKKRMEDECEAHQRHCIQVREKSLGSLKTRLPE  682

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            +F AM++++ ACS +Y  L S T
Sbjct  683  IFRAMTDYAHACSEVYGKLRSTT  705



>gb|KCW81524.1| hypothetical protein EUGRSUZ_C02885 [Eucalyptus grandis]
Length=747

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 194/263 (74%), Gaps = 0/263 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWE M+ HH+ Q  IV  L SLD S +PKET++HHY+RT QL   V E
Sbjct  475  PKLAQLVDGMANMWEKMRMHHDKQESIVRDLMSLDSSNAPKETTKHHYDRTDQLHKYVLE  534

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W  QF+K+I HQK+YI+ L+ WLKLNL+PI+++LKEK+SSP R QNPPI AL+ +W D +
Sbjct  535  WQLQFDKLITHQKQYIQALHSWLKLNLIPIESSLKEKISSPPRAQNPPIQALIVSWHDYL  594

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI++F+AV++ I+ HQ +EMKLKD+C++TR+E  ++ + FEDWY KY  R
Sbjct  595  EKLPDELAKSAIFAFAAVIHNIIAHQEEEMKLKDKCEETRREYLRKKQAFEDWYQKYEHR  654

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P++   +D  H D  VIERQ  +E+L ++L+++ EA+ R C+QVR KSL +L+  LPE
Sbjct  655  RVPDETRTEDANHHDPVVIERQAVVESLYKKLEDDVEAHRRLCIQVREKSLGNLKNRLPE  714

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF AM+ +S+ C+  Y  L  IT
Sbjct  715  LFRAMAAYSQHCADAYGNLRFIT  737



>emb|CDX88193.1| BnaA06g27840D [Brassica napus]
Length=737

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 203/263 (77%), Gaps = 4/263 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L SLVE MA+MW  M   H+ Q  IV  L+SL++S S KET++ H+++T Q   V++E
Sbjct  470  PRLVSLVEGMAKMWSNMCIQHDTQLNIVGELKSLEISTSQKETTKQHHQQTRQFCTVLEE  529

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ HQK+YI  LN WLKLNL+PI+++LKE+VSSP RPQ+PPI ALLH+W D +
Sbjct  530  WHVQFEKLVTHQKQYINSLNTWLKLNLIPIESSLKERVSSPPRPQHPPIQALLHSWHDRL  589

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC+DTR+E  ++ + FE+WY K++++
Sbjct  590  EKLPDEVAKSAISSFAAVIRTILLHQEEEMKLKERCEDTRREFIRKKQGFEEWYQKHLEK  649

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P    E++G  ED++V ER++ +E+LK+RL++EEEA+ R C+QVR KSL SL+  LPE
Sbjct  650  RGP---VEEEGG-EDDHVTERRIVVESLKKRLEDEEEAHQRHCVQVREKSLNSLKIRLPE  705

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            +F A+S+++ AC+  Y+ L  I+
Sbjct  706  IFRALSDYAHACADSYEKLRIIS  728



>ref|XP_009151092.1| PREDICTED: uncharacterized protein LOC103874418 [Brassica rapa]
Length=735

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 203/263 (77%), Gaps = 4/263 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L SLVE MA+MW  M   H+ Q  IV  L+SL++S S KET++ H+++T Q   V++E
Sbjct  468  PRLVSLVEGMAKMWSNMCIQHDTQLNIVGELKSLEISTSQKETTKQHHQQTRQFCTVLEE  527

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFE+++ HQK+YI  LN WLKLNL+PI+++LKE+VSSP RPQ+PPI ALLH+W D +
Sbjct  528  WHVQFERLVTHQKQYINSLNTWLKLNLIPIESSLKERVSSPPRPQHPPIQALLHSWHDRL  587

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC+DTRKE  ++ + FE+WY K++++
Sbjct  588  EKLPDEVAKSAISSFAAVIRTILLHQEEEMKLKERCEDTRKEFIRKKQGFEEWYQKHLEK  647

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P    E++G  ED++V ER++ +E+LK+RL++EEEA+ R C+QVR KSL SL+  LPE
Sbjct  648  RGP---VEEEGG-EDDHVTERRIVVESLKKRLEDEEEAHQRHCVQVREKSLNSLKIRLPE  703

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            +F A+S+++ AC+  Y+ L  I+
Sbjct  704  IFRALSDYAHACADSYEKLRIIS  726



>ref|XP_008228519.1| PREDICTED: uncharacterized protein LOC103327921 [Prunus mume]
Length=537

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 200/262 (76%), Gaps = 4/262 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE MA MW+ M+ HHE Q + V ALRSLD S  PK+TS+HH+ERT QL  VVQ 
Sbjct  262  PKLVQLVEGMATMWDIMRLHHETQSKRVTALRSLDTSHCPKQTSQHHHERTIQLLGVVQG  321

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS+  K++ +QK YI+ LN+WLKLNL+PI+++LKEKVSSP R Q PPI  LL AWQD +
Sbjct  322  WHSEIGKLVTYQKVYIKALNNWLKLNLIPIESSLKEKVSSPPRIQRPPIQGLLLAWQDHL  381

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD++A+TAI++F AV++TIV  Q DE+K+KD+C++TRKEL ++ R FEDW +K M +
Sbjct  382  EKLPDDVARTAIHNFGAVISTIVTLQEDEIKMKDKCEETRKELARKKRHFEDWCNKNMHK  441

Query  396  RTPNDDTEQDGP--HEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
              P D+ + D P  H  N+V+ E+Q  +E +K+RL+EEEEAY R C+QVR KS+ S+++ 
Sbjct  442  TIP-DEIDPDRPEGHTRNDVVAEKQFAVEIVKKRLEEEEEAYERLCLQVREKSIASIKSR  500

Query  225  LPELFHAMSEFSRACSIMYQTL  160
            LPELF A+S+F+ +CS MY++L
Sbjct  501  LPELFRALSDFASSCSEMYRSL  522



>ref|XP_009616206.1| PREDICTED: uncharacterized protein LOC104108786 [Nicotiana tomentosiformis]
Length=728

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 194/265 (73%), Gaps = 3/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ M  M E M  HH+NQ ++   L+++++S  P ETS+HH+ERT QLG VV+E
Sbjct  454  PKLAALVQGMVNMSEFMFSHHKNQLEMATDLKAIEISGFPLETSKHHHERTIQLGNVVKE  513

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F+ ++ +QK YI+ L+ WLKLNL+PI+++LKEK+SSP R QNPPI ALLH+WQ+L+
Sbjct  514  WHDHFDNLVKNQKLYIQTLHSWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHSWQELL  573

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             K PDELAK+AI SF AV+ TI+ HQ +EMKLK++C++TRKE  ++ + FEDWY KYMQR
Sbjct  574  EKFPDELAKSAIASFEAVIRTIIIHQEEEMKLKEKCEETRKEYIRKRQAFEDWYQKYMQR  633

Query  396  RTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP D  + D   E N    V E+Q  ++ALK+RL EE EA+ + C+QVR KSL SL+  
Sbjct  634  RTPPDVADPDRATESNPKDPVAEKQFLVDALKKRLDEETEAHQKHCIQVREKSLGSLKIR  693

Query  225  LPELFHAMSEFSRACSIMYQTLESI  151
            LPELF AMSE+S AC   Y  L  I
Sbjct  694  LPELFRAMSEYSYACLEAYGRLRLI  718



>ref|XP_010691307.1| PREDICTED: uncharacterized protein LOC104904665 [Beta vulgaris 
subsp. vulgaris]
Length=777

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 203/268 (76%), Gaps = 4/268 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV++MA MWE M+ HHENQ  I   LR +D+SQS KET++HH+ERT QL  +V+E
Sbjct  495  PKLVALVDAMATMWEVMQVHHENQRNIAAHLRFIDISQSNKETTDHHHERTIQLWAIVRE  554

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++ FEKM+ HQKEYIR LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D +
Sbjct  555  WNTHFEKMVNHQKEYIRALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQNLLFAWHDHL  614

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE AK AIY+F+AV++T+VQ Q DE++ + + +++R++LEK+ RQ+  W ++YMQ+
Sbjct  615  EKLPDEHAKGAIYNFAAVLDTLVQQQDDEIRQRAKVEESRRDLEKKQRQYNKWLNEYMQK  674

Query  396  RTPNDDTE----QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R P+DD +    +DG ++D  +++++  +E  K++L+++ E Y R C  VR KSLTSL+T
Sbjct  675  RVPSDDMDPSSIEDGVNKDEIMVDKEFVVENAKKKLEDDTEEYERLCTHVREKSLTSLKT  734

Query  228  GLPELFHAMSEFSRACSIMYQTLESITH  145
             LPELF ++SEF+ + S MY  L+++ H
Sbjct  735  RLPELFLSLSEFALSASEMYSNLKALCH  762



>ref|XP_008462152.1| PREDICTED: uncharacterized protein LOC103500575 [Cucumis melo]
Length=705

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 205/267 (77%), Gaps = 1/267 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L+  MA MWETM  HH +Q ++V ALR LD+SQSPKETS+HH+ERT QL  VVQE
Sbjct  422  PKLVQLINGMASMWETMHFHHGSQLKVVAALRMLDISQSPKETSDHHHERTVQLWAVVQE  481

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQ EK++  QK+YI+ L++WL+LNL+P +++LKEKVSSP R ++PPI +LLHAWQD +
Sbjct  482  WHSQLEKLVNRQKDYIKALSNWLRLNLIPTESSLKEKVSSPPRVRSPPIQSLLHAWQDHL  541

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+ +  I++F+ V++TI+Q Q +EMKLK +C++T KEL ++++QF+DW  KY+QR
Sbjct  542  EKLPDEVLRNTIFTFATVIHTIMQSQEEEMKLKLKCQETEKELARKSKQFKDWQKKYVQR  601

Query  396  RTPN-DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  N D+ + + P + + + ERQ  +EA+++RL+EE E + + C+ VR KSL SL+  LP
Sbjct  602  RGSNADEVDMEEPGDKDAIAERQAAVEAVEKRLEEEREEHQKLCLHVREKSLGSLKNQLP  661

Query  219  ELFHAMSEFSRACSIMYQTLESITHPL  139
            ELF A+ EFS ACS MY+ L+SI+ P+
Sbjct  662  ELFRALFEFSLACSRMYRHLKSISQPI  688



>ref|XP_004141776.1| PREDICTED: uncharacterized protein LOC101222402 [Cucumis sativus]
 ref|XP_004169318.1| PREDICTED: uncharacterized protein LOC101224589 [Cucumis sativus]
 gb|KGN45358.1| hypothetical protein Csa_7G446740 [Cucumis sativus]
Length=700

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 204/267 (76%), Gaps = 1/267 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L+  MA MWETM  HH +Q + V ALR LD+SQSPKETS+HH+ERT QL  VVQE
Sbjct  422  PKLVHLINGMASMWETMHFHHGSQLKAVAALRMLDISQSPKETSDHHHERTVQLWAVVQE  481

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQ EK++  QK+YI+ L++WL+LNL+P +++LKEKVSSP R ++PPI  LLHAWQD +
Sbjct  482  WHSQLEKLVNRQKDYIKALSNWLRLNLIPTESSLKEKVSSPPRVRSPPIQILLHAWQDHL  541

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+ + AI++F+ V++TI+Q Q +EMKLK +C++T KEL ++++QF+DW  KY+QR
Sbjct  542  EKLPDEVLRNAIFTFATVIHTIMQSQEEEMKLKLKCQETEKELARKSKQFKDWQKKYVQR  601

Query  396  RTPN-DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  N D+ + + P + + + ERQ  +EA++++L+EE E + + C+ VR KSL SL+  LP
Sbjct  602  RGSNADEVDMEEPADKDAIAERQAAVEAVEKKLEEEREEHQKLCLHVREKSLGSLKNQLP  661

Query  219  ELFHAMSEFSRACSIMYQTLESITHPL  139
            ELF A+ EFS ACS MY+ L+SI+ P+
Sbjct  662  ELFRALFEFSLACSRMYRHLKSISQPM  688



>ref|XP_004501198.1| PREDICTED: uncharacterized protein LOC101510604 [Cicer arietinum]
Length=696

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 198/262 (76%), Gaps = 0/262 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SLV  MA MWE M  +HE+Q +IV  L+SLD+SQ  KET++HHY+RT QL  V+QE
Sbjct  426  PKLVSLVVEMANMWENMFINHESQLKIVTDLKSLDISQDHKETTKHHYDRTLQLWNVIQE  485

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQFEK++  QK+YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D +
Sbjct  486  WQSQFEKLVTQQKQYIQALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYL  545

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+    +EMKLK++C++TRKE  ++ + FE+WY K++ R
Sbjct  546  DKLPDELAKSAISSFAAVIKTILLXXXEEMKLKEKCEETRKEFLRKNQAFEEWYQKHLLR  605

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P+D    +  + +N + E+Q  + +L+++L+EE E++ + C+QVR KSL SL+T LPE
Sbjct  606  RGPDDAERGEEGNTNNPLSEKQYVVGSLQKKLEEETESHKKLCVQVREKSLQSLKTRLPE  665

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            LF A+S+++ AC   Y+ L+ I
Sbjct  666  LFRALSDYTHACYDAYEKLKLI  687



>ref|XP_008378117.1| PREDICTED: uncharacterized protein LOC103441188 [Malus domestica]
Length=710

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 193/262 (74%), Gaps = 0/262 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA MWE M  H ++Q +IV  L+SLD+  +P ET++HH+ RT QL  V+ E
Sbjct  444  PKLVSLADGMASMWENMCTHXDSQLKIVTDLKSLDIGHTPMETTKHHHARTVQLWNVLXE  503

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FE ++ HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+W D +
Sbjct  504  WHSHFENLVTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQALLHSWHDFL  563

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SFSAV+ TI+ HQ +EMKLK++ ++TRKE  ++ + FEDWY KY QR
Sbjct  564  EKLPDELAKSAISSFSAVIKTIILHQEEEMKLKEKFEETRKEYLRKNQAFEDWYQKYSQR  623

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D+   +     + V E++  +++LK+RL+EE EA+ R C+QVR KSL SL+T LPE
Sbjct  624  HAEMDEERGEDAVPKDPVSEKKFIVDSLKKRLEEECEAHQRHCIQVREKSLGSLKTRLPE  683

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM++++RACS  Y  L SI
Sbjct  684  IFRAMTDYARACSEAYGKLRSI  705



>ref|XP_002516075.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46495.1| conserved hypothetical protein [Ricinus communis]
Length=714

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 204/265 (77%), Gaps = 2/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWETM+ HH+NQ +IV ALRSLD+SQS KETSE+HY+RT QL  VV++
Sbjct  445  PKLVQLVDGMATMWETMQYHHDNQSKIVYALRSLDISQSLKETSEYHYDRTCQLCGVVRD  504

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF ++I +QK+YI+ LN+W+KLNL+PI++NLKEKVSSP R QNPPI  LL AW D +
Sbjct  505  WHAQFCRLIDYQKDYIKALNNWIKLNLIPIESNLKEKVSSPPRIQNPPIHVLLIAWHDHL  564

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LPDE+A++AI +F+AVV TIV HQ +E+K++++C+ TRKEL +R RQ +DW +K+  R
Sbjct  565  DRLPDEIARSAISNFAAVVQTIVHHQEEEVKMREKCEATRKELSRRIRQLDDWKNKHNVR  624

Query  396  RTPND-DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
                D + E++ PH  N ++ERQ  ++ LK++L+EEEEA  +  +QVR KSL SL+T LP
Sbjct  625  DDELDPEAEEENPHR-NAMMERQGVVDLLKKQLEEEEEACQKLSLQVREKSLASLKTRLP  683

Query  219  ELFHAMSEFSRACSIMYQTLESITH  145
            ELF AMS+ + AC+ MY  L SI H
Sbjct  684  ELFRAMSDIALACADMYSNLRSIAH  708



>ref|XP_010667633.1| PREDICTED: uncharacterized protein LOC104884645 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 193/266 (73%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MWE +  HH+NQ QI   L+SLD+  +P+ETS+ HY  T QL  VVQ+
Sbjct  434  PKLVELVDRMAQMWEDICIHHDNQLQIATELKSLDVILTPRETSKPHYHCTLQLSNVVQQ  493

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W  +FE ++  QK Y+R LN WLKLNL+PI++NLKEK+SSP R  +PPI ALLHAW D +
Sbjct  494  WQDRFETLVHQQKHYVRSLNSWLKLNLIPIESNLKEKISSPPRAHHPPIQALLHAWHDAL  553

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+ +TAI SF A++ TI+ HQ +EM+LK++C++TRKE  ++ + FEDWYHKYMQR
Sbjct  554  EKLPDEVTRTAISSFGAMIKTIILHQDEEMRLKEKCEETRKEFLRKNQAFEDWYHKYMQR  613

Query  396  RTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            + P   + +  +DGP +D  V ERQ+ +E+LK RL++E E Y R C+QVR KSL +L+T 
Sbjct  614  KGPEAMDSERGEDGPGKD-PVSERQVVVESLKNRLEDELEKYQRHCVQVREKSLGTLKTR  672

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPELF A+SE++ A    Y  L +I 
Sbjct  673  LPELFRALSEYAHASYDSYNKLRAIV  698



>ref|XP_008393906.1| PREDICTED: uncharacterized protein LOC103456054 [Malus domestica]
Length=711

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 194/263 (74%), Gaps = 0/263 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA+MWE M  HH +Q +IV  L+SLD+  +P ET++HH++RT QL  V+QE
Sbjct  445  PKLVSLADGMAKMWENMCTHHGSQLKIVTDLKSLDIPHTPMETTKHHHDRTVQLWNVLQE  504

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS FEK++ HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q PPI ALLH+W D +
Sbjct  505  WHSHFEKLVTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQRPPIQALLHSWHDSL  564

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SF+AV+ TI+ +Q +EMKLK++ ++TRKE  ++++ FEDWY KY QR
Sbjct  565  EKLPDELAKSAISSFAAVIKTIILNQEEEMKLKEKFEETRKEFLRKSQAFEDWYQKYAQR  624

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D    +     + V E++  +E+LK+R++EE E + R C+QVR KSL SL+T LPE
Sbjct  625  HAEMDQERGEDAIPKDPVSEKKFIVESLKKRMEEEYEXHQRHCIQVREKSLGSLKTRLPE  684

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            +F +M++++ ACS  Y  L S T
Sbjct  685  IFRSMTDYANACSEAYGKLRSTT  707



>ref|XP_010112163.1| hypothetical protein L484_019902 [Morus notabilis]
 gb|EXC32788.1| hypothetical protein L484_019902 [Morus notabilis]
Length=821

 Score =   294 bits (753),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 205/266 (77%), Gaps = 6/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA MWE+M  HH++Q +IV  L+ LD++ +PKET++ H++RT QL  ++QE
Sbjct  477  PKLVSLADGMATMWESMCIHHDSQLKIVTDLKGLDLAHAPKETTKQHHDRTVQLYNIIQE  536

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ HQK+YI+ LN WLKLNLVPI+++LKE +SSP R Q+PPI ALLH+W DL+
Sbjct  537  WHSQFEKLVTHQKQYIQALNSWLKLNLVPIESSLKEIISSPPRAQHPPIQALLHSWHDLL  596

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+A  SF+AV+ TI+ HQ +EMKLK++C++TRKE  +R + FEDWY K+MQR
Sbjct  597  EKLPDELAKSAASSFAAVIKTIILHQEEEMKLKEKCEETRKEYLRRNQAFEDWYQKHMQR  656

Query  396  RTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R P++   + G  ED N    V E+Q  +++LK+RL+EE EA+ + C+QVR KSL SL+T
Sbjct  657  RGPDEMDPERG--EDANTKDPVSEKQFVVDSLKKRLEEEIEAHQKHCLQVREKSLGSLKT  714

Query  228  GLPELFHAMSEFSRACSIMYQTLESI  151
             LPE+F AMS++S+ACS  Y+ L  +
Sbjct  715  RLPEIFRAMSDYSQACSDGYEKLSCV  740



>ref|XP_008776462.1| PREDICTED: uncharacterized protein LOC103696569 [Phoenix dactylifera]
Length=375

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 200/271 (74%), Gaps = 4/271 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MWE M  HH+NQ +IVL L+ LD+S +P ETSEHH   T QL  +V+E
Sbjct  101  PKLLDLVDGMAKMWEAMYVHHDNQLKIVLNLKILDISNAPMETSEHHNRHTIQLFDIVKE  160

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+K++ HQK+YI+ L+ WLKLN++PI+++LKEKVSSP RP+ PPI ALLHAW D +
Sbjct  161  WHLQFDKLVSHQKDYIQALSSWLKLNIIPIESSLKEKVSSPPRPRQPPIQALLHAWHDHL  220

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SFSAV+NTIV  Q +E+K +++C +TRKE  K+ R FEDWY KY  R
Sbjct  221  DKLPDELAKSAILSFSAVINTIVTLQQEELKQREKCDETRKEYLKKIRAFEDWYSKYSHR  280

Query  396  RTP-NDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R   +++  Q   +G ++++ V ER++ +E+ K RL EEEE + + C QVR KS  +L+T
Sbjct  281  RAALSEEAGQEGSEGANQNDPVAERKVAVESAKSRLDEEEENHEKLCKQVREKSFGTLKT  340

Query  228  GLPELFHAMSEFSRACSIMYQTLESITHPLN  136
             LPEL  AMS+FS ACS MY+ L+SI+   N
Sbjct  341  HLPELIRAMSDFSHACSEMYKKLKSISQSQN  371



>ref|XP_009345256.1| PREDICTED: uncharacterized protein LOC103937065 [Pyrus x bretschneideri]
Length=713

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 194/262 (74%), Gaps = 0/262 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA+MWE M   H+NQ +IV  L+SLD++ +P ET++HH+ RT QL  V+QE
Sbjct  447  PKLVSLADGMAKMWENMCTDHDNQLKIVTDLKSLDIALTPMETTKHHHARTVQLWNVLQE  506

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS F  ++ HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+W D +
Sbjct  507  WHSHFVNLVTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQALLHSWHDFL  566

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI S SAV+ TI+ HQ +EMKLK++ ++TRKE  ++ + F+DWY KY QR
Sbjct  567  EKLPDELAKSAISSCSAVIKTIILHQEEEMKLKEKFEETRKEYLRKNQAFDDWYQKYSQR  626

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                D+   +     + V E++  +++LK+RL+EE EA+ R C+QVR KSL SL+T LPE
Sbjct  627  HAQMDEERGEDAVPKDPVSEKKFIVDSLKKRLEEECEAHQRHCIQVREKSLGSLKTRLPE  686

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM++++RACS  Y  L SI
Sbjct  687  IFRAMTDYARACSEAYGKLRSI  708



>emb|CDP18480.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 196/266 (74%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +L+  M +MWE+M  HH++Q QI   L+ LD+S +P ETS+HH+ERT QL   V++
Sbjct  451  PKLVALINGMTKMWESMWMHHQDQKQIATDLKLLDVSAAPGETSKHHHERTCQLLHHVED  510

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
             HS  EK++ +Q +YI  LN WLK NL+PI+++LKEK+SSP R QNPPI  LL  W D +
Sbjct  511  LHSHLEKLMTNQNQYIHFLNSWLKQNLIPIESSLKEKISSPPRSQNPPIQPLLQMWHDHL  570

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+ AK+AI++FS VV  I+ HQ +EMKLK+ C++TRKE  ++++ FEDWYHKYMQR
Sbjct  571  EKLPDDAAKSAIHTFSEVVKRILVHQEEEMKLKETCEETRKEYLRKSQAFEDWYHKYMQR  630

Query  396  RTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            RTP+DD + D P E N    + E++  +E+LK+RL+EE EA+ + C+QVR KSLTSL+ G
Sbjct  631  RTPHDDADPDRPEETNPNDPLAEKRFVVESLKKRLEEEMEAHQKHCIQVREKSLTSLKIG  690

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LP+LF AMS+++ AC   Y +L S+ 
Sbjct  691  LPDLFRAMSDYAEACLNAYGSLRSLA  716



>ref|XP_011089542.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105170443 
[Sesamum indicum]
Length=717

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 198/271 (73%), Gaps = 6/271 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ M  MWE+M  HH++Q +IV  L+SLD+S    ETS+HH+ERT QL  VV++
Sbjct  443  PKLVALVQGMTNMWESMCQHHDSQLKIVTDLKSLDVSGVLIETSKHHHERTKQLSNVVEQ  502

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ +Q+ YI  LN+WLKLNL+PI+++LKEKVSSP R  NPPI  LL +W D +
Sbjct  503  WHLQFEKLVTNQRHYINSLNNWLKLNLIPIESSLKEKVSSPPRTLNPPIQPLLRSWHDHL  562

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLKD+ ++TRKE  ++ + FE+WY KYMQR
Sbjct  563  EKLPDEVAKSAIASFAAVIKTIIIHQEEEMKLKDKYEETRKEYFRKKQAFEEWYQKYMQR  622

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P D+T+ D   E N    V ERQ  +E+LK+RL++E E + + C+QVR KSL SL+  
Sbjct  623  RPPMDETDPDKAVETNAKDPVSERQFLVESLKKRLEDEMEDHQKHCVQVREKSLGSLKIR  682

Query  225  LPELFHAMSEFSRACSIMYQTLESIT---HP  142
            LPELF A+S+++ AC   Y+ L  IT   HP
Sbjct  683  LPELFRALSDYAHACFDAYERLRLITQSQHP  713



>ref|XP_008775372.1| PREDICTED: uncharacterized protein LOC103695745 [Phoenix dactylifera]
Length=557

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 198/270 (73%), Gaps = 3/270 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MWETM  HH  Q +IV  LR+ D+S +PKETSE H+E T QL  VV+E
Sbjct  286  PKLVDLVDGMANMWETMHVHHGTQYKIVANLRAFDISFAPKETSEEHHECTAQLWRVVRE  345

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQ EK++ +QK+YI+ LN WLKLNL+PI+++LKEKVSSP RP  PPI ALLH+W D +
Sbjct  346  WHSQIEKLMKNQKDYIKSLNSWLKLNLIPIESSLKEKVSSPPRPSRPPIQALLHSWNDQL  405

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KL DELA++AIYSFS VV TIV HQ DE+K+K++C+D RKE  ++ R FEDWY KY ++
Sbjct  406  EKLSDELARSAIYSFSEVVRTIVVHQEDELKMKEKCEDLRKEFMRKKRAFEDWYRKYSEK  465

Query  396  RTP-NDDTEQDGPHEDNN--VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            +    +D   +G    N     ER+L++EAL+ +LK+EEEAY R C QVR KSL +LRT 
Sbjct  466  KAASGEDANPEGGEGSNQDRGTERKLEVEALEIKLKDEEEAYARLCKQVREKSLGTLRTH  525

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLN  136
            LPELF  +S+F+ ACS MY+ L S++  L+
Sbjct  526  LPELFRNVSDFALACSEMYKKLRSVSQSLD  555



>emb|CDX80528.1| BnaC07g29160D [Brassica napus]
Length=733

 Score =   287 bits (735),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 201/263 (76%), Gaps = 4/263 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L SLVE MA+MW  M   H+ Q  IV  L+SL++S   KET++ H+++T Q   V++E
Sbjct  466  PRLVSLVEGMAKMWSNMCIQHDTQLIIVGELKSLEISTCQKETTKQHHQQTRQFCAVLEE  525

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFE+++ HQK+YI  LN WLKLNL+ I+++LKE+VSSP RPQ+PPI ALLH+W D +
Sbjct  526  WHVQFERLVTHQKQYINSLNTWLKLNLISIESSLKERVSSPPRPQHPPIQALLHSWHDRL  585

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC++TR+E  ++ + FE+WY K++++
Sbjct  586  EKLPDEVAKSAISSFAAVIRTILLHQEEEMKLKERCEETRREFIRKKQGFEEWYQKHLEK  645

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R P    E++G  ED++V ER++ +E+LK+RL++EEEA+ R C+QVR KSL SL+  LPE
Sbjct  646  RGP---VEEEGG-EDDHVTERRIVVESLKKRLEDEEEAHQRHCVQVREKSLHSLKIRLPE  701

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            +F A+S+++ AC+  Y+ L  I+
Sbjct  702  IFRALSDYAHACADSYEKLRIIS  724



>gb|KDO79698.1| hypothetical protein CISIN_1g004600mg [Citrus sinensis]
Length=743

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 200/268 (75%), Gaps = 1/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  MA+MWE M  HH++Q  IV  L+ LD++ + KET++HH+ERT +L  VVQ+
Sbjct  468  PKLVALVNGMAKMWENMCIHHDSQLTIVSELKPLDIAHAVKETTQHHHERTEELFTVVQK  527

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH++FEK + HQK++I+ L  WLKLNL+PI+++LKE+V+SP R  NPPI ALLH+W D +
Sbjct  528  WHTEFEKFVNHQKQFIQALTSWLKLNLIPIESSLKERVTSPPRAPNPPIQALLHSWHDYL  587

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TRKEL ++T  +E+W+ KY + 
Sbjct  588  EKLPDEIAKSAISSFAAVIKTIMLHQEEEMKLKEKCEETRKELLRKTHAYEEWHRKYKKT  647

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
             +   + E+ D  +  + V++RQ+ +E+L++RL+EE EA+ R C+QVR KSL SL+  LP
Sbjct  648  HSEESEAERGDDANTRDPVLDRQIVIESLRKRLEEETEAFRRHCLQVREKSLGSLKLRLP  707

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLN  136
            +LF A+S+F+ A    Y+ L SIT   N
Sbjct  708  DLFRAVSDFAHASFDAYEKLRSITQSQN  735



>ref|XP_006450611.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
 gb|ESR63851.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
Length=745

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 200/268 (75%), Gaps = 1/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  MA+MWE M  HH++Q  IV  L+ LD++ + KET++HH+ERT +L  VVQ+
Sbjct  470  PKLVALVNGMAKMWENMCIHHDSQLTIVSELKPLDIAHAVKETTQHHHERTEELFTVVQK  529

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH++FEK + HQK++I+ L  WLKLNL+PI+++LKE+V+SP R  NPPI ALLH+W D +
Sbjct  530  WHTEFEKFVNHQKQFIQALTSWLKLNLIPIESSLKERVTSPPRAPNPPIQALLHSWHDYL  589

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TRKEL ++T  +E+W+ KY + 
Sbjct  590  EKLPDEIAKSAISSFAAVIKTIMLHQEEEMKLKEKCEETRKELLRKTHAYEEWHRKYKKT  649

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
             +   + E+ D  +  + V++RQ+ +E+L++RL+EE EA+ R C+QVR KSL SL+  LP
Sbjct  650  HSEESEAERGDDANTRDPVLDRQIVIESLRKRLEEETEAFRRHCLQVREKSLGSLKLRLP  709

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLN  136
            +LF A+S+F+ A    Y+ L SIT   N
Sbjct  710  DLFRAVSDFAHASFDAYEKLRSITQSQN  737



>ref|XP_006476157.1| PREDICTED: myosin-9-like [Citrus sinensis]
Length=745

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 200/268 (75%), Gaps = 1/268 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV  MA+MWE M  HH++Q  IV  L+ LD++ + KET++HH+ERT +L  VVQ+
Sbjct  470  PKLVALVNGMAKMWENMCIHHDSQLTIVSELKPLDIAHAVKETTQHHHERTEELFTVVQK  529

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH++FEK + HQK++I+ L  WLKLNL+PI+++LKE+V+SP R  NPPI ALLH+W D +
Sbjct  530  WHTEFEKFVNHQKQFIQALTSWLKLNLIPIESSLKERVTSPPRAPNPPIQALLHSWHDYL  589

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TRKEL ++T  +E+W+ KY + 
Sbjct  590  EKLPDEIAKSAISSFAAVIKTIMLHQEEEMKLKEKCEETRKELLRKTHAYEEWHRKYKKT  649

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
             +   + E+ D  +  + V++RQ+ +E+L++RL+EE EA+ R C+QVR KSL SL+  LP
Sbjct  650  HSEESEAERGDDANTRDPVLDRQIVIESLRKRLEEETEAFRRHCLQVREKSLGSLKLRLP  709

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLN  136
            +LF A+S+F+ A    Y+ L SIT   N
Sbjct  710  DLFRAVSDFAHASFDAYEKLRSITQSQN  737



>gb|KDP37214.1| hypothetical protein JCGZ_06270 [Jatropha curcas]
Length=729

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 195/265 (74%), Gaps = 3/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ MA MWETM+ HH  Q ++V ALRSLD+S+SPKETSE+HY+RT+QL  VV++
Sbjct  457  PRLAQLVDGMATMWETMQYHHHTQSKLVYALRSLDISESPKETSEYHYDRTFQLCGVVRD  516

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W +QF K++ HQK YI+ LN WLKLNL+PI++NLKEK+SSP R QNPPI ALL AW D +
Sbjct  517  WQNQFCKLVDHQKGYIKALNSWLKLNLIPIESNLKEKISSPPRVQNPPIHALLIAWNDDL  576

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM--  403
             KLPDE+A++AI +F+AV+ TIV HQ +E+K++++C+ TR+EL ++T+QF +W  K+M  
Sbjct  577  EKLPDEIARSAIVNFAAVIQTIVHHQEEELKIREKCEATRRELARKTKQFNEWKQKHMVE  636

Query  402  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
                 + D  ++ PH +  + +RQ  ++AL ++L+EEEE   R   QVR KSL SL+  L
Sbjct  637  THDETDPDRAEENPHRE-ALTDRQFVIDALTKQLEEEEEGCRRLSQQVREKSLASLKHRL  695

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PELF AMS+ + A S MY  L SI 
Sbjct  696  PELFTAMSDIALAFSAMYSNLRSIA  720



>ref|XP_008342705.1| PREDICTED: uncharacterized protein LOC103405477 [Malus domestica]
Length=736

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 194/264 (73%), Gaps = 4/264 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE M  MW TM+ HHE Q  I   LR LD+SQ PK TSEHH+ERT QL  VVQ 
Sbjct  461  PKLVQLVEGMTIMWATMRSHHETQSNIAKELRWLDISQCPKHTSEHHHERTIQLFGVVQG  520

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W S+F K++  QKEYI+ LN WLKLNL+PI++ LKEKVSSP R Q PPI  LL AW D +
Sbjct  521  WQSEFVKLVSQQKEYIKALNSWLKLNLIPIESXLKEKVSSPPRIQRPPIQGLLLAWHDHL  580

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD++A+TAIY+F+A +NTI+ HQ +E+K+K++C+DTRKEL ++ RQF++WY K   +
Sbjct  581  EKLPDDVARTAIYNFAAAINTIMIHQEEEIKMKEKCEDTRKELSRKMRQFQEWYDKNKHK  640

Query  396  RTPNDDTEQDGP--HEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
              P D+ + DGP  H  ++V+ E+Q  +E +K+RL+EEEE Y R  +QVR KS+ SL+T 
Sbjct  641  TIP-DEGDTDGPEGHTRSDVLAEKQFAVEIVKKRLEEEEETYERLGLQVREKSVVSLKTR  699

Query  225  LPELFHAMSEFSRACSIMYQTLES  154
            LPELF A+S+F+ +CS MY+ L S
Sbjct  700  LPELFRALSDFAYSCSEMYRGLRS  723



>emb|CAN72109.1| hypothetical protein VITISV_044047 [Vitis vinifera]
Length=728

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 179/227 (79%), Gaps = 4/227 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA MW TM  HH++Q +  +AL+SLD+SQSPKETSEHH++RT QL  VVQE
Sbjct  450  PKLVALVDGMATMWGTMLEHHKSQSKTAMALKSLDISQSPKETSEHHHKRTIQLWXVVQE  509

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ +QK YI  L  WL+LNL+PI++NLKEKVSSP R QNPPI ALL AW D +
Sbjct  510  WHSQFDKLVTNQKNYITALKKWLRLNLIPIESNLKEKVSSPPRXQNPPIQALLQAWNDHL  569

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAKT+I +F+A++ TI+QHQ DEM+LK +C++T KELE++TRQF DW+ KYMQ+
Sbjct  570  EKLPDELAKTSISNFAAIIETIMQHQQDEMRLKAKCEETAKELERKTRQFNDWHSKYMQK  629

Query  396  RTPNDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCM  265
            R P+++  +   D PH D  VIER+L +E L  RLK+EEE Y ++C+
Sbjct  630  RIPDENDREHPGDDPH-DEVVIERKLVVETLSNRLKDEEETYQKECV  675



>ref|XP_008447502.1| PREDICTED: uncharacterized protein LOC103489935 [Cucumis melo]
Length=722

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 196/264 (74%), Gaps = 2/264 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  M  MW+TM+ HHE Q +IV ALR LD+SQSPKETS HH+ERT QL  VV+E
Sbjct  456  PKLVQLVHGMMLMWDTMRMHHEEQLKIVNALRYLDLSQSPKETSVHHHERTVQLCNVVRE  515

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK+   QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D +
Sbjct  516  WHSQFEKLAYRQKDYIKALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQRLLIAWHDQL  575

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE  +TAI SFSAV++TI+  Q +EMKLK RC +T KEL ++ RQF+DW++KY QR
Sbjct  576  EKLPDEHLRTAISSFSAVISTIMLQQEEEMKLKLRCDETEKELVRKQRQFDDWHYKYQQR  635

Query  396  RTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P+  D  + +   +D  V ER + +E+LK++L+EE+E + +QC+ VR KSL SL+  L
Sbjct  636  RMPDELDPEKSEENSQDAAVTERFVVVESLKKKLEEEKETHAKQCLHVREKSLVSLKNQL  695

Query  222  PELFHAMSEFSRACSIMYQTLESI  151
            PELF A+SEFS A S MY+ L  I
Sbjct  696  PELFRALSEFSSAGSEMYKNLRLI  719



>ref|XP_008799874.1| PREDICTED: uncharacterized protein LOC103714416 [Phoenix dactylifera]
Length=559

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 197/272 (72%), Gaps = 5/272 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L + MA+MWE M  HH+NQ +IVL L+ LD++  PKETSEHHY+RT QL  +V+E
Sbjct  284  PKLVELADGMAKMWEAMYVHHDNQLKIVLNLKILDITNVPKETSEHHYKRTLQLFEIVKE  343

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQF+K++ HQK+YIR LN+WLKLN++PI+++LKE+VSSP RP+ PPI ALL AW D +
Sbjct  344  WHSQFDKLVSHQKDYIRALNNWLKLNIIPIESSLKERVSSPPRPRQPPIQALLLAWHDHL  403

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             K+PDELAK+AI SFSAV+NTIV  Q +E+K K++C +TRKE  K+ R FEDWY KY QR
Sbjct  404  EKIPDELAKSAILSFSAVINTIVILQQEELKQKEKCDETRKEYLKKARAFEDWYSKYSQR  463

Query  396  RTPNDDTE-----QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            R      E      +   + + V ER+  +E++K RL EEE+ + + C QVR KS  SL+
Sbjct  464  RATALSEEAVQEDSEAASQKDPVAERKFAVESVKSRLDEEEDNHRKLCKQVREKSFGSLK  523

Query  231  TGLPELFHAMSEFSRACSIMYQTLESITHPLN  136
            T LPELF AMS+F+ A S MY  L+SI+   N
Sbjct  524  THLPELFRAMSDFAYASSDMYMKLKSISQGQN  555



>emb|CDX87081.1| BnaC09g03960D [Brassica napus]
Length=534

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 202/266 (76%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L SLVE MA+MW  M   H+ Q QIV  L+SL++S S KET++ H+++T Q   V++E
Sbjct  260  PRLVSLVEGMAKMWTNMCTQHDTQLQIVGELKSLEISTSQKETTKQHHQQTRQFCTVLEE  319

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFE+++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct  320  WHVQFERLVTHQKQYINSLNTWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRL  379

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FE+WY K++Q+
Sbjct  380  EKLPDEVAKSAISSFAAVMKTILLHQEEEMKLKEKCEETRREFIRKKQGFEEWYQKHLQK  439

Query  396  RTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P +   D E+    +D++V ER++ +E LK+RL++EEEAY R C+QVR KSL SL+  
Sbjct  440  RGPTEEGVDGEEGSGRDDDHVTERRIVVETLKKRLEDEEEAYQRHCVQVREKSLNSLKIR  499

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  500  LPEIFRALSDYAHACADSYEKLRVIS  525



>ref|XP_010931963.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
 ref|XP_010931964.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
Length=740

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 197/270 (73%), Gaps = 3/270 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE MA+MWETM  HH  Q +IV  LR+  +S SPKETSE H+E T QL  VV+E
Sbjct  469  PKLVDLVEGMAKMWETMHVHHGTQHKIVANLRAFAISSSPKETSEQHHECTVQLWRVVRE  528

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ +QKEYI+ LN WLKLNL+PI+++LKEKVSSP RP  PPI  LLH+W D +
Sbjct  529  WHSQFEKLMKNQKEYIKSLNSWLKLNLIPIESSLKEKVSSPPRPSRPPIQPLLHSWNDQL  588

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA++AIYSFS V+ TIV HQ +E+K+K++C+D RKE  ++ R F+DWY KY+++
Sbjct  589  EKLPDELARSAIYSFSEVIRTIVVHQQEELKMKEKCEDMRKEFMRKKRAFDDWYQKYLEK  648

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            +  + +       E +N   V ER+L+++ L  RLK E+E + + C QVR KSL SLRT 
Sbjct  649  KAASGEEANPEGGEGSNQDRVAERKLEVDGLDARLKAEDENHGKLCKQVRDKSLGSLRTH  708

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLN  136
            LPELF +MS+F+  CS MY+ L S+T  LN
Sbjct  709  LPELFRSMSDFALECSEMYKRLISVTRSLN  738



>ref|XP_010907260.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK14 [Elaeis guineensis]
Length=740

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 196/268 (73%), Gaps = 3/268 (1%)
 Frame = -1

Query  930  LKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWH  751
            L  LV+ MA+MWET+  HH  Q +IV+ LR+ D+S +PKETSE H+ERT QL  +V++WH
Sbjct  471  LVDLVDGMAKMWETVHAHHGTQHEIVVNLRAFDISLAPKETSEQHHERTVQLWQIVRQWH  530

Query  750  SQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGK  571
             QFEK+   QKEYI+ LN WL+LNL+PI+++LKEKVSSP +P  PPI ALLH+W D + K
Sbjct  531  LQFEKLTKSQKEYIKALNSWLRLNLIPIESSLKEKVSSPPQPSQPPIQALLHSWNDQLEK  590

Query  570  LPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT  391
            LPDELA+ AIYSFS VV TIV HQ DE+K K++C+D RK+  ++ R F+DW +KY++RR 
Sbjct  591  LPDELARNAIYSFSEVVRTIVVHQQDELKTKEKCEDLRKKFIRKKRAFDDWSYKYLERRA  650

Query  390  PN-DDTEQDGPHEDN--NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
             + ++   +G    N   + ER+L +E L+ RLK EEEAY + C QVR KSL SL+T LP
Sbjct  651  ASGEEANPEGGRASNQDTLAERKLAIETLESRLKNEEEAYGKLCQQVREKSLGSLQTHLP  710

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLN  136
            ELF A+S+F+ ACS MY+ L S+T   N
Sbjct  711  ELFRAVSDFALACSEMYKKLRSVTQSQN  738



>ref|XP_008808244.1| PREDICTED: uncharacterized protein LOC103720359 [Phoenix dactylifera]
Length=735

 Score =   279 bits (714),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 200/271 (74%), Gaps = 4/271 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MWE M  HH+NQ +IVL L+ LD+S +P ETSEHH   T QL  +V+E
Sbjct  461  PKLLDLVDGMAKMWEAMYVHHDNQLKIVLNLKILDISNAPMETSEHHNRHTIQLFDIVKE  520

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+K++ HQK+YI+ L+ WLKLN++PI+++LKEKVSSP RP+ PPI ALLHAW D +
Sbjct  521  WHLQFDKLVSHQKDYIQALSSWLKLNIIPIESSLKEKVSSPPRPRQPPIQALLHAWHDHL  580

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELAK+AI SFSAV+NTIV  Q +E+K +++C +TRKE  K+ R FEDWY KY  R
Sbjct  581  DKLPDELAKSAILSFSAVINTIVTLQQEELKQREKCDETRKEYLKKIRAFEDWYSKYSHR  640

Query  396  RTP-NDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R   +++  Q   +G ++++ V ER++ +E+ K RL EEEE + + C QVR KS  +L+T
Sbjct  641  RAALSEEAGQEGSEGANQNDPVAERKVAVESAKSRLDEEEENHEKLCKQVREKSFGTLKT  700

Query  228  GLPELFHAMSEFSRACSIMYQTLESITHPLN  136
             LPEL  AMS+FS ACS MY+ L+SI+   N
Sbjct  701  HLPELIRAMSDFSHACSEMYKKLKSISQSQN  731



>ref|XP_010519919.1| PREDICTED: uncharacterized protein LOC104799211 [Tarenaya hassleriana]
Length=762

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 200/267 (75%), Gaps = 4/267 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SLV+ MA+MW  M  HH+ Q +IV  L+ L++  S KET++HH+ERT Q G +V+E
Sbjct  483  PKLVSLVQGMAKMWGNMCIHHDTQLKIVGDLKPLEICGSLKETTKHHHERTRQFGNIVEE  542

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFE++++HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH W D +
Sbjct  543  WHVQFERLVMHQKQYINALNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHTWHDWL  602

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC++TRKE  K+ + FE+WY K++Q+
Sbjct  603  EKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKERCEETRKEFLKKNQAFEEWYQKHLQK  662

Query  396  RTPND-DTEQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R P++ +  +DG    N    V ER+  +E L++RL++E EAY R C+QVR KSL SL+ 
Sbjct  663  RGPDEAEGGEDGASVTNPKDPVSERRFAVETLRKRLEDEVEAYQRHCVQVREKSLNSLKI  722

Query  228  GLPELFHAMSEFSRACSIMYQTLESIT  148
             LPELF A+S+++ AC+  Y+ L  IT
Sbjct  723  RLPELFRALSDYAHACADAYEKLRIIT  749



>gb|EPS57690.1| hypothetical protein M569_17127, partial [Genlisea aurea]
Length=245

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 184/257 (72%), Gaps = 15/257 (6%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVL-ALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  733
            MA MW TMK +HENQ ++V  +LR LD S SPKET++HH+ERT QLG VVQEW++   + 
Sbjct  1    MATMWGTMKFYHENQFKVVHESLRLLDASHSPKETTDHHHERTRQLGGVVQEWYTNLTEF  60

Query  732  IIHQKEYIRGLNDWLKLNLVPIDTNLKE-KVSSPQRPQ-NPPILALLHAWQDLIGKLPDE  559
               QKEYI+ LN+WLKLNL+PIDTNLK+   SSP RP+ NPPI  LLHAW + + KLPDE
Sbjct  61   TTQQKEYIKALNNWLKLNLIPIDTNLKDPSASSPARPESNPPIQLLLHAWNEYLQKLPDE  120

Query  558  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDD  379
             A++AI +F+A V TI +HQ +E++ ++RC ++ K+L+++TR FE+WY K+        +
Sbjct  121  AARSAINNFAAAVKTIWEHQKEELEFRNRCAESSKDLKRKTRDFENWYRKHFT------E  174

Query  378  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  199
             E+D       V E+Q+ +E  K+RL+E+EEAY RQC+QVR KS+ SL+T LPELF A+S
Sbjct  175  VEKDV------VSEKQIAVEIAKKRLEEDEEAYRRQCVQVRDKSVMSLKTHLPELFRALS  228

Query  198  EFSRACSIMYQTLESIT  148
             F+ A + MY  L ++ 
Sbjct  229  AFAGAGADMYSHLRNVA  245



>gb|EMT28812.1| hypothetical protein F775_16807 [Aegilops tauschii]
Length=445

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 180/266 (68%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+ M  HH+ Q +I+  L+S D+S + +ETSE H ERT QL  VVQE
Sbjct  175  PKLLELVKGMGHMWDAMYKHHKAQLKIISELKSFDISVAARETSEQHNERTVQLWQVVQE  234

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH Q+ K +  QKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++
Sbjct  235  WHVQYSKFMASQKEYVGNLYSWIKLNVIPIDTNLKANSSQPVET-TPPIKRLLHAWHDML  293

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDE A+ AI++FS VV+ I+ HQ +E+KL+ R +DTRKE E+++RQFEDW  KYM++
Sbjct  294  GKLPDEDARKAIHTFSEVVHIILVHQDEEIKLRQRIQDTRKEHERKSRQFEDWARKYMEK  353

Query  396  RT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R   P +    DG   D  + ER+  +E L+  LKE EEAY +QC  VR KSL+ LRT L
Sbjct  354  RAGIPPEAGNPDGTRAD-PLAERKAAMEKLENSLKELEEAYTKQCKVVREKSLSLLRTNL  412

Query  222  PELFHAMSEFSRACSIMYQTLESITH  145
            PELF  +SEFS   + M++ L SI++
Sbjct  413  PELFRIVSEFSLQSAAMFKDLWSISN  438



>gb|KFK27812.1| hypothetical protein AALP_AA8G433100 [Arabis alpina]
Length=755

 Score =   269 bits (687),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 202/267 (76%), Gaps = 4/267 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L SLVE MA+MW  M  HH+ Q +IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  480  PRLVSLVEGMAKMWTNMCIHHDTQLKIVGELKSLEISTSNKETTKQHHHQTRQFCTVLEE  539

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++L+EKVSSP RPQ PPI ALLH+W D +
Sbjct  540  WHVQFDRLVTHQKQYINSLNSWLKLNLIPIESSLREKVSSPPRPQRPPIQALLHSWHDRL  599

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FEDWY K++ +
Sbjct  600  EKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKEKCEETRREFIRKKQGFEDWYQKHLHK  659

Query  396  RTPNDDTE--QDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            + P ++ E  +DG      ++V ER++ +EALK+RL++EEEA+ R C+QVR KSL SL+ 
Sbjct  660  KGPTEEAEGGEDGTTNTSRDHVSERRIVVEALKKRLEDEEEAHQRHCVQVREKSLNSLKI  719

Query  228  GLPELFHAMSEFSRACSIMYQTLESIT  148
             LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  720  RLPEIFRALSDYAHACADSYEKLRMIS  746



>gb|EYU29268.1| hypothetical protein MIMGU_mgv1a002196mg [Erythranthe guttata]
Length=702

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 188/262 (72%), Gaps = 0/262 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SLV+ M +MWE+M  HH++Q  IV  L+SL++S S  ET++HH+ERT QL  VV +
Sbjct  434  PKLVSLVQGMTKMWESMCTHHDSQLSIVSNLKSLEISGSLIETTKHHHERTNQLSAVVDQ  493

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ +QK+YI  LN WLKLNL+PI+++LKEKVSSP     PPI  LL +W DL+
Sbjct  494  WHSQFEKLVNNQKQYINSLNSWLKLNLIPIESSLKEKVSSPPHTPTPPIHPLLRSWHDLL  553

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AKTAI SF+AV+ TI  HQ +EMK+K++ ++TR+E  ++ + FE+WY KYMQR
Sbjct  554  EKLPDEVAKTAISSFAAVIKTIGIHQEEEMKMKEKYEETRREYYRKKQSFEEWYQKYMQR  613

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            R   +D         + V ERQ  +++LK+RL EE E + + C+QVR KSL SL+  LPE
Sbjct  614  RAGQNDENDPDKGVKDPVSERQFVVDSLKKRLDEEMEEHQKMCVQVREKSLGSLKIRLPE  673

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            LF A+S+++ +C   YQ L  I
Sbjct  674  LFRALSDYAHSCFDAYQRLRLI  695



>gb|EMS56206.1| hypothetical protein TRIUR3_11325 [Triticum urartu]
Length=472

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 180/266 (68%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+TM  +H+ Q +I+  L+S D+S + +ETSE H ERT QL  VVQE
Sbjct  202  PKLLELVKGMGHMWDTMYKNHKAQFKIISELKSFDISVAARETSEQHNERTVQLWQVVQE  261

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+Q+ K +  QKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D +
Sbjct  262  WHAQYSKFMASQKEYVGNLYSWIKLNVIPIDTNLKSNSSQPVET-TPPIKRLLHAWHDNL  320

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE A+ AI++FS VV+ I+ HQ +E+KL+ R +DTRKE E+++RQFEDW  KYM++
Sbjct  321  AKLPDEDARKAIHTFSEVVHIILVHQDEEIKLRQRIQDTRKEHERKSRQFEDWAQKYMEK  380

Query  396  RT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R   P +    DG   D  + ER+  +E L+  LKE EEAY +QC  VR KSL+ LRT L
Sbjct  381  RAGIPPEAGNPDGTRAD-PLAERKAAMEKLENSLKELEEAYTKQCKVVREKSLSLLRTNL  439

Query  222  PELFHAMSEFSRACSIMYQTLESITH  145
            PELF  +SEFS   + M++ L SI++
Sbjct  440  PELFRIVSEFSLQSAAMFKGLWSISN  465



>ref|XP_006658396.1| PREDICTED: uncharacterized protein LOC102701368, partial [Oryza 
brachyantha]
Length=437

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 181/266 (68%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+TM  HH+ Q +I+  L+SLD+S + +ETS+ H++RT QL  VVQ+
Sbjct  167  PKLLELVKGMGVMWDTMYIHHKTQLRIISGLKSLDISVAARETSDQHHDRTVQLYNVVQD  226

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++
Sbjct  227  WHAQFDKFMTYQKQYVGSLYSWIKLNVIPIDTNLKPNSSQPHET-TPPIKRLLHAWHDIL  285

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDE AK AIY+F+ +V TI+ HQ DE+KL+ + +DTR+E  ++ RQF+DW  KYM +
Sbjct  286  GKLPDEAAKKAIYTFAEIVKTILVHQEDELKLRLKIEDTRREHGRKRRQFDDWAQKYMHK  345

Query  396  RTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
                  +D   DG   D  ++ER+  +E ++  +KE EE Y++QC  VR KSL  LRT L
Sbjct  346  TAGILPEDGNPDGLRAD-PMVERKAAMERMELSMKELEETYVKQCRVVREKSLNLLRTSL  404

Query  222  PELFHAMSEFSRACSIMYQTLESITH  145
            PELF  +S+FS   + M++ L SI H
Sbjct  405  PELFTVVSDFSLQSAGMFKGLWSIAH  430



>ref|XP_006655291.1| PREDICTED: uncharacterized protein LOC102706661 [Oryza brachyantha]
Length=553

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 181/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++
Sbjct  280  PRLLDLADRMAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEK  339

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F  ++ +QKEY+  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  340  WTANFSDLMSYQKEYVNALYSWLKLNLIPIESSLKEKVASPPRAQQPPVKALLQAWNEHL  399

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QR
Sbjct  400  TKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYTRKARAFEDWYHKHAQR  459

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  + D E  +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LP
Sbjct  460  RAFDVDPESGEGTTQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLP  519

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   MY  L
Sbjct  520  ELFRALTDFSHASFDMYSKL  539



>ref|XP_009393120.1| PREDICTED: uncharacterized protein LOC103978894 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/273 (48%), Positives = 189/273 (69%), Gaps = 3/273 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LVE MA+MW+ M  HH +Q +++  +++LD+S + KETSEHH++RT QL   V+E
Sbjct  396  PKLVELVEGMAKMWQAMHMHHYSQLKMMEGIKALDISNASKETSEHHHKRTLQLLDTVRE  455

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQ  K++ HQK+Y+  L+ WLKLNL+PID +LKEKVSSPQRP + PI  L+HAW + +
Sbjct  456  WQSQLHKLVTHQKQYVGALDSWLKLNLIPIDGSLKEKVSSPQRPAHAPIQTLVHAWHEYL  515

Query  576  GK-LPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
             K LP+ELA TA+ SFSAV+NTI   Q +E+K K+RC + +K   ++ R FEDW  K+ Q
Sbjct  516  EKQLPEELANTALLSFSAVLNTIEAVQQEELKQKERCGEIQKAYLRKKRAFEDWCQKHSQ  575

Query  399  RRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            +R    +T  +   +++ V ER+  +E+LK +L E  EA+   C QVR KS  +L+T LP
Sbjct  576  KRMGEPETGGEAASQNDPVGERRRVVESLKSKLDEGVEAHKGICKQVREKSSVTLKTHLP  635

Query  219  ELFHAMSEFSRACSIMYQTLESIT--HPLNRES  127
            ELF A+S+F+  CS MY +L+ +T  +PL + +
Sbjct  636  ELFRAVSDFAELCSKMYTSLKLVTDQNPLTKAT  668



>ref|XP_006394813.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
 gb|ESQ32099.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
Length=770

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/265 (51%), Positives = 199/265 (75%), Gaps = 3/265 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L SLVE MA+MW  M   H+ Q +IV  L+SL++S   KET++ H+++T Q   V++E
Sbjct  498  PRLVSLVEGMAKMWTNMCIQHDTQLKIVGELKSLEISTCHKETTKQHHQQTRQFCTVLEE  557

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct  558  WHAQFDRLVTHQKQYINSLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDCL  617

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FE+WY K++Q+
Sbjct  618  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEEWYQKHLQK  677

Query  396  RTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R P    +  +D    D +V ER++ +E LK+RL++EEEA+ R C+QVR KSL SL+  L
Sbjct  678  RGPMEEGEGGEDASSRD-HVTERRIVVETLKKRLEDEEEAHQRHCVQVREKSLNSLKIRL  736

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PE+F A+S+++ AC+  Y+ L  I+
Sbjct  737  PEIFRALSDYAHACADSYEKLRIIS  761



>ref|XP_002874269.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50528.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 202/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S +ET++ H+ +T Q   V++E
Sbjct  486  PRLVALVEGMAKMWTNMCIHHDTQLGIVGELKSLEISTSLRETTKQHHHQTRQFCTVLEE  545

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++L+EKVSSP RPQ PPI ALLH+W D +
Sbjct  546  WHVQFDRLVTHQKQYINALNSWLKLNLIPIESSLREKVSSPPRPQRPPIQALLHSWHDRL  605

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI+SF+ V+ TI+ HQ DEMKLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  606  EKLPDEVAKSAIFSFAEVIKTILLHQEDEMKLKEKCEETRREFIRKKQGFEDWYQKHLQK  665

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  666  RGPTEEAEGGDDTTTSARDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  725

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ AC+  Y+ L  I  +H  N  +T
Sbjct  726  LPEIFRALSDYAHACADSYEKLRIISQSHKSNGGAT  761



>ref|NP_197941.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM13874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91720.1| unknown protein [Arabidopsis thaliana]
 gb|AED93470.1| uncharacterized protein AT5G25590 [Arabidopsis thaliana]
Length=775

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 198/266 (74%), Gaps = 3/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L++L++S S KET++ H+ +T Q   V++E
Sbjct  497  PRLVALVEGMAKMWTNMCIHHDTQLGIVGELKALEISTSLKETTKQHHHQTRQFCTVLEE  556

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+ ++ HQK+YI  LN+WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct  557  WHVQFDTLVTHQKQYINSLNNWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRL  616

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  617  EKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKEKCEETRREFIRKKQGFEDWYQKHLQK  676

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  677  RGPTEEAEGGDDATTSSRDHVTERRIAVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  736

Query  225  LPELFHAMSEFSRACSIMYQTLESIT  148
            LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  737  LPEIFRALSDYAHACADSYEKLRIIS  762



>dbj|BAJ96225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 179/265 (68%), Gaps = 4/265 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+ M  HH+ Q +I+  L+S D+S +  +TSE H ERT QL  VV+E
Sbjct  461  PKLLELVKGMGHMWDAMYKHHKAQLKIISELKSFDVSVAAPDTSERHNERTMQLWQVVRE  520

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+Q+ K + HQKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++
Sbjct  521  WHAQYSKFMEHQKEYVGNLYSWIKLNVIPIDTNLKSNSSQPVE-TTPPIKRLLHAWHDIL  579

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDE AK +I++FS V+ TI+ HQ +EMKL  R +DTRKE E+++RQFEDW  KYM++
Sbjct  580  GKLPDEAAKNSIHTFSEVIRTILVHQGEEMKLWQRIQDTRKEHERKSRQFEDWARKYMEK  639

Query  396  RT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R   P +    DG   D  + +R+  +E L+  LK+ EE Y +QC  VR KSL+ LRT L
Sbjct  640  RAGIPPEAGNPDGTRAD-PLADRKASMERLELSLKDLEEEYTKQCKVVREKSLSLLRTSL  698

Query  222  PELFHAMSEFSRACSIMYQTLESIT  148
            PELF  +S+FS   + M+++L SI+
Sbjct  699  PELFRVVSDFSLQSAAMFKSLWSIS  723



>ref|XP_006287097.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
 gb|EOA19995.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
Length=791

 Score =   257 bits (656),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 201/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  513  PRLVALVEGMAKMWTNMCIHHDTQLSIVGELKSLEISTSQKETTKQHHHQTRQFCTVLEE  572

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALL AW D +
Sbjct  573  WHVQFDRLVTHQKQYINYLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLFAWHDRL  632

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  633  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQK  692

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  693  RGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCIQVREKSLNSLKIR  752

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ AC+  Y+ L  I  +H  N  +T
Sbjct  753  LPEIFRALSDYAHACADSYEKLRIISQSHKANSGAT  788



>ref|XP_010421422.1| PREDICTED: DNA ligase 1-like isoform X3 [Camelina sativa]
Length=790

 Score =   257 bits (656),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 202/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  512  PRLVALVEGMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEE  571

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct  572  WHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRL  631

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  632  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQK  691

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  692  RGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  751

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  752  LPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  787



>ref|XP_010228227.1| PREDICTED: formin-like protein 5 [Brachypodium distachyon]
Length=741

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 182/264 (69%), Gaps = 4/264 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV  M +MW+ M GHH+ Q +I+L L+S D+S + +ETS+ H +RT QL  +VQE
Sbjct  471  PKLLELVNGMWQMWDKMYGHHKAQLKIILELKSFDISVAARETSDQHNDRTVQLWHIVQE  530

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+Q++K + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++
Sbjct  531  WHTQYDKFMTYQKQYVGSLYSWIKLNVIPIDTNLKPNSSQPVE-TTPPIKRLLHAWHDIL  589

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPD+ AK AI++F+ VV+TI+ HQ DEMKL  + ++TRK+ E++ RQFEDW  +YM++
Sbjct  590  GKLPDDAAKKAIHTFAEVVHTILLHQDDEMKLSIKIQETRKDYERKKRQFEDWAQRYMEK  649

Query  396  RT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            R   P++    DG   D  + ER++ +E L+  LK+ EE Y +QC  VR KSL+ LRT L
Sbjct  650  RAGIPHEAGNPDGTRAD-PLAERKVAVERLELVLKDLEEQYKKQCRVVREKSLSLLRTNL  708

Query  222  PELFHAMSEFSRACSIMYQTLESI  151
            PELF  +SEFS   + M + L SI
Sbjct  709  PELFRVVSEFSLQSAAMLKGLWSI  732



>ref|XP_010421421.1| PREDICTED: DNA ligase 1-like isoform X2 [Camelina sativa]
Length=792

 Score =   256 bits (655),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 202/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  514  PRLVALVEGMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEE  573

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct  574  WHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRL  633

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  634  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQK  693

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  694  RGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  753

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  754  LPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  789



>ref|XP_010421420.1| PREDICTED: DNA ligase 1-like isoform X1 [Camelina sativa]
Length=796

 Score =   256 bits (655),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 202/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  518  PRLVALVEGMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEE  577

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct  578  WHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRL  637

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  638  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQK  697

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  698  RGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  757

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  758  LPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  793



>gb|EEE63626.1| hypothetical protein OsJ_18443 [Oryza sativa Japonica Group]
Length=663

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 181/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++
Sbjct  392  PRLLDLADRMAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEK  451

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  452  WTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHL  511

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QR
Sbjct  512  TKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQR  571

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  + D E  +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LP
Sbjct  572  RAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLP  631

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   MY  +
Sbjct  632  ELFRALTDFSLASFEMYSKM  651



>gb|EEE66795.1| hypothetical protein OsJ_23540 [Oryza sativa Japonica Group]
Length=561

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 180/266 (68%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV E
Sbjct  291  PKLLELVKGMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHE  350

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++
Sbjct  351  WHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEIL  409

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +
Sbjct  410  GKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQ  469

Query  396  RTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
                  +D   DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT L
Sbjct  470  TAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNL  528

Query  222  PELFHAMSEFSRACSIMYQTLESITH  145
            PELF  +S+FS   + M++ + SI H
Sbjct  529  PELFRVVSDFSLQSAGMFKGVWSIAH  554



>ref|XP_010454904.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Camelina sativa]
 ref|XP_010454905.1| PREDICTED: ABC transporter F family member 4-like isoform X2 
[Camelina sativa]
Length=798

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 202/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  520  PRLVALVEGMAKMWTNMCIHHDTQLTIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEE  579

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI +LLH+W D +
Sbjct  580  WHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQSLLHSWHDRL  639

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  640  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQK  699

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  700  RGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  759

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  760  LPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  795



>ref|XP_010493822.1| PREDICTED: DNA ligase 1-like [Camelina sativa]
Length=800

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 202/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +LVE MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++E
Sbjct  522  PRLVALVEGMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEE  581

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI +LLH+W D +
Sbjct  582  WHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQSLLHSWHDRL  641

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct  642  EKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQK  701

Query  396  RTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct  702  RGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR  761

Query  225  LPELFHAMSEFSRACSIMYQTLESI--THPLNREST  124
            LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  762  LPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  797



>gb|EEC79170.1| hypothetical protein OsI_19854 [Oryza sativa Indica Group]
Length=665

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 181/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++
Sbjct  394  PRLLDLADRMAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEK  453

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  454  WTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHL  513

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QR
Sbjct  514  TKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQR  573

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  + D E  +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LP
Sbjct  574  RAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLP  633

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   +Y  +
Sbjct  634  ELFRALTDFSLASFEIYSKM  653



>emb|CDM83169.1| unnamed protein product [Triticum aestivum]
Length=437

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 189/275 (69%), Gaps = 8/275 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+E
Sbjct  161  PKLVDLVDGMAKMWSSMHRHHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVRE  220

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+K++ HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D +
Sbjct  221  WHMQFDKLMDHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQL  280

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R
Sbjct  281  ERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKKAQFEDWHRRYTER  340

Query  396  RTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            +      E+  P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR
Sbjct  341  KASQG--EEANPEAANTPSLDHVNERRIAIEEVEIRLKEEEKLHLRLVRQVREKTLANLR  398

Query  231  TGLPELFHAMSEFSRACSIMYQTL-ESITHPLNRE  130
              LPELF  M++FS  C  MY +L +S   P+ R+
Sbjct  399  MHLPELFRNMADFSFFCHDMYSSLRKSAVLPMLRD  433



>ref|XP_006826988.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
 gb|ERM94225.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
Length=693

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 181/267 (68%), Gaps = 5/267 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ +A+MWE M  +HENQ +IV  LRSLD+S +PKETS+ H+++T QL    ++
Sbjct  418  PKLVELVDGLAKMWEAMYQNHENQLKIVADLRSLDISNAPKETSKEHHKQTGQLCQAAKD  477

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W S F+ ++  QK+YI  LN WL+LNL+PI+++LKEKVSSP R  NPPI  LLH W   +
Sbjct  478  WDSHFKNLVTLQKKYIEALNSWLRLNLIPIESSLKEKVSSPPRVVNPPIHTLLHEWHARL  537

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKL DE+   AI  F+AV+  I + Q +E+K+K+RC +  ++  ++ R F DW  KY+ +
Sbjct  538  GKLSDEVTINAISGFAAVIEAIHKQQAEEIKIKERCAELEEDYNRKNRSFVDWKQKYLDK  597

Query  396  RTPND-DTE---QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            R P + D E   + G H+D  ++E++  +E LK+R  EE E + + C QVR KSL SL+T
Sbjct  598  RGPEEVDGERGGEGGTHKD-PLVEKEFVVETLKKRFDEEVELHRKICKQVREKSLGSLKT  656

Query  228  GLPELFHAMSEFSRACSIMYQTLESIT  148
            GLP LF A+S+++  CS +Y+ L  +T
Sbjct  657  GLPPLFRAISDYAHTCSEVYKELHVVT  683



>gb|EAZ03209.1| hypothetical protein OsI_25359 [Oryza sativa Indica Group]
Length=599

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 180/266 (68%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV E
Sbjct  329  PKLLELVKGMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHE  388

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++
Sbjct  389  WHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEIL  447

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +
Sbjct  448  GKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQ  507

Query  396  RTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
                  +D   DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT L
Sbjct  508  TAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNL  566

Query  222  PELFHAMSEFSRACSIMYQTLESITH  145
            PELF  +S+FS   + M++ + SI H
Sbjct  567  PELFRVVSDFSLQSAGMFKGVWSIAH  592



>gb|AAT93897.1| unknown protein [Oryza sativa Japonica Group]
Length=847

 Score =   254 bits (649),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 181/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++
Sbjct  527  PRLLDLADRMAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEK  586

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  587  WTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHL  646

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QR
Sbjct  647  TKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQR  706

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  + D E  +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LP
Sbjct  707  RAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLP  766

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   MY  +
Sbjct  767  ELFRALTDFSLASFEMYSKM  786



>dbj|BAC16409.1| putative bZIP protein [Oryza sativa Japonica Group]
 dbj|BAD31698.1| putative bZIP protein [Oryza sativa Japonica Group]
Length=737

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 180/266 (68%), Gaps = 4/266 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV E
Sbjct  467  PKLLELVKGMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHE  526

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++
Sbjct  527  WHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEIL  585

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +
Sbjct  586  GKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQ  645

Query  396  RTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
                  +D   DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT L
Sbjct  646  TAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNL  704

Query  222  PELFHAMSEFSRACSIMYQTLESITH  145
            PELF  +S+FS   + M++ + SI H
Sbjct  705  PELFRVVSDFSLQSAGMFKGVWSIAH  730



>gb|EMT10854.1| hypothetical protein F775_26145 [Aegilops tauschii]
Length=628

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 175/259 (68%), Gaps = 0/259 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L + +A+MWE M  HH NQ + VL L+S+D+S S  ETS HH+  T QL  +V +
Sbjct  356  PKLLDLADRLAKMWEDMHMHHANQLKTVLDLKSVDISDSSIETSAHHHSHTRQLHDIVDK  415

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++ F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  416  WNTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEQL  475

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LA+ AI SF AV+ TI+  Q +E+K K+ C+   KE  ++ R FE+WYHK+ QR
Sbjct  476  AKLPDDLARHAIVSFRAVLETILGVQDEELKKKEACEQIHKEYVRKARAFEEWYHKHGQR  535

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RT +D    +G  + + + E++  +E+LK +L  E EA+ +   QVR KSL+ LR  LPE
Sbjct  536  RTFDDPESGEGTSQKDAISEKRFAVESLKSKLDNEVEAHNKLSKQVREKSLSILRAHLPE  595

Query  216  LFHAMSEFSRACSIMYQTL  160
            LF A+++FS A + M+  L
Sbjct  596  LFRALTDFSHATADMHSKL  614



>gb|EMT20964.1| hypothetical protein F775_31339 [Aegilops tauschii]
Length=268

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 182/266 (68%), Gaps = 8/266 (3%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  730
            MA MW +M  HH++Q   +  +R+ ++   P+ET++ HY++T +L  +V+EWH QF+K++
Sbjct  1    MANMWSSMHRHHKSQFLTISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFDKLM  60

Query  729  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  550
             HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW DL+ +LP ELAK
Sbjct  61   DHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDLLERLPVELAK  120

Query  549  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  370
            TAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R+      E+
Sbjct  121  TAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKRAQFEDWHRRYTERKA--SQGEE  178

Query  369  DGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  205
              P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR  LPELF  
Sbjct  179  ANPEAANTPSLDHVNERRITIEEVEIRLKEEEKLHLRLARQVREKTLANLRMHLPELFRN  238

Query  204  MSEFSRACSIMYQTL-ESITHPLNRE  130
            M++FS  C  MY +L +S   P+ R+
Sbjct  239  MADFSFFCHDMYSSLRKSAVLPMLRD  264



>ref|XP_010254134.1| PREDICTED: uncharacterized protein LOC104595215 [Nelumbo nucifera]
Length=710

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 183/262 (70%), Gaps = 3/262 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA+MWE M  HH  Q +I + L++LD+SQ+PKETS  H E   QL  VVQE
Sbjct  439  PKLVTLVDGMAKMWELMHVHHRTQMEIAVDLKNLDISQAPKETSIQHSECIKQLWNVVQE  498

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++Q +K++ +QK+YIR LN+WLKLNL+PI+++LKEKVSSP +   PPI  LL AW + +
Sbjct  499  WNTQLQKLMANQKDYIRALNNWLKLNLIPIESSLKEKVSSPLKVSRPPIHHLLQAWNEHL  558

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             K+ D +A++AI +F+A + TI+  Q +E+KLKD+C++  KEL +R R  +    KY+++
Sbjct  559  EKVTDGVARSAITAFAAGIETIILQQDEEIKLKDKCEEISKELARRERILDASRRKYLEK  618

Query  396  RTPNDDTEQDGPHEDNNVIE-RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            RTP D  E D  + D N +E +QL +  L++RL++E E Y + C QVR KS  +L+  LP
Sbjct  619  RTPPD--EMDPDNVDKNPLEDKQLMVATLRKRLEDELEQYQKHCRQVREKSFVNLKMHLP  676

Query  219  ELFHAMSEFSRACSIMYQTLES  154
            EL  AMS FS AC+ MY+ L S
Sbjct  677  ELCRAMSVFSLACTNMYKDLRS  698



>dbj|BAJ96409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=791

 Score =   248 bits (634),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 174/259 (67%), Gaps = 0/259 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L +  A+MWE M  HH NQ + VL L+S+D+S S  ETS HH+  T QL  +V +
Sbjct  519  PKLLDLADRQAKMWEDMHMHHANQLKTVLDLKSVDISDSSIETSAHHHSHTRQLHDIVDK  578

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++ F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  579  WNTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEQL  638

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LA+ AI SF AV+ TI+  Q +E+K K+ C+   KE  ++ R FE+WYHK+ QR
Sbjct  639  AKLPDDLARHAIVSFRAVLETILGVQDEELKKKEVCEQIHKEYVRKARAFEEWYHKHGQR  698

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RT +D    DG  + + + ER+  +E+LK +L  E EA+ +   QVR KSL+ LR  LPE
Sbjct  699  RTFDDPESGDGTSQKDAISERRFAVESLKSKLDNEVEAHNKLSKQVREKSLSILRAHLPE  758

Query  216  LFHAMSEFSRACSIMYQTL  160
            LF A+++FS A + M+  L
Sbjct  759  LFRALTDFSHATADMHSKL  777



>gb|EMS63249.1| hypothetical protein TRIUR3_24469 [Triticum urartu]
Length=268

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 175/255 (69%), Gaps = 7/255 (3%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  730
            MA MW +M  HH++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+EWH QF+K++
Sbjct  1    MANMWSSMHRHHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFDKLM  60

Query  729  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  550
             HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D + +LP ELAK
Sbjct  61   EHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQLERLPVELAK  120

Query  549  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  370
            TAI SF+ V++ IV  Q +E+ L+ RC +TR++L+++  QFEDW+ +Y +R+      E+
Sbjct  121  TAIKSFTEVISNIVLLQEEEVSLRRRCDETRRDLDRKRAQFEDWHRRYTERKA--SQGEE  178

Query  369  DGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  205
              P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR  LPELF  
Sbjct  179  PNPEAANTPSLDHVNERRIAIEEVEIRLKEEEKLHLRLARQVREKTLANLRMHLPELFRN  238

Query  204  MSEFSRACSIMYQTL  160
            M++FS  C  MY +L
Sbjct  239  MADFSFFCHDMYSSL  253



>ref|XP_010033880.1| PREDICTED: uncharacterized protein LOC104423116 [Eucalyptus grandis]
 gb|KCW53731.1| hypothetical protein EUGRSUZ_J02988 [Eucalyptus grandis]
Length=726

 Score =   247 bits (630),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/270 (47%), Positives = 186/270 (69%), Gaps = 7/270 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW+ MK  HENQ + V  L  L++ ++ KETSEHH++RT QL  VV +
Sbjct  458  PKLVELVDGMAKMWDAMKVCHENQYKTVRNLAYLEIDRAAKETSEHHHDRTLQLLKVVGD  517

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+ QF  ++ +QK+YI+ L +WLK+N++PI+++L+EKVSSP R +NP I  L+HAW + +
Sbjct  518  WNEQFRNVMDNQKKYIKALKNWLKVNVIPIESSLREKVSSPPRDENPLIQKLVHAWDETL  577

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDELA+T ++SF  V+ TI+  Q DE+  K RC++ R+EL ++ R  ++    Y+ R
Sbjct  578  QKLPDELARTEMHSFHEVLATILSIQEDEIGFKHRCEEFRRELNRKERSLKE----YIAR  633

Query  396  RTPNDDTE--QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            RTP DD +   DG +  N + E+++ +E LK+ L EEE+A+ R C+QVR K+L S +  L
Sbjct  634  RTPPDDMDPAHDGRY-INVITEKEVAVETLKKMLAEEEDAHQRMCLQVREKTLVSFKNRL  692

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNR  133
            PE+F A+S F+RA S MY  L S + P  R
Sbjct  693  PEVFRALSTFARASSQMYGNLRSSSQPQKR  722



>gb|EMS61963.1| hypothetical protein TRIUR3_31953 [Triticum urartu]
Length=695

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 175/259 (68%), Gaps = 0/259 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L + +A+MWE M  HH NQ + VL L+S+D+S S  ETS HH+  T QL  +V +
Sbjct  372  PKLLDLADRLAKMWEDMHMHHANQLKTVLDLKSVDISDSSIETSAHHHSHTRQLHDIVDK  431

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++ F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct  432  WNTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEQL  491

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LA+ AI SF AV+ TI+  Q +E+K K+ C+   KE  ++ R FE+WYHK+ QR
Sbjct  492  AKLPDDLARHAIVSFRAVLETILGVQDEELKKKEACEQIHKEYVRKARAFEEWYHKHGQR  551

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RT +D    +G  + + + E++  +E+LK +L  E EA+ +   QVR KSL+ LR  LPE
Sbjct  552  RTFDDPESGEGTSQKDAISEKRFAVESLKSKLDSEVEAHNKLSKQVREKSLSILRAHLPE  611

Query  216  LFHAMSEFSRACSIMYQTL  160
            LF A+++FS A + M+  L
Sbjct  612  LFRALTDFSHATAEMHSKL  630



>emb|CDM82883.1| unnamed protein product [Triticum aestivum]
Length=797

 Score =   246 bits (628),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 189/275 (69%), Gaps = 8/275 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+E
Sbjct  521  PKLVDLVDGMAKMWSSMHRHHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVRE  580

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF+K++ HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D +
Sbjct  581  WHMQFDKLMDHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQL  640

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R
Sbjct  641  ERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKKAQFEDWHRRYTER  700

Query  396  RTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            +      E+  P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR
Sbjct  701  KA--SQGEEANPEAANTPSLDHVNERRIAIEEVEIRLKEEEKLHLRLVRQVREKTLANLR  758

Query  231  TGLPELFHAMSEFSRACSIMYQTL-ESITHPLNRE  130
              LPELF  M++FS  C  MY +L +S   P+ R+
Sbjct  759  MHLPELFRNMADFSFFCHDMYSSLRKSAVLPMLRD  793



>ref|XP_003568507.1| PREDICTED: ras and Rab interactor 3 [Brachypodium distachyon]
Length=779

 Score =   244 bits (624),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 182/266 (68%), Gaps = 2/266 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  L + MA+MW+ M  HH +Q + VL L+S+D+S S  ETS HH+  T QL  +V++
Sbjct  510  PKLLDLADRMAKMWKDMHMHHGDQLKTVLDLKSVDISDSNIETSRHHHSHTRQLRDIVEK  569

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W++ F  ++ +QKEY+  L  WLKLNL+PI+++L+EKV+SP R Q PPI ALL AW + +
Sbjct  570  WNTNFSDLMSYQKEYVNALYSWLKLNLIPIESSLREKVASPPRMQQPPIKALLQAWNEHL  629

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LA+ AI SF AV++TI+  Q +E+K K+ C+   KE  ++ R FEDWYHK+ QR
Sbjct  630  AKLPDDLARHAIVSFRAVLDTILSVQDEELKQKENCEQIHKEYARKVRAFEDWYHKHAQR  689

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            ++ + D E  +G  + + + ER+  +E+LK RL +E E + +   QVR KSL+ L+  LP
Sbjct  690  KSFDVDPESGEGTGQKDVISERRFAVESLKSRLDDEIEVHNKLSKQVREKSLSILKAHLP  749

Query  219  ELFHAMSEFSRACSIMYQTLE-SITH  145
            ELF A+++FS AC  M+  L+  +TH
Sbjct  750  ELFRALTDFSHACFEMHSKLKIDVTH  775



>dbj|BAJ94711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=804

 Score =   243 bits (620),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 180/264 (68%), Gaps = 7/264 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW +M   H++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+E
Sbjct  528  PKLMDLVDGMANMWSSMHRQHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVRE  587

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D +
Sbjct  588  WHMQFEKLMDHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQL  647

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R
Sbjct  648  ERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKRAQFEDWHRRYTER  707

Query  396  RTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            +      E+  P   N     +V ER++ +E ++ RLKEEE  ++R   QVR K+L +LR
Sbjct  708  KA--SQGEEANPEAANTSSLDHVNERRIAIEEVEIRLKEEERLHLRLARQVREKTLANLR  765

Query  231  TGLPELFHAMSEFSRACSIMYQTL  160
              LPELF  M++FS  C  MY +L
Sbjct  766  MHLPELFRNMTDFSFFCHDMYSSL  789



>ref|XP_010249762.1| PREDICTED: uncharacterized protein LOC104592230 isoform X1 [Nelumbo 
nucifera]
Length=703

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 187/263 (71%), Gaps = 1/263 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA+MWE M  +H  Q ++ + L+ +D+SQ  KETS  HYERT QL  VVQE
Sbjct  437  PKLVALVDGMAQMWEAMHVNHARQMRLAVDLKDIDISQETKETSRQHYERTRQLFHVVQE  496

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W +Q +K+I HQKEYI+ L+ WLKLNL+PI+++LKEKVS P +    PI  LL AW + +
Sbjct  497  WQAQLQKVITHQKEYIQALSSWLKLNLIPIESSLKEKVSCPPKVPCTPIQPLLQAWGEQL  556

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
            GKLPD +A++A+ +F+A +  I+  Q+DEMKLK++ ++T KELE+R +   +   KYM+R
Sbjct  557  GKLPDGVARSAVGTFAASIEAIMVQQMDEMKLKEKWEETSKELERREKHLMEARQKYMER  616

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            RTP D+ + D    D    ++Q  +++L++RL+EE+E + +   QVR KSL +L+  LPE
Sbjct  617  RTPPDEMDPDNADRD-PFEDKQFIVDSLRKRLEEEKEEHQKNYRQVREKSLVNLKIHLPE  675

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            L  AMS+FSR CS++Y+ L+SI+
Sbjct  676  LCRAMSDFSRDCSMLYKELKSIS  698



>ref|XP_002439756.1| hypothetical protein SORBIDRAFT_09g019490 [Sorghum bicolor]
 gb|EES18186.1| hypothetical protein SORBIDRAFT_09g019490 [Sorghum bicolor]
Length=812

 Score =   241 bits (614),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 176/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE M  HH NQ + VL L+ +D+S +  ETS++H+  T QL  +V +
Sbjct  541  PRLLDLADRMAKMWEDMHMHHANQLETVLNLKLVDISDARIETSDYHHSHTRQLRYIVDK  600

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PPI A L AW + +
Sbjct  601  WITNFTDLMNYQKEYINTLYSWLKLNLIPIESSLKEKVTSPPRMQQPPIKAFLQAWNEHL  660

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI +F AV++TI+  Q +E+K K+ C+ TR+E  ++ R FEDWYHK+ QR
Sbjct  661  TKLPDDLAKTAIVTFRAVLDTILGVQDEELKQKETCEQTRREYMRKARAFEDWYHKHSQR  720

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            +  + D E  +G    + V E++  +E+LK RL +E E++ +   QVR KSL+ L+  LP
Sbjct  721  KASDVDPESGEGIGHKDAVTEKKFAVESLKSRLDDEIESHNKLSKQVREKSLSILKAHLP  780

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   MY  L
Sbjct  781  ELFRALTDFSSASFDMYSKL  800



>ref|XP_002457866.1| hypothetical protein SORBIDRAFT_03g017350 [Sorghum bicolor]
 gb|EES02986.1| hypothetical protein SORBIDRAFT_03g017350 [Sorghum bicolor]
Length=264

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 173/253 (68%), Gaps = 3/253 (1%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  730
            MA+MW +M  HH +Q  I+  +R  ++   P+ET++ HY +T +L  +V+EWH+QFEK++
Sbjct  1    MAKMWSSMHRHHRSQFLIISGIRGFEIPSVPRETTDSHYIQTCELRDIVKEWHTQFEKLM  60

Query  729  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  550
             +QK YIR LN WLKLNL+PI++N+KEKVSSP R  +PPI  LLHAW D + +LP ELAK
Sbjct  61   DNQKAYIRALNAWLKLNLIPIESNIKEKVSSPPRLVDPPIKHLLHAWHDELERLPIELAK  120

Query  549  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP-NDDTE  373
            TAI +F+ V++ IV  Q +E+ L+ RC +TR++L ++   FEDW+ KY++RR    +DT 
Sbjct  121  TAIKTFAEVMSNIVHLQEEEVNLRRRCDETRRDLTRKRAHFEDWHQKYLERRAAFGEDTN  180

Query  372  QDGPHEDN--NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  199
             D     N   V +R+  +E L+ RL+EEE  ++R   QVR KSL +LRT LPELF  M+
Sbjct  181  PDAAETQNIDPVEDRKRNIEELEVRLREEEGHHLRHARQVREKSLANLRTHLPELFRNMA  240

Query  198  EFSRACSIMYQTL  160
            +F+  C  MY  L
Sbjct  241  DFAYFCHDMYNNL  253



>emb|CBI20923.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL +LV+ MA+MW  M   H +Q ++V  L+S+D+SQ+PKETS+HH+ERT QL   +Q 
Sbjct  219  PKLVALVDGMAKMWNDMCMQHNSQLKMVTDLKSIDISQAPKETSKHHHERTIQLWNEIQG  278

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHSQFEK++ H+K+YI+ LN WLKLNL+PI+++LKEK+SSP RPQ+PPI ALLH+W D +
Sbjct  279  WHSQFEKLVTHEKQYIQALNSWLKLNLIPIESSLKEKISSPPRPQHPPIQALLHSWHDSL  338

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
             KLP ELAK+AI SF+AV+ TI+ HQ +EMKLK++C++T+KE  ++ + F+DWY KYMQ
Sbjct  339  EKLPHELAKSAISSFAAVIKTIILHQEEEMKLKEKCEETQKEYSRKHQAFQDWYQKYMQ  397



>ref|NP_001169630.1| hypothetical protein [Zea mays]
 gb|ACN34343.1| unknown [Zea mays]
 tpg|DAA54627.1| TPA: hypothetical protein ZEAMMB73_367183 [Zea mays]
Length=783

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 181/259 (70%), Gaps = 7/259 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH +Q  I+  +R  ++   P+ET++ HY +T +L  +V+E
Sbjct  521  PKLMDLVDGMAKMWSSMYRHHRSQFLIISGIRGFEIPPIPRETTDSHYIQTCELRDIVRE  580

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QFEK++ +QK YIR LN WLKLNL+PI++N+KEKVSSP R  +PPI  LLHAW D +
Sbjct  581  WHTQFEKLMDNQKAYIRALNAWLKLNLIPIESNIKEKVSSPPRLVDPPIKHLLHAWHDEL  640

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI +F+ V++TIV  Q +E+ L+ RC +TR++L ++  QFEDW+ KY++R
Sbjct  641  ERLPIELAKTAIKTFAEVISTIVHLQEEEVNLRRRCDETRRDLNRKKAQFEDWHQKYLER  700

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
            +T   +T+   P ED     R+  +E L+ RL+EEE  ++R   QVR KSL +LRT LPE
Sbjct  701  QTA--ETQNIDPVED-----RKRTIEELEIRLREEEGHHLRHARQVREKSLANLRTHLPE  753

Query  216  LFHAMSEFSRACSIMYQTL  160
            LF  MS+F+  C  MY  L
Sbjct  754  LFRNMSDFAYFCKDMYNNL  772



>ref|XP_010667640.1| PREDICTED: uncharacterized protein LOC104884645 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=650

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MWE +  HH+NQ QI   L+SLD+  +P+ETS+ HY  T QL  VVQ+
Sbjct  434  PKLVELVDRMAQMWEDICIHHDNQLQIATELKSLDVILTPRETSKPHYHCTLQLSNVVQQ  493

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W  +FE ++  QK Y+R LN WLKLNL+PI++NLKEK+SSP R  +PPI ALLHAW D +
Sbjct  494  WQDRFETLVHQQKHYVRSLNSWLKLNLIPIESNLKEKISSPPRAHHPPIQALLHAWHDAL  553

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE+ +TAI SF A++ TI+ HQ +EM+LK++C++TRKE  ++ + FEDWYHKYMQR
Sbjct  554  EKLPDEVTRTAISSFGAMIKTIILHQDEEMRLKEKCEETRKEFLRKNQAFEDWYHKYMQR  613

Query  396  RTP---NDDTEQDGPHEDNNVIERQL  328
            + P   + +  +DGP +D  V ERQ+
Sbjct  614  KGPEAMDSERGEDGPGKD-PVSERQV  638



>ref|NP_001172370.1| Os01g0500550 [Oryza sativa Japonica Group]
 dbj|BAD73247.1| bZIP protein-like [Oryza sativa Japonica Group]
 gb|EEE54643.1| hypothetical protein OsJ_01915 [Oryza sativa Japonica Group]
 dbj|BAH91100.1| Os01g0500550 [Oryza sativa Japonica Group]
Length=752

 Score =   238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW +M  HH+ Q  I+  +R+ +    P+ET++ HY++T  L  +V+E
Sbjct  477  PKLVDLVDGMANMWSSMHHHHKWQLVIISGIRNFEAPPVPRETTDQHYKQTCDLRDIVRE  536

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D +
Sbjct  537  WHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRLVEPPIKDLLYAWHDQL  596

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++TR++L ++  QFE+W+ +YM+R
Sbjct  597  ERLPIELAKTAIKSFAEVISNIVLLQEEEVNLRRRCEETRRDLNRKKAQFEEWHQRYMER  656

Query  396  RTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            +       +++E       + V +R+  +E ++ RL+EE   + R   QVR KSL +LR 
Sbjct  657  KASQGEDANNSEVAEAVNSDPVADRKTAIEEVEIRLREEMGHHNRIARQVREKSLANLRM  716

Query  228  GLPELFHAMSEFSRACSIMYQTL  160
             LPELF  M++F+  C  MY  L
Sbjct  717  HLPELFRNMTDFAGFCYEMYSNL  739



>gb|EEC70709.1| hypothetical protein OsI_02082 [Oryza sativa Indica Group]
Length=797

 Score =   238 bits (607),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW +M  HH+ Q  I+  +R+ +    P+ET++ HY++T  L  +V+E
Sbjct  522  PKLVDLVDGMANMWSSMHHHHKWQLVIISGIRNFEAPPVPRETTDQHYKQTCDLRDIVRE  581

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D +
Sbjct  582  WHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRLVEPPIKDLLYAWHDQL  641

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++TR++L ++  QFE+W+ +YM+R
Sbjct  642  ERLPIELAKTAIKSFAEVISNIVLLQEEEVNLRRRCEETRRDLNRKKAQFEEWHQRYMER  701

Query  396  RTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  229
            +       +++E       + V +R+  +E ++ RL+EE   + R   QVR KSL +LR 
Sbjct  702  KASQGEDANNSEVAEAVNSDPVADRKTAIEEVEIRLREEMGHHNRIARQVREKSLANLRM  761

Query  228  GLPELFHAMSEFSRACSIMYQTL  160
             LPELF  M++F+  C  MY  L
Sbjct  762  HLPELFRNMTDFAGFCYEMYSNL  784



>ref|NP_001168451.1| uncharacterized protein LOC100382224 [Zea mays]
 gb|ACN28274.1| unknown [Zea mays]
Length=677

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 175/260 (67%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE MK HH NQ +IVL L+S+D+  S  ETS++H+  T QL  +V +
Sbjct  406  PRLLDLTDRMAKMWEDMKIHHANQLKIVLNLKSVDIPDSNIETSDYHHSHTRQLRDIVDK  465

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F   +  QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PPI A L+AW + +
Sbjct  466  WITNFTDFMNCQKEYINALYGWLKLNLIPIESSLKEKVASPPRMQQPPIKAFLYAWHEHL  525

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI +F AV++TI+  Q +E+K K+ C+ TR+E  ++ R FEDW HK+ Q 
Sbjct  526  AKLPDDLAKTAIVTFRAVLDTILGVQDEELKQKEICEQTRREYIRKARAFEDWCHKHPQP  585

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  + D +  +G    + V E++  +E+LK +L +E E++ +   QVR KSL+ L+  LP
Sbjct  586  RAIDVDPDSGEGTGHKDVVTEKRFAVESLKSKLDDEIESHNKLSKQVREKSLSILKAHLP  645

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   MY  L
Sbjct  646  ELFRALTDFSDASFEMYSKL  665



>gb|AFW82165.1| hypothetical protein ZEAMMB73_214762 [Zea mays]
Length=775

 Score =   235 bits (599),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 175/260 (67%), Gaps = 1/260 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L + MA+MWE MK HH NQ +IVL L+S+D+  S  ETS++H+  T QL  +V +
Sbjct  504  PRLLDLTDRMAKMWEDMKIHHANQLKIVLNLKSVDIPDSNIETSDYHHSHTRQLRDIVDK  563

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W + F   +  QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PPI A L+AW + +
Sbjct  564  WITNFTDFMNCQKEYINALYGWLKLNLIPIESSLKEKVASPPRMQQPPIKAFLYAWHEHL  623

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD+LAKTAI +F AV++TI+  Q +E+K K+ C+ TR+E  ++ R FEDW HK+ Q 
Sbjct  624  AKLPDDLAKTAIVTFRAVLDTILGVQDEELKQKEICEQTRREYIRKARAFEDWCHKHPQP  683

Query  396  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
            R  + D +  +G    + V E++  +E+LK +L +E E++ +   QVR KSL+ L+  LP
Sbjct  684  RAIDVDPDSGEGTGHKDVVTEKRFAVESLKSKLDDEIESHNKLSKQVREKSLSILKAHLP  743

Query  219  ELFHAMSEFSRACSIMYQTL  160
            ELF A+++FS A   MY  L
Sbjct  744  ELFRALTDFSDASFEMYSKL  763



>ref|XP_004968820.1| PREDICTED: uncharacterized protein LOC101757982 [Setaria italica]
Length=791

 Score =   234 bits (597),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 177/272 (65%), Gaps = 3/272 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKLK LVE MA+MW  M  HH +Q  I+  +R  ++     E ++ HY +T +L  +V+E
Sbjct  519  PKLKDLVEGMAKMWSAMHRHHRSQFMIISGIRGFEIPPVTSERTDLHYNQTCELRDIVRE  578

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ +QK YIR LN WLKLNL+PI++N+KEKVSSP R  +PPI  LLHAW D +
Sbjct  579  WHMQFEKLMNNQKAYIRALNAWLKLNLIPIESNIKEKVSSPPRLVDPPIKNLLHAWHDEL  638

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI +F+ V++ IV  Q +E+ L+ RC +TR++L ++  QFEDW+ KY +R
Sbjct  639  ERLPIELAKTAIKTFAEVISNIVHLQEEEVNLRRRCDETRRDLTRKRAQFEDWHQKYTER  698

Query  396  RTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            R     N + E       + V +R+  +E L+ RL+EEE  ++RQ  QVR KSL +LRT 
Sbjct  699  RAALGENGNPEAAEVQNIDPVEDRKRVIEELEIRLREEEGHHLRQARQVREKSLANLRTH  758

Query  225  LPELFHAMSEFSRACSIMYQTLESITHPLNRE  130
            LPELF  M++FS  C  MY  L     P   E
Sbjct  759  LPELFRNMADFSYFCHDMYNNLRKAAAPAKDE  790



>ref|XP_004506851.1| PREDICTED: uncharacterized protein LOC101489547 [Cicer arietinum]
Length=568

 Score =   230 bits (587),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 174/272 (64%), Gaps = 11/272 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW  M  HHE Q  I+  LRS D SQ P ETSEHH++RTYQL +V+QE
Sbjct  295  PKLVQLVDGMATMWGIMHSHHEKQLNIMKLLRSSD-SQFPLETSEHHHDRTYQLLLVMQE  353

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPI-DTNLKEKVSSPQRPQNPPILALLHAWQDL  580
            W SQF+K I +QK +I+ L  WLKLNL  + D+++KE +SSP+   + PI  LLHAW D 
Sbjct  354  WESQFQKSINNQKGFIKALYTWLKLNLTLLNDSDIKENISSPK---SCPIQILLHAWNDR  410

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
            + KLPDE A+ AI +F A V+++ Q Q +E+ LK +C + RKE  +++ QF+ W  KY +
Sbjct  411  LEKLPDEFARIAIANFVAAVDSLYQRQQEELVLKRKCDEIRKEYTRKSTQFDQWESKYSK  470

Query  399  RR-----TPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL  235
            R+      PN  TE D    D  + E++  L  L++RL EE++A+ R C+ VR KSL  L
Sbjct  471  RKRLDEFDPN-RTEGDCNEADEVLKEKKRLLIELEKRLDEEKDAFERHCLHVRQKSLRCL  529

Query  234  RTGLPELFHAMSEFSRACSIMYQTLESITHPL  139
            +  L ELF  M++FS  CS MY  L  + H L
Sbjct  530  KNDLLELFRTMTDFSLECSKMYSELSYVVHKL  561



>ref|XP_003567735.1| PREDICTED: uncharacterized protein LOC100824905 [Brachypodium 
distachyon]
Length=796

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 183/264 (69%), Gaps = 7/264 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA MW +M  +H++Q  I+L +R+ ++   P+ET++ H+++T +L  +V+E
Sbjct  525  PKLGELVDGMANMWGSMHRYHKSQLLIILGIRAFEVPPVPRETTDVHHKQTCELRDIVRE  584

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LLHAW D +
Sbjct  585  WHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRQVEPPIKNLLHAWHDQL  644

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLP ELAKTAI SF+ V++ IV  Q +E+ L+ RC DTR++L ++  QF++W+ KYM+R
Sbjct  645  EKLPIELAKTAIKSFAEVISNIVVLQEEEINLRRRCDDTRRDLVRKKAQFQEWHLKYMER  704

Query  396  RT-----PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            +      PN +T +  P  D  V ER++ +E ++ RLKEEE  + R   QVR K+L +LR
Sbjct  705  KASLGEEPNPETAET-PTVD-PVNERKIAIEEVEIRLKEEEGHHHRLARQVREKTLANLR  762

Query  231  TGLPELFHAMSEFSRACSIMYQTL  160
              LPELF  M++FS  C  MY +L
Sbjct  763  MHLPELFRNMADFSFFCHDMYSSL  786



>ref|XP_010249763.1| PREDICTED: uncharacterized protein LOC104592230 isoform X2 [Nelumbo 
nucifera]
Length=670

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  730
            MA+MWE M  +H  Q ++ + L+ +D+SQ  KETS  HYERT QL  VVQEW +Q +K+I
Sbjct  413  MAQMWEAMHVNHARQMRLAVDLKDIDISQETKETSRQHYERTRQLFHVVQEWQAQLQKVI  472

Query  729  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  550
             HQKEYI+ L+ WLKLNL+PI+++LKEKVS P +    PI  LL AW + +GKLPD +A+
Sbjct  473  THQKEYIQALSSWLKLNLIPIESSLKEKVSCPPKVPCTPIQPLLQAWGEQLGKLPDGVAR  532

Query  549  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  370
            +A+ +F+A +  I+  Q+DEMKLK++ ++T KELE+R +   +   KYM+RRTP D+ + 
Sbjct  533  SAVGTFAASIEAIMVQQMDEMKLKEKWEETSKELERREKHLMEARQKYMERRTPPDEMDP  592

Query  369  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  190
            D    D    ++Q  +++L++RL+EE+E + +   QVR KSL +L+  LPEL  AMS+FS
Sbjct  593  DNADRD-PFEDKQFIVDSLRKRLEEEKEEHQKNYRQVREKSLVNLKIHLPELCRAMSDFS  651

Query  189  RACSIMYQTLESIT  148
            R CS++Y+ L+SI+
Sbjct  652  RDCSMLYKELKSIS  665



>ref|XP_008652191.1| PREDICTED: uncharacterized protein LOC103632124 [Zea mays]
 tpg|DAA60030.1| TPA: hypothetical protein ZEAMMB73_463294 [Zea mays]
Length=742

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 167/263 (63%), Gaps = 3/263 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+  A MW+ M   H+ Q +I+  L++ D+S + +ETSE H+ERT QL  VVQE
Sbjct  475  PKLLELVKGFAHMWDVMYARHKAQLKIITELKASDISVATRETSEQHHERTLQLWNVVQE  534

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++ + +QKEYI  L +W+KLN++PIDTN+K   S P     PPI  LLHAW D++
Sbjct  535  WHVQFDRFMTYQKEYIGSLYNWIKLNVIPIDTNIKPNSSQPHE-ATPPIKRLLHAWHDIL  593

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD   K AI++F+ VVNTI+ HQ DE+KL+ +  D R++LEK+ +QF+ W  K   R
Sbjct  594  EKLPDNETKKAIHTFAEVVNTILVHQDDELKLRLKIDDIRRDLEKKRKQFDSWAQKNWDR  653

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                 D   D P   +   ER+  ++ ++  LK+ E+ Y  QC  VR KSL  LR+ LPE
Sbjct  654  GASIPDG--DNPGRVDPAAERKAVVDRVENALKDLEDNYRTQCKVVRDKSLNLLRSNLPE  711

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF A+SEFS   +  ++ L SI 
Sbjct  712  LFRAVSEFSLQSAGYFKGLWSIA  734



>gb|EPS58005.1| hypothetical protein M569_16812 [Genlisea aurea]
Length=282

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/273 (42%), Positives = 175/273 (64%), Gaps = 15/273 (5%)
 Frame = -1

Query  909  MARMWETMKGHHENQCQIVLALRSLDMSQSPK-------ETSEHHYERTYQLGVVVQEWH  751
            MA+MW +M  H+++Q + V  L+SLD+S S         ETS  H+ERT QL + V++W+
Sbjct  1    MAKMWRSMCQHNDDQLKAVSGLKSLDVSGSVDSGSGAAIETSREHHERTKQLCIAVEQWN  60

Query  750  SQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP------ILALLHAW  589
            SQFEKM+ +Q++Y+  LN WLKLNL+PI++ L+EK S+      P       I  LL +W
Sbjct  61   SQFEKMVTNQRQYVNSLNGWLKLNLIPIESTLREKASAAAASSPPRNPTPPPIQPLLLSW  120

Query  588  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK  409
             D + KLPD++AK++I+SF  V+ +I  HQ +EMKL+++   TR+E  ++ + FE+WY +
Sbjct  121  HDHLEKLPDDVAKSSIFSFKEVIKSIALHQEEEMKLREKRDGTRREYLRKKQGFEEWYQR  180

Query  408  YMQRRTPNDDTEQDGPH--EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL  235
            ++QRRTP      DG      +  +ER++ +E LK+RL EE + + + C+ VR KSL SL
Sbjct  181  HVQRRTPPPRGADDGAETASKDPAVERRIAVEMLKKRLDEETDEHRKHCVHVREKSLASL  240

Query  234  RTGLPELFHAMSEFSRACSIMYQTLESITHPLN  136
            +  LPELF A+S++S AC   Y++L  +    N
Sbjct  241  KIRLPELFRALSDYSHACFDAYESLRMVIQSQN  273



>ref|XP_006644200.1| PREDICTED: uncharacterized protein LOC102708565 [Oryza brachyantha]
Length=760

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 175/262 (67%), Gaps = 3/262 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW +M  HH+ Q  I+  +R+ ++   P+ET++ H+++T  L  +V+E
Sbjct  486  PKLVDLVDGMAKMWSSMHQHHKWQLVILSGIRNFEVPPVPRETTDQHHKQTSDLRDIVRE  545

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QFEK++ +QK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D +
Sbjct  546  WHMQFEKLMDYQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRQVEPPIKDLLYAWHDQL  605

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC+DTR++L ++  QFE+W+ +YM+R
Sbjct  606  ERLPIELAKTAIKSFAEVISNIVLLQEEEINLRRRCEDTRRDLNRKKAQFEEWHQRYMER  665

Query  396  RTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
            +    +       E  N   V ER+  +E ++ RL+EE   + R   QVR KSL +LR  
Sbjct  666  KASQGEDANSEVAEAVNSDPVAERKTSIEEIEIRLREEMGHHSRIASQVREKSLANLRMH  725

Query  225  LPELFHAMSEFSRACSIMYQTL  160
            LPELF  M++FS  C  MY  L
Sbjct  726  LPELFRNMTDFSGFCHEMYSNL  747



>ref|XP_004955806.1| PREDICTED: uncharacterized protein LOC101763037 [Setaria italica]
Length=735

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 170/263 (65%), Gaps = 3/263 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ ++ MW+ M  HH+ Q +I+  L+S D+  + +ETSE H+ERT QL  +VQE
Sbjct  468  PKLLELVKGLSHMWDIMYAHHKAQLRIITELKSSDIMVAARETSEQHHERTVQLWSIVQE  527

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+QF+K + +QKEY+  L  W+KLN++PID +LK   S P     PPI  LLHAW D++
Sbjct  528  WHAQFDKFMTYQKEYVGSLYSWIKLNVIPIDADLKPNSSQPHE-TTPPIKRLLHAWHDIL  586

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPD  AK AI++F+ VV+TI+  Q DE+KL+ + ++TR++LEK+ RQF+DW  K   R
Sbjct  587  EKLPDNDAKKAIHTFAEVVHTILVQQEDELKLRIKIEETRRDLEKKRRQFDDWAQKNWDR  646

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                 D   + P   +   ER+  ++ ++  LK+ E+ Y  QC  VR KSL  LR+ LPE
Sbjct  647  GASIPDG--NNPGRADPAGERKAVVDRVENALKDLEDQYKTQCKVVRDKSLNLLRSNLPE  704

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF A+S+FS   +  ++ L SI 
Sbjct  705  LFRAVSDFSLQSAGYFKGLWSIA  727



>ref|XP_009398982.1| PREDICTED: uncharacterized protein LOC103983491 [Musa acuminata 
subsp. malaccensis]
Length=729

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 175/267 (66%), Gaps = 5/267 (2%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+LK LV  MA+MWETM+ HH +Q +I+  +R LD+  +P+ETS+ H+ RT QL  +V E
Sbjct  454  PRLKELVNGMAKMWETMRFHHGSQLKIIKEIRGLDIPLAPRETSKQHHNRTVQLWKMVGE  513

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W SQF+K++ +QK+YI+ LN WL LN+VPI+ + ++  SSP    +P I  LLHAW D +
Sbjct  514  WDSQFDKLMSNQKDYIKALNRWLNLNVVPIERSSRKDASSPPEQADPLIKILLHAWHDQL  573

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
              LP + AK+++ +FS  V  I+  Q++E+ LK +  D  ++ E++  +F+ W+HKY +R
Sbjct  574  ENLPVDRAKSSLSTFSGAVQAIMLCQVEELNLKLKWDDAHRDCERKKHEFDVWHHKYTER  633

Query  396  RTPNDDTEQD-----GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
             T     E +     G  + + V E++  ++  + +L+  EE+Y +QC  VR KSLTSL+
Sbjct  634  ITATSSDEVNPETVEGATQQDLVSEKKAVVDNAESKLRVSEESYRKQCKMVRDKSLTSLK  693

Query  231  TGLPELFHAMSEFSRACSIMYQTLESI  151
            T LPELF AM +F+ +C+ MY+ L SI
Sbjct  694  THLPELFRAMLDFASSCAEMYKRLSSI  720



>ref|XP_002461680.1| hypothetical protein SORBIDRAFT_02g006420 [Sorghum bicolor]
 gb|EER98201.1| hypothetical protein SORBIDRAFT_02g006420 [Sorghum bicolor]
Length=761

 Score =   226 bits (575),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 168/263 (64%), Gaps = 2/263 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ ++ MW+ M   H+ Q +I+  L++ D+S S +ETSE H ERT QL  +VQE
Sbjct  493  PKLLELVKGLSHMWDVMYTQHKAQLRIITELKASDISVSTRETSEQHNERTVQLWNIVQE  552

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH QF++ + +QKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++
Sbjct  553  WHVQFDRFMAYQKEYVGSLYSWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRLLHAWHDIL  611

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLP +  K AI++F+ VV+TI+ HQ +E+KL+ + ++TR++ EK+ RQF+DW  K   R
Sbjct  612  EKLPVDATKRAIHTFAEVVHTILVHQDEELKLRMKIEETRRDFEKKRRQFDDWAQKNWDR  671

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                 D +   P  D    ER+  ++ L+  LK+ E++Y  QC  VR KSL  LR+ LPE
Sbjct  672  GASIPDGDNPAPRAD-PAAERKAVVDKLENALKDLEDSYKTQCKVVRDKSLNLLRSNLPE  730

Query  216  LFHAMSEFSRACSIMYQTLESIT  148
            LF  +SEFS   +  ++ L SI 
Sbjct  731  LFRVVSEFSLQSAGYFKGLWSIA  753



>ref|XP_003604444.1| hypothetical protein MTR_4g012430 [Medicago truncatula]
Length=523

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 164/239 (69%), Gaps = 12/239 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW TM  HH+ Q  I+  L+SLD SQ P ETSEHH++RTYQL  V+QE
Sbjct  292  PKLVQLVDGMAKMWRTMHSHHKKQLSIMKLLKSLD-SQFPTETSEHHHDRTYQLLNVMQE  350

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
              SQFEK+I +QK +I+ L  WLKLNL  I+++  +K+SSP      P+  LLHAW D +
Sbjct  351  LESQFEKLIKNQKGFIKALYSWLKLNLTLIESDTTKKISSP------PLQILLHAWNDHL  404

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE A+ A+  F+AVV+++ QHQ  E+ LK +C++ RKE  +++R+F+ W  KY ++
Sbjct  405  EKLPDEHARIALSHFAAVVDSLYQHQEQELVLKRKCEEIRKEYTRKSRRFDQWECKYKKK  464

Query  396  RTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
            +  ++  +  G  + N+     +E+++ +E L++RL EE++A+ +QC+ VR KSL+ L+
Sbjct  465  KGLDEFDQNRGEDDINDPPEVAMEKRVLVE-LEKRLDEEKDAFEKQCLHVRQKSLSCLK  522



>ref|XP_010479739.1| PREDICTED: uncharacterized protein LOC104758551, partial [Camelina 
sativa]
Length=687

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  933  KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW  754
            KL  LV++M +MWE M  HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct  522  KLLHLVDAMGKMWEMMHLHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEW  581

Query  753  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG  574
            H+QF +M+ HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LL  W D + 
Sbjct  582  HTQFCRMVDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLTVWYDRLD  641

Query  573  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKR  439
            K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++
Sbjct  642  KIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRK  686



>gb|ABR18011.1| unknown [Picea sitchensis]
Length=724

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 161/278 (58%), Gaps = 16/278 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P L  LVE M +MW++M   H  Q +IV  LR  D S +P ET++ H++RTYQL  V  E
Sbjct  438  PNLVELVEGMEKMWKSMYDCHRRQEEIVKDLR-FDNSNAPDETTKQHHDRTYQLYNVANE  496

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH+Q EK+ IHQK+YI  LN+WL+LNL+PI++NLKEKVSSP +   PPI  LL  W   +
Sbjct  497  WHAQSEKLFIHQKQYIGALNNWLRLNLIPIESNLKEKVSSPPKAFVPPIHELLQVWHSTL  556

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY------  415
             +LP  +A   + SF+A++N I   Q +E+K K   +D + ELE++ + F +W       
Sbjct  557  DQLPYAVALQGLKSFAAIINRIFTQQQEELKKKKNYEDAQAELERKRKAFNEWALRNPPE  616

Query  414  ----HKYMQRRTPNDDTEQDGP--HEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQ  262
                 +    +T N  +E++     E NN    +ER+  L  L++R+ EE   +   C  
Sbjct  617  NKGSEESAGGQTENRSSEENAGVQTEINNKDPSMERRHALILLEKRVHEEGVKHKNSCKL  676

Query  261  VRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  148
             R  SL SL TGLP LF A+   SR C   Y+ L +IT
Sbjct  677  TRDLSLKSLETGLPALFQALVGLSRNCFETYKELHTIT  714



>gb|AES86641.2| BZIP protein [Medicago truncatula]
Length=512

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 156/228 (68%), Gaps = 12/228 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL  LV+ MA+MW TM  HH+ Q  I+  L+SLD SQ P ETSEHH++RTYQL  V+QE
Sbjct  292  PKLVQLVDGMAKMWRTMHSHHKKQLSIMKLLKSLD-SQFPTETSEHHHDRTYQLLNVMQE  350

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
              SQFEK+I +QK +I+ L  WLKLNL  I+++  +K+SSP      P+  LLHAW D +
Sbjct  351  LESQFEKLIKNQKGFIKALYSWLKLNLTLIESDTTKKISSP------PLQILLHAWNDHL  404

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             KLPDE A+ A+  F+AVV+++ QHQ  E+ LK +C++ RKE  +++R+F+ W  KY ++
Sbjct  405  EKLPDEHARIALSHFAAVVDSLYQHQEQELVLKRKCEEIRKEYTRKSRRFDQWECKYKKK  464

Query  396  RTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCM  265
            +  ++  +  G  + N+     +E+++ +E L++RL EE++A+ +QC+
Sbjct  465  KGLDEFDQNRGEDDINDPPEVAMEKRVLVE-LEKRLDEEKDAFEKQCL  511



>ref|XP_008352156.1| PREDICTED: uncharacterized protein LOC103415623 [Malus domestica]
Length=414

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            PKL SL + MA+MWE M  HH +Q +IV  L+SLD+  +P ET++HH++RT QL  V+QE
Sbjct  209  PKLVSLADGMAKMWENMCTHHGSQLKIVTDLKSLDIXHTPMETTKHHHDRTVQLWNVLQE  268

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  FEK+  HQK+YI+ LN WLKLNL+PI+++LK+K+SSP R Q PPI ALLH+W D +
Sbjct  269  WHXHFEKLXXHQKQYIQALNSWLKLNLIPIESSLKZKISSPPRVQRPPIQALLHSWHDSL  328

Query  576  GKLPDELAKTAIYSFSAVVNTIV  508
             KL DELAK AI SF+AV+ TI+
Sbjct  329  EKLSDELAKCAISSFAAVIKTII  351


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  288  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSI  175
            +A+ R C+QVR KSL SL+T LPE+F  M++++ ACSI
Sbjct  361  KAHQRHCIQVRDKSLGSLKTRLPEIFRTMTDYANACSI  398



>ref|XP_009786427.1| PREDICTED: uncharacterized protein LOC104234548 isoform X2 [Nicotiana 
sylvestris]
Length=631

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -1

Query  516  TIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE  337
            T+  +  +EMKLKDRC+DTR+EL K+TRQ+EDWYHKYMQRRTP D+ + D  HED+ V++
Sbjct  500  TMRGYHKEEMKLKDRCEDTRRELNKKTRQYEDWYHKYMQRRTPPDEMDPDQAHEDSLVVD  559

Query  336  RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  157
            RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMS+FS AC+ MY+ L 
Sbjct  560  RQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFEAMSDFSLACADMYRDLR  619

Query  156  SITHPLNR  133
            SI    NR
Sbjct  620  SIAKHRNR  627



>ref|XP_009628246.1| PREDICTED: uncharacterized protein LOC104118644 isoform X2 [Nicotiana 
tomentosiformis]
Length=614

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -1

Query  516  TIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE  337
            T+  +  +EMKLKDRC+DTR+EL K+TRQ+EDWY ++MQRRTP D+ + D  H D+ V++
Sbjct  483  TMRGYHKEEMKLKDRCEDTRRELNKKTRQYEDWYQRHMQRRTPPDEMDPDQAHVDSLVVD  542

Query  336  RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  157
            RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMSEFS AC+ MY+ L 
Sbjct  543  RQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFGAMSEFSLACADMYRDLR  602

Query  156  SITHPLNR  133
            SI+   NR
Sbjct  603  SISKHRNR  610



>ref|XP_009391172.1| PREDICTED: ras and EF-hand domain-containing protein homolog 
[Musa acuminata subsp. malaccensis]
Length=861

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 141/269 (52%), Gaps = 10/269 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L+  +  MW +M   H+ Q  IV  L+ L+ + +   TS  H +   QL + V+ 
Sbjct  386  PQLLELLTGLMSMWRSMYECHQVQTHIVQQLKYLNCALNSHPTSNIHRQAALQLELEVEN  445

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+S F  ++  Q+EY+  L  WL+L+L     +     S  Q  QNP I +L   WQ  +
Sbjct  446  WYSAFCSLVNSQREYVHALTGWLRLSLFQCHHD-----SLAQSRQNPEIYSLCEEWQLAL  500

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF +V++ +V  Q +E K K R +   +ELEKR  +      K+   
Sbjct  501  DRIPDKVASEGIKSFLSVIHAVVMQQAEEQKQKKRSEVAFRELEKRAEELRSLESKF---  557

Query  396  RTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
              P   TE  G     + V+E++ ++EALK + +EE+  Y +     R  +L +L+TG P
Sbjct  558  -GPYSTTEGHGGMAQRSPVLEKRAKVEALKAKAEEEKSKYEKSVGVTRAMTLNNLQTGFP  616

Query  219  ELFHAMSEFSRACSIMYQTLESITHPLNR  133
             +F AM+ F+  C  +++++ +    L+R
Sbjct  617  NVFQAMTGFAGVCMQVFESVYNHQRSLDR  645



>ref|XP_010941314.1| PREDICTED: uncharacterized protein LOC105059637 [Elaeis guineensis]
Length=640

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 134/262 (51%), Gaps = 10/262 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV  +  MW +M   H+ Q  IV  L  L+ + S   T++ H + + QL V V  
Sbjct  371  PQLLELVTGLMGMWRSMYECHQVQTHIVQQLEYLNNATSTNPTTDTHRQASLQLEVEVNH  430

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+S F  ++  Q+EYI  L  WL+L+L   D N+  K     +  +  I +L   WQ  +
Sbjct  431  WYSSFCSLVNSQREYIYALTGWLRLSLFQCDHNMLGK----SQQSSDMIYSLCEEWQLAL  486

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  V++ +V  Q +E K K + +   KELEKR  +      KY   
Sbjct  487  DRIPDKVASEGIKSFITVIHAVVVQQAEEQKQKRKSELAFKELEKRAEELRSLESKYGPY  546

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                   E  G +    V+E++ ++EALK + +EE+  Y +     R  +L +L+TGLP 
Sbjct  547  SVAEGYGEMAGRYP---VLEKRAKVEALKTKAEEEKSRYEKSIAVTRAMTLNNLQTGLPN  603

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM+ F+  C    Q  ES+
Sbjct  604  VFQAMTGFASVC---MQAFESV  622



>gb|KHN00204.1| hypothetical protein glysoja_034735 [Glycine soja]
Length=422

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 149/271 (55%), Gaps = 19/271 (7%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVV  763
            P+L  L   +  MW++M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V
Sbjct  154  PQLVELCHGILYMWKSMHQYHEIQSNIVQQVRGL-VNQSSKGHSTSESHKQATRDLESAV  212

Query  762  QEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD  583
              WHS F ++I  Q+++I  L+ WLKLNL+P++ +     +S   P    + +    W+ 
Sbjct  213  SAWHSSFCRLIKFQRDFILSLHGWLKLNLIPVNND----NNSSSEPSG--VFSFCDEWKL  266

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WY  415
             + ++PD +A  AI SF  VV+ I   Q +E+K+K R +++ KELEK++         +Y
Sbjct  267  ALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKRRTENSSKELEKKSSSLRSIERKFY  326

Query  414  HKY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
              Y M   TP +    +G   D  + + E++++L A ++R+++E   + +     R  +L
Sbjct  327  SSYSMVGITPPESGPGNGQGLDARDPLAEKKMELAAHQRRVEDEMVRHSKAVEVTRAMTL  386

Query  243  TSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
             +L+TGLP +F A++ FS   ++  + LES+
Sbjct  387  NNLQTGLPGVFQALTSFS---TLFTEALESV  414



>ref|XP_007134473.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
 gb|ESW06467.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
Length=810

 Score =   136 bits (343),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 151/272 (56%), Gaps = 16/272 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVV  763
            P+L  L   +  MW++M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V
Sbjct  537  PQLLDLCREIMYMWKSMHQYHEIQSNIVQQVRGL-VNQSSKGHSTSESHKQATRDLESAV  595

Query  762  QEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSPQRPQNPPILALLHAWQ  586
              WHS F ++I  Q+++I  L+ WLKLNL+P++  N+K   ++     +  + +    W+
Sbjct  596  SAWHSSFCRLIKFQRDFILSLHGWLKLNLIPVNKDNIKSTSNNNSESSH--VFSFCDEWK  653

Query  585  DLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----W  418
              + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK++         +
Sbjct  654  LALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKKRTESASKELEKKSSSLRSIERKF  713

Query  417  YHKY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKS  247
            Y+ Y M   TP +    +G   D  + + E++L+LE+ ++R+++E   + +     R  +
Sbjct  714  YNSYSMVGITPPESGPGNGQGLDARDPLAEKKLELESYQRRVEDEIVRHSKAVEVTRAMT  773

Query  246  LTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            L +L+TGLP +F AMS FS   S+  + LES+
Sbjct  774  LNNLQTGLPGVFQAMSSFS---SLFTEALESV  802



>ref|XP_011093240.1| PREDICTED: uncharacterized protein LOC105173250 [Sesamum indicum]
Length=844

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/270 (31%), Positives = 142/270 (53%), Gaps = 16/270 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW +M   HE Q  IV  +R L +     + TS+ H + T  L   V 
Sbjct  575  PQLVELCHGFMYMWRSMNQSHEVQNDIVQQVRGLVNRMTKGQSTSDLHRQATRDLESAVS  634

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F +MI  Q+++IR L+ W KL L+PI++   E  +S + P    + A    W+  
Sbjct  635  AWHSSFCRMIKFQRDFIRSLHGWFKLTLLPINS---EPTNSDREPSK--VFAFFDEWKLA  689

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF+ VV++I   Q +E+K+K R +   KELEK++    +    +YH
Sbjct  690  VDRIPDTVASEAIKSFNNVVHSISLKQTEELKIKKRTESASKELEKKSSSLRNIEKKYYH  749

Query  411  KYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y        D   D  H     + + E++ +L   ++R+++E   +++     R  +L 
Sbjct  750  SYSMVGIGLPDNGPDNGHVLDARDPLAEKKAELAICQRRVEDEMVKHLKAVEVTRAMTLN  809

Query  240  SLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            +++TGLP +F AM+ FS   +++ + LE++
Sbjct  810  NIQTGLPGVFQAMTSFS---ALITEALETV  836



>ref|XP_011099873.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105178172 
[Sesamum indicum]
Length=623

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 132/259 (51%), Gaps = 9/259 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S   TSE H + T QL +  Q+
Sbjct  356  PQLLQLVKGLMSMWRSMYEFHQVQTHIVQQLKYLNCIPSTDPTSEIHRQSTLQLELEAQQ  415

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L  +  N   K       Q+  I +    WQ  I
Sbjct  416  WHLSFCNLMKAQRDYIQSLTGWLRLSLFQVGNNPISKTK-----QDSAIYSFCEEWQLTI  470

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
               PD++A   I SF ++++ IV  Q +E K K R +   KELEK+  +      K+   
Sbjct  471  NNAPDKVASEGIKSFLSMIHAIVVQQAEEQKQKRRSESVFKELEKKAGELRSLESKHGPY  530

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P    E  G    + V E++ ++EAL+ R ++E+  Y +     R  ++ +L+ GLP 
Sbjct  531  SMP----EASGETNKDPVREKRAKVEALRARAEDEKAKYEKSISVTRAMTMNNLQMGLPH  586

Query  216  LFHAMSEFSRACSIMYQTL  160
            +F AM+ F+  C+  + ++
Sbjct  587  VFQAMTGFANVCTQAFDSV  605



>ref|XP_010113322.1| hypothetical protein L484_026653 [Morus notabilis]
 gb|EXC35329.1| hypothetical protein L484_026653 [Morus notabilis]
Length=658

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 140/270 (52%), Gaps = 9/270 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L++  S + TSE H + T QL + VQ+
Sbjct  391  PQLLELVKGLMCMWRSMYECHQVQKHIVQQLKYLNVIPSTEPTSEIHRQTTLQLELEVQQ  450

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  M+  Q++YI+ L  WL+L+L   + N   + S     Q   I +L   W   +
Sbjct  451  WHLSFCNMVKAQQDYIQSLTGWLRLSLFQFNRNPLARTS-----QESKIYSLCEEWHLAV  505

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  V++ IV  Q +E K K + +   K+LEK+  +      KY   
Sbjct  506  DRIPDKVASEGIKSFLTVIHAIVVQQAEEQKQKKKSESVFKDLEKKMLELRSLESKY---  562

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P   +E  G    N V E++ ++E LK + +EE+  + +     R  +L +L+ GLP 
Sbjct  563  -GPYSMSESSGITGRNPVAEKRAKVEMLKAKAEEEKTKHEKSVSVTRAMTLNNLQMGLPH  621

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNRES  127
            +F  M  FS  C   ++++ + T   ++E+
Sbjct  622  VFEGMVGFSSVCMHAFESVYNHTKSADQEA  651



>ref|XP_010935104.1| PREDICTED: uncharacterized protein LOC105055091 [Elaeis guineensis]
Length=565

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 86/263 (33%), Positives = 134/263 (51%), Gaps = 13/263 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV  +  MW +M   H+ Q  IV  L  L+ + S   T+  H + + QL + V  
Sbjct  297  PQLLELVTGLMGMWRSMYECHQVQTHIVQQLDYLNNASSNNPTTNIHRQASLQLELEVDH  356

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+S F  ++  Q+EYI  L  WL+L+L   D NL       +  Q+  I +L   WQ  +
Sbjct  357  WYSAFCNLVKSQREYIHALTGWLRLSLFQCDHNLL-----GETQQSSDIYSLCEEWQLAL  411

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  V++ +V  Q +E K K + +   KELEKR  +      KY   
Sbjct  412  DRIPDKVASEGIKSFLTVIHAVVLQQAEEQKQKRKSEMVFKELEKRAEELRALESKY---  468

Query  396  RTPNDDTEQDGPH-EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
              P   TE  G     + V+E++ ++EALK + +EE+  Y +     R  +L +L+TG P
Sbjct  469  -GPYCVTEGYGVMVRASPVMEKRAKVEALKMKAEEEKSKYEKSVAVTRAMTLNNLQTGFP  527

Query  219  ELFHAMSEFSRACSIMYQTLESI  151
             +F AM+ F+  C    Q  ES+
Sbjct  528  NVFQAMTGFAGVC---MQAFESV  547



>gb|ABK95129.1| unknown [Populus trichocarpa]
Length=126

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = -1

Query  489  MKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNN--VIERQLQLEA  316
            MKLK++C++TR+E  ++ + FE+WY KYMQRRTP D+T+ D   + N   V ERQ  +E+
Sbjct  1    MKLKEKCEETRREFMRKNQAFEEWYQKYMQRRTPTDETDADRGEDANPNPVSERQFVVES  60

Query  315  LKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  148
            LK+RL+EE EA+ + C+QVR KS+ SL+  LPELF AMS+++ ACS  Y+ L SIT
Sbjct  61   LKKRLEEEIEAHGKHCLQVREKSVGSLKIRLPELFRAMSDYAHACSDAYEKLRSIT  116



>ref|XP_006576720.1| PREDICTED: uncharacterized protein LOC100792843 [Glycine max]
Length=799

 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/270 (32%), Positives = 145/270 (54%), Gaps = 17/270 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW++M  +HE Q  IV  +R L + S     TSE H + T  L   V 
Sbjct  531  PQLVELCHGILYMWKSMHQYHEIQSNIVQQVRGLVNQSSEGHSTSESHKQATRDLESAVS  590

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+++I  L+ WLKLNL+P++ N     S P       +L+    W+  
Sbjct  591  AWHSSFCRLIKFQRDFILSLHGWLKLNLIPVN-NDNNSSSEPSG-----VLSFCDEWKLA  644

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +++ KE EK++         +Y 
Sbjct  645  LDRVPDTVASEAIKSFINVVHVISVKQSEELKIKRRTENSSKEFEKKSSSLRSIERKFYS  704

Query  411  KY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y M   TP +    +G   D  + + E++++L A ++R+++E   + +     R  +L 
Sbjct  705  SYSMVGITPPESGPGNGQGLDARDPLAEKKMELAAHQRRVEDEMVRHSKAVEVTRAMTLN  764

Query  240  SLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            +L+TGLP +F A++ FS   ++  + LES+
Sbjct  765  NLQTGLPGVFQALTSFS---TLFTEALESV  791



>ref|XP_007204230.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica]
 gb|EMJ05429.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica]
Length=647

 Score =   132 bits (331),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 85/269 (32%), Positives = 135/269 (50%), Gaps = 9/269 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct  380  PQLIELVKGLMCMWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQATLQLELQVQQ  439

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q +YI+ L  WL+L+L     +   K S   R     I  L   W   +
Sbjct  440  WHQSFCNLVKAQLDYIQSLTGWLRLSLFQFRRHPISKTSQESR-----IYMLCEEWHHAV  494

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  VV+ IV  Q +E K K + + T KELEK+         KY   
Sbjct  495  DRIPDKVASEGIKSFLTVVHAIVVQQAEEYKQKKKSESTFKELEKKATVLRSLESKYGPY  554

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P+  +        N V+E++ ++E L+ + +EE+  + +     RV +L +L+ G P 
Sbjct  555  SMPDSASTST----KNPVVEKRAKVEVLRAKAEEEKSKHEKSVSVTRVMTLNNLQMGFPH  610

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNRE  130
            +F AM  FS  C   +++L +     N+E
Sbjct  611  VFEAMVGFSSVCMQAFESLYNQAKSANQE  639



>ref|XP_007139641.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
 gb|ESW11635.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
Length=818

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/269 (32%), Positives = 140/269 (52%), Gaps = 15/269 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L +L+     MW+ M  +HE Q  +V  +R L + S     TSE H + T  L   V 
Sbjct  550  PQLVALIHGFMYMWKAMHNYHEIQSNVVQQVRGLVNRSSRGDSTSELHRQATRDLEAAVS  609

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+E+I  L+ W KL+L+PI+    + +++ +   N         W+  
Sbjct  610  AWHSSFCRLIKFQREFIFSLHGWFKLSLLPIN---NDNINNSR--DNSDTYHFFDEWKLA  664

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R + T KELEK+     +    +Y 
Sbjct  665  LDRVPDTVASEAIKSFINVVHVISAKQTEELKIKKRTETTSKELEKKASSLRNLERKYYS  724

Query  411  KYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTS  238
             Y        DT  DG   D  + + E++L L   ++R+++E   + +     R  +L +
Sbjct  725  SYSMVGISLPDTAPDGQGLDARDPLAEKKLDLATCQRRVEDEMLRHSKAVELTRAMTLNN  784

Query  237  LRTGLPELFHAMSEFSRACSIMYQTLESI  151
            L+TGLP +F A++ FS   S+  + LES+
Sbjct  785  LQTGLPGVFQALTSFS---SLFTEALESV  810



>ref|XP_004492935.1| PREDICTED: uncharacterized protein LOC101510124 [Cicer arietinum]
Length=859

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 138/274 (50%), Gaps = 18/274 (7%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   M  MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V 
Sbjct  589  PQLVELCHGMMYMWRSMHQYHEVQSNIVQQVRGLVNRSSGSDSTSELHRQATRDLESAVS  648

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSPQRPQNPPILALLHAWQD  583
             WHS F ++I  Q+++I  L+ W KL+L+P+D  N+      P              W+ 
Sbjct  649  AWHSSFCRLIKFQRDFILSLHGWFKLSLIPVDNDNINNHSREPS-----DAYVFFDDWKL  703

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WY  415
             + ++PD +A  AI SF  VV+ I   Q DE+K+K R ++  KELEK+     +    +Y
Sbjct  704  ALDRVPDTVASEAIKSFINVVHVISCKQADELKIKKRTENASKELEKKASSVRNIERKFY  763

Query  414  HKYMQRRTPNDDTEQD---GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
              Y        DT  D   G    + + E++L+L   ++R+++E   + +     R  +L
Sbjct  764  SSYSLVGIGLPDTAPDNGQGLDARDPLAEKKLELATCQRRVEDEMLRHSKAVEATRAMTL  823

Query  243  TSLRTGLPELFHAMSEFSRACSIMYQTLESI-TH  145
             +L+TGLP +F A++ FS   S+  + LES+ TH
Sbjct  824  NNLQTGLPGVFQALTSFS---SLFAEALESVCTH  854



>ref|XP_006425413.1| hypothetical protein CICLE_v10025182mg [Citrus clementina]
 gb|ESR38653.1| hypothetical protein CICLE_v10025182mg [Citrus clementina]
Length=615

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 135/265 (51%), Gaps = 21/265 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ M  MW +M   H+ Q  IV  L+ +++  S + TSE H + T QL + VQ+
Sbjct  351  PQLLDLVKGMMCMWRSMYESHQVQTHIVQQLKYINIMPSSEPTSEIHRQATLQLELQVQQ  410

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W   F  ++  Q++Y++ L  WL+L+L    T+   + +     Q   I +L   WQ  +
Sbjct  411  WLQSFSSLVKAQQDYVQSLTGWLRLSLFQFSTSPLSRTT-----QESGIYSLCEEWQQAV  465

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKY  406
             ++PD++A   I SF AVV+ IV  Q DE K K + + + KE EK+    R  E  Y  +
Sbjct  466  ERIPDKVASEGIKSFLAVVHAIVVQQSDEHKQKKKAESSFKEYEKKAAELRSLESKYGPF  525

Query  405  MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
              R +   D           V E+++++E L+ + +EE+  + +     R  +L +L+ G
Sbjct  526  SMRESFGKDP----------VGEKRVKVEMLRTKAEEEKTKHEKSVSVTRAMTLNNLQMG  575

Query  225  LPELFHAMSEFSRACSIMYQTLESI  151
             P +F AM  FS  C    Q  ES+
Sbjct  576  FPHVFQAMVGFSSVC---MQAFESV  597



>ref|XP_006466986.1| PREDICTED: uncharacterized protein LOC102630487 [Citrus sinensis]
Length=615

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 135/265 (51%), Gaps = 21/265 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ M  MW +M   H+ Q  IV  L+ +++  S + TSE H + T QL + VQ+
Sbjct  351  PQLLDLVKGMMCMWRSMYESHQVQTHIVQQLKYINIMPSSEPTSEIHRQATLQLELQVQQ  410

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W   F  ++  Q++Y++ L  WL+L+L    T+   + +     Q   I +L   WQ  +
Sbjct  411  WLQSFSSLVKAQQDYVQSLTGWLRLSLFQFSTSPLSRTT-----QESGIYSLCEEWQQAV  465

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKY  406
             ++PD++A   I SF AVV+ IV  Q DE K K + + + KE EK+    R  E  Y  +
Sbjct  466  ERIPDKVASEGIKSFLAVVHAIVVQQSDEHKQKKKAESSFKEYEKKAAELRSLESKYGPF  525

Query  405  MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
              R +   D           V E+++++E L+ + +EE+  + +     R  +L +L+ G
Sbjct  526  SMRESFGKDP----------VGEKRVKVEMLRTKAEEEKTKHEKSVSVTRAMTLNNLQMG  575

Query  225  LPELFHAMSEFSRACSIMYQTLESI  151
             P +F AM  FS  C    Q  ES+
Sbjct  576  FPHVFQAMVGFSSVC---MQAFESV  597



>gb|EYU30808.1| hypothetical protein MIMGU_mgv1a0195871mg, partial [Erythranthe 
guttata]
Length=266

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 130/253 (51%), Gaps = 11/253 (4%)
 Frame = -1

Query  900  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  721
            MW +M   H+ Q  IV  L+ L+   S   TSE H + T QL +  Q+WH  F  +I  Q
Sbjct  4    MWRSMYEFHQVQTHIVQQLKYLNFFPSTDPTSEIHRQATLQLELEAQQWHLSFCTLIKSQ  63

Query  720  KEYIRGLNDWLKLNL---VPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  550
            ++YI+ L  WL+L+L     ++TN    V+  +  Q+  I +    WQ  I   PD++A 
Sbjct  64   RDYIQSLTGWLRLSLFQVASVNTN-HNPVNIRKTKQDSAIYSFCEEWQLAINNSPDKVAS  122

Query  549  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  370
              I SF  V++ IV  Q +E K K R     K+L+K+  +     +K+     P    E 
Sbjct  123  EGIKSFLTVIHAIVMQQAEEQKQKRRADSVFKDLDKKAGELRSLENKHGPYFVP----EG  178

Query  369  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  190
             G  + + V +++ ++EAL+ + ++E+  Y +     R  ++ +L+ GLP +F AM+ F+
Sbjct  179  SGETKKDPVRDKRAKVEALRAKAEDEKAKYEKAVSVTRAMTMNNLQMGLPHVFQAMTGFA  238

Query  189  RACSIMYQTLESI  151
              C+   Q  ES+
Sbjct  239  NVCA---QAFESV  248



>ref|XP_004166130.1| PREDICTED: uncharacterized LOC101224117, partial [Cucumis sativus]
Length=260

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 139/265 (52%), Gaps = 26/265 (10%)
 Frame = -1

Query  900  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  724
            MW +M  +H+ Q  IV  +R L + +     TSE H + T  L  +V  WHS F ++I  
Sbjct  4    MWRSMHQYHDIQNNIVQQVRGLVNQTSHGDSTSELHRQATRDLESMVTAWHSSFCRLIKF  63

Query  723  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  544
             +++IR L+ WLKL+ +P++ +              P    L  W+  + ++PD +A  A
Sbjct  64   HRDFIRSLHGWLKLSYIPVNND-------SLTDNKEPAEIFLDQWKLALDRVPDTVASVA  116

Query  543  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF----EDWYHKYMQRRTPNDDT  376
            I SF  VVN I   Q +E+K+K R +   KE EK++       + +Y+ Y        DT
Sbjct  117  IKSFINVVNVISAKQTEEIKIKKRTESASKEFEKKSASIMHLEKKFYNSYSMVGIGLPDT  176

Query  375  EQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
               GP ++ +++       E++++L A ++R++EE+  + +     R  +L +L+TGLP 
Sbjct  177  ---GPADNGHILDARDPLAEKKIELVACQRRVEEEKIKHSKAVEVTRAMTLNNLQTGLPG  233

Query  216  LFHAMSEFSRACSIMYQTLESI-TH  145
            +F A++ FS   ++  + LES+ TH
Sbjct  234  VFQALTSFS---ALFTEALESVCTH  255



>ref|NP_171713.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD95352.1| bZIP-like protein [Arabidopsis thaliana]
 gb|AEE27385.1| uncharacterized protein AT1G02110 [Arabidopsis thaliana]
Length=703

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/273 (32%), Positives = 143/273 (52%), Gaps = 17/273 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V 
Sbjct  442  PQLVELCHGLMYMWKSMHEYHEIQNNIVQQVRGLINQTERGESTSEVHRQVTRDLESAVS  501

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+E+I  L+ W KL+LVP+     +K       Q P   AL   W+  
Sbjct  502  LWHSSFCRIIKFQREFICSLHAWFKLSLVPLSNGDPKK-------QRPDSFALCEEWKQS  554

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q
Sbjct  555  LERVPDTVASEAIKSFVNVVHVISIKQAEEVKMKKRTESAGKELEKKASSLRSIERKYYQ  614

Query  399  RRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL  235
              +    T   GP  +     + + E++ +L A ++++++E   +++     R  +L +L
Sbjct  615  AYS----TVGIGPGPEVLDSRDPLSEKKCELAACQRQVEDEVMRHVKAVEVTRAMTLNNL  670

Query  234  RTGLPELFHAMSEFSRACSIMYQTLESITHPLN  136
            +TGLP +F A++ FS   +   QT+ S ++ +N
Sbjct  671  QTGLPNVFQALTSFSSLFTESLQTVCSRSYSIN  703



>ref|XP_008459782.1| PREDICTED: uncharacterized protein LOC103498813 [Cucumis melo]
Length=813

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 144/275 (52%), Gaps = 27/275 (10%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW +M  +H+ Q  IV  +R L + +     TSE H + T  L  +V 
Sbjct  545  PQLVELCHGLMYMWRSMHQYHDIQNNIVQQVRGLVNQTSHGDSTSELHRQATRDLESMVT  604

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNP-PILALLHAWQD  583
             WHS F ++I   +++IR L+ WLKL+ +P++ +          P N  P    L  W+ 
Sbjct  605  AWHSSFCRLIKFHRDFIRSLHGWLKLSYIPVNND--------GLPDNKEPAEIFLDQWKL  656

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF----EDWY  415
             + ++PD +A  AI SF  VVN I   Q +E+K+K R +   KE EK++       + +Y
Sbjct  657  ALDRVPDTVASVAIKSFINVVNVISAKQTEEIKIKKRTESASKEFEKKSASIMNLEKKFY  716

Query  414  HKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVR  256
            + Y        DT   GP ++ +++       E++++L A ++R++EE+  + +     R
Sbjct  717  NSYSMVGIGLPDT---GPADNGHILDARDPLAEKKIELVACQRRVEEEKIKHSKAVEVTR  773

Query  255  VKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
              +L +L+TGLP +F A++ FS   ++  + LES+
Sbjct  774  AMTLNNLQTGLPGVFQALTSFS---ALFTEALESV  805



>ref|XP_006464424.1| PREDICTED: uncharacterized protein LOC102627291 [Citrus sinensis]
Length=769

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 131/257 (51%), Gaps = 13/257 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW+ M  +HE Q  IV  +R L + +   + TS+ H + T  L   + 
Sbjct  500  PRLVDLCHGFMYMWKAMHQYHEVQNNIVQQVRGLVNQAAKGESTSDMHRQATRNLESAIT  559

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q++++R L+ W KL L+P+     + +S  + P    +      W+  
Sbjct  560  AWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVSN---DNMSGKREPSE--VYGFFDEWKLA  614

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH
Sbjct  615  LERVPDTVASEAIKSFINVVHVISVKQTEELKIKKRTETASKELEKKASSLRNIERKFYH  674

Query  411  KYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y        D   D  H     + + E++L+L A ++R+++E   + R     R  +L 
Sbjct  675  SYSMVGIGLPDPGPDNGHVLDARDPLAEKKLELAACQRRVEDELLRHSRAVEVTRANTLN  734

Query  240  SLRTGLPELFHAMSEFS  190
            +L+TGLP +F A++ FS
Sbjct  735  NLQTGLPGVFQALTSFS  751



>gb|KDO85511.1| hypothetical protein CISIN_1g040600mg [Citrus sinensis]
Length=754

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 131/257 (51%), Gaps = 13/257 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW+ M  +HE Q  IV  +R L + +   + TS+ H + T  L   + 
Sbjct  485  PRLVDLCHGFMYMWKAMHQYHEVQNNIVQQVRGLVNQAAKGESTSDMHRQATRNLESAIT  544

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q++++R L+ W KL L+P+     + +S  + P    +      W+  
Sbjct  545  AWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVSN---DNMSGKREPSE--VYGFFDEWKLA  599

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH
Sbjct  600  LERVPDTVASEAIKSFINVVHVISVKQTEELKIKKRTETASKELEKKASSLRNIERKFYH  659

Query  411  KYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y        D   D  H     + + E++L+L A ++R+++E   + R     R  +L 
Sbjct  660  SYSMVGIGLPDPGPDNGHVLDARDPLAEKKLELAACQRRVEDELLRHSRAVEVTRANTLN  719

Query  240  SLRTGLPELFHAMSEFS  190
            +L+TGLP +F A++ FS
Sbjct  720  NLQTGLPGVFQALTSFS  736



>ref|NP_001190052.1| protein ALTERED PHOSPHATE STARVATION RESPONSE 1 [Arabidopsis 
thaliana]
 gb|AEE78775.1| uncharacterized protein AT3G51290 [Arabidopsis thaliana]
Length=798

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/262 (32%), Positives = 129/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct  375  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEVQQ  434

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  435  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAI  489

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct  490  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTESMLKDFEKKSASLRALESKYSPY  549

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  550  SVPES-------RKKNPVIEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  602

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  603  VFQAMVGFSSVC---MQAFESV  621



>ref|XP_010426683.1| PREDICTED: uncharacterized protein LOC104711671 isoform X2 [Camelina 
sativa]
Length=643

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  378  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  437

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   K S   +     I +    W   I
Sbjct  438  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVKSSYESK-----IYSFCEEWHLAI  492

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct  493  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPY  552

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N V+E+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  553  SVPES-------RKTNPVVEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  605

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  606  VFQAMVGFSSVC---MQAFESV  624



>ref|XP_010426682.1| PREDICTED: uncharacterized protein LOC104711671 isoform X1 [Camelina 
sativa]
Length=668

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  403  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  462

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   K S   +     I +    W   I
Sbjct  463  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVKSSYESK-----IYSFCEEWHLAI  517

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct  518  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPY  577

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N V+E+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  578  SVPES-------RKTNPVVEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  630

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  631  VFQAMVGFSSVC---MQAFESV  649



>ref|XP_010679893.1| PREDICTED: uncharacterized protein LOC104895159 [Beta vulgaris 
subsp. vulgaris]
Length=673

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 140/271 (52%), Gaps = 12/271 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  +V+    MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL V +Q+
Sbjct  404  PQLLDIVKGCMCMWRSMYECHQVQMHIVDQLKFLNTIPSTEPTSEIHRQSTLQLEVELQQ  463

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP--QRPQNPPILALLHAWQD  583
            WH  F  ++  Q++YIR L  WL+L+L   + N       P  +  Q+  I +L   WQ 
Sbjct  464  WHQSFCNLVKAQRDYIRSLTGWLRLSLFQFNKN-------PLMRSMQDSTIYSLCEQWQL  516

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM  403
             I  +PD++A   I S   V++ IV  Q +E+K K R +   K+LEKR  +      KY 
Sbjct  517  EIDNVPDKVASEGIKSLWTVIHAIVVQQAEELKQKKRSEVANKQLEKRAVELRSLEVKYG  576

Query  402  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
                P   + + G    + V E++ +++ LK + +EE+  + +     R  +L +++ GL
Sbjct  577  PYSKPEISSSRKG---GDPVGEKRAKVDMLKVKAEEEKAKHEKSVSATRAMTLNNMQMGL  633

Query  222  PELFHAMSEFSRACSIMYQTLESITHPLNRE  130
            P +F AM+ FS  C   ++ + + T  +++E
Sbjct  634  PHVFQAMTGFSSVCKQAFEKVYNETKNMDQE  664



>gb|KEH23438.1| BZIP transcription factor bZIP80 [Medicago truncatula]
Length=843

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/269 (30%), Positives = 137/269 (51%), Gaps = 16/269 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L   M  MW +M  +HE Q  IV  +R L      + TSE H + T  L   V  
Sbjct  576  PQLVELCHGMMYMWRSMHQYHEVQSNIVQQVRGLVNRSGGESTSELHRQATRDLESAVSA  635

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS F ++I  Q+++I  L+ W KL+L+P+D +      +  R ++         W+  +
Sbjct  636  WHSSFCRLIKFQRDFILSLHGWFKLSLMPVDND------NVNRMEHSDAYMFFDDWKLAL  689

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHK  409
             ++PD +A  AI SF  VV+ I   Q +E+K+K R ++  KELE++     +    +Y  
Sbjct  690  DRVPDTVASEAIKSFINVVHVISSKQAEELKIKKRTENASKELERKASSVRNLERKFYSS  749

Query  408  YMQRRTPNDDTEQD---GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTS  238
            Y        DT  D   G    + + E++++L   ++R+++E   + +     R  +L +
Sbjct  750  YSMVGIGIPDTGPDNGQGLDARDPLAEKKMELATCQRRVEDEMTKHSKAVEVTRAMTLNN  809

Query  237  LRTGLPELFHAMSEFSRACSIMYQTLESI  151
            L+TGLP +F A++ FS   S+  + L+S+
Sbjct  810  LQTGLPGVFQALTSFS---SLFTEALDSV  835



>ref|XP_006445430.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
 gb|ESR58670.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
Length=785

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 131/257 (51%), Gaps = 13/257 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW+ M  +HE Q  IV  +R L + +   + TS+ H + T  L   + 
Sbjct  516  PRLVDLCHGFMYMWKAMHQYHEVQNNIVQQVRGLVNQAAKGESTSDMHRQATRNLESAIT  575

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q++++R L+ W KL L+P+     + +S  + P    +      W+  
Sbjct  576  AWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVSN---DNMSGKREPSE--VYGFFDEWKLA  630

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH
Sbjct  631  LERVPDTVASEAIKSFINVVHVISVKQTEELKIKKRTETASKELEKKASSLRNIERKFYH  690

Query  411  KYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y        D   D  H     + + E++L+L A ++R+++E   + R     R  +L 
Sbjct  691  SYSMVGIGLPDPGPDNGHVLDARDPLAEKKLELAACQRRVEDELLRHSRAVEVTRANTLN  750

Query  240  SLRTGLPELFHAMSEFS  190
            +L+TGLP +F A++ FS
Sbjct  751  NLQTGLPGVFQALTSFS  767



>ref|XP_010503820.1| PREDICTED: uncharacterized protein LOC104780964 [Camelina sativa]
Length=644

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  379  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  438

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  439  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAI  493

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct  494  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPY  553

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  554  SVPES-------RKTNPVIEKRVKVEMLKAKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  606

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  607  VFQAMVGFSSVC---MQAFESV  625



>ref|XP_010515532.1| PREDICTED: uncharacterized protein LOC104791366 [Camelina sativa]
Length=643

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  378  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  437

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  438  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAI  492

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct  493  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPY  552

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  553  SVPES-------RKTNPVIEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  605

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  606  VFQAMVGFSSVC---MQAFESV  624



>gb|KJB22870.1| hypothetical protein B456_004G070400 [Gossypium raimondii]
Length=820

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 138/270 (51%), Gaps = 16/270 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  +   +  MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V 
Sbjct  551  PQLVEICHGLRYMWGSMHQYHEVQSNIVQQVRGLINRSVKGDSTSELHRQATRDLESAVT  610

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+++I  L+ W KL+L+P+  +  +  + P       + A    W+  
Sbjct  611  AWHSSFCRLIKFQRDFICSLHGWFKLSLLPLSNDNVDGNADPS-----GVYAFCDEWKLA  665

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A   I SF  VV  I   Q +E+K+K R ++  KELEK+     +    +YH
Sbjct  666  LERVPDTVASEGIKSFINVVRVISAKQTEELKIKKRTENASKELEKKASSLRNIERKFYH  725

Query  411  KY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y M    P D     GP  D  + + E++ +L A ++R+++E   + +     R  +L 
Sbjct  726  SYSMVGIGPPDSGSDHGPVLDARDPLSEKKSELAACQRRVEDEMMRHAKAVEVTRAMTLN  785

Query  240  SLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            +L+TGLP +F A++ FS    +  + L+S+
Sbjct  786  NLQTGLPGVFRALTSFS---GVFTEALDSV  812



>ref|XP_008365863.1| PREDICTED: uncharacterized protein LOC103429493 [Malus domestica]
Length=733

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/261 (29%), Positives = 133/261 (51%), Gaps = 2/261 (1%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P++  L++ + R W+ M   HE Q +I+  ++S   S   K ++  H   T QL V +Q 
Sbjct  445  PQIVELLKGLMRTWKIMLESHETQHKILFEVKSFAGSAYGKFSNNSHMRATLQLLVELQN  504

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS--PQRPQNPPILALLHAWQD  583
            WH+ F + +  QK Y+  L+ WL   +VP +       SS  P     PP+L + H W  
Sbjct  505  WHACFREYVAAQKAYVETLHGWLIKFVVPEEELYSRSRSSAAPYGVNGPPLLLICHDWLS  564

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM  403
             + KLPD L   A+ SF+  V  ++  Q +E K K +     KEL++R R F+    +++
Sbjct  565  SMEKLPDTLVTIALRSFTKDVRALLNQQGEEQKQKRKVDSLAKELDRRIRAFQKTESRFL  624

Query  402  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL  223
            + +      E D  H+  ++ ER+ Q++  ++++  E E +     + +  +L  ++TG 
Sbjct  625  EPKLVEQKCETDIEHKTESLTERKEQIDMFRRKVDMEREKHQNYVQETQRVTLNVIQTGF  684

Query  222  PELFHAMSEFSRACSIMYQTL  160
              +F +++EFSRA   +Y  L
Sbjct  685  CSVFESLAEFSRASQKLYGDL  705



>ref|XP_010919721.1| PREDICTED: uncharacterized protein LOC105043738 [Elaeis guineensis]
Length=759

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/275 (30%), Positives = 141/275 (51%), Gaps = 22/275 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  +   +  MW +M   HE Q  IV  +R L + S + + TS+ H   T  L   V 
Sbjct  486  PQLVDICYGLLNMWRSMHQFHEVQNHIVQQVRGLVNRSSAGEPTSDLHRLATRDLEAAVS  545

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPI----LALLHA  592
             WHS F ++I +Q++YIR L  WL+L L  + ++      +PQ+  + PI     A    
Sbjct  546  AWHSSFNRLIKYQRDYIRALYSWLRLTLYQVSSD------NPQKDHSSPISLELTAFCDE  599

Query  591  WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYH  412
            W+  + +LPD +A  AI SF  V++ I   Q +E+K+K R +   KELEK++        
Sbjct  600  WKQALDRLPDTVASEAIKSFMNVIHVIYTKQAEELKIKKRTEALSKELEKKSASLRSIEK  659

Query  411  KYMQRRT------PNDDTEQDGPHEDNN--VIERQLQLEALKQRLKEEEEAYMRQCMQVR  256
            KY Q  +      P    +  G   D+   + E++ ++ A ++R+++E   + +     R
Sbjct  660  KYYQSYSMVGIGLPGGGRDNGGQVFDSRDPLAEKKSEIAACRRRVEDEMMRHAKAVEVTR  719

Query  255  VKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
              +L +++TGLP +F AM+ FS   ++  + LE++
Sbjct  720  SMTLNNIQTGLPGVFQAMTGFS---NLFVEALEAV  751



>ref|XP_006837374.1| hypothetical protein AMTR_s00111p00120840 [Amborella trichopoda]
 gb|ERN00228.1| hypothetical protein AMTR_s00111p00120840 [Amborella trichopoda]
Length=910

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/270 (28%), Positives = 138/270 (51%), Gaps = 11/270 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L +L   + +MW+ M   HE Q +IV  +R L+       TS+ H   T  L   V  
Sbjct  585  PQLVNLCCGLMQMWQAMNRCHEAQNRIVQQVRGLENPPVGTSTSDIHRRATLHLEAAVSS  644

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP-----ILALLHA  592
            WHS F ++  + ++Y+R L+ WL+L +   +  L    S  Q   + P     + +L   
Sbjct  645  WHSSFSRLTRYHRDYVRALHSWLRLTIAHPELTLAPPSSPAQILDSAPNEASQMYSLCDE  704

Query  591  WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED---  421
            W+ +  ++PD +A  AI  F+ VV++I   Q +E+K   R +   KELEK+     +   
Sbjct  705  WKQVAERVPDTVASEAIKGFAIVVHSIAMRQAEELKCNKRAETAEKELEKKASNLRNIAR  764

Query  420  -WYHKY-MQRRTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVK  250
             +Y+ Y +    P  +++  G  +  + +IE++ +++A +++ +EE   +++     R  
Sbjct  765  KFYNSYSLVGVNPGGESDTGGVLDARDPLIEKKAEVDACRRKAEEERAKHVKAIQVTRAM  824

Query  249  SLTSLRTGLPELFHAMSEFSRACSIMYQTL  160
            +L +++TGLP +F AM  FS  C+    T+
Sbjct  825  TLNNIQTGLPGVFQAMVGFSGICTEALGTV  854



>ref|XP_006306896.1| hypothetical protein CARUB_v10008455mg, partial [Capsella rubella]
 gb|EOA39794.1| hypothetical protein CARUB_v10008455mg, partial [Capsella rubella]
Length=711

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/273 (32%), Positives = 142/273 (52%), Gaps = 17/273 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V 
Sbjct  449  PQLVELCHGLMYMWKSMHEYHEIQSNIVQQVRGLINQTEKGESTSEVHRQVTRDLESAVS  508

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+E+I  L+ W KL+LV +     +K       Q P   AL   W+  
Sbjct  509  LWHSSFCRIIKFQREFICSLHAWFKLSLVSLSNEDPKK-------QRPDSFALCEEWKQS  561

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q
Sbjct  562  LERVPDTVASEAIKSFVNVVHVISIKQAEEVKMKKRTESAGKELEKKASSLRSIERKYYQ  621

Query  399  RRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL  235
              +    T   GP  +     + + E++ +L A +++++EE   +++     R  +L +L
Sbjct  622  AYS----TVGIGPGPEVLDARDPLSEKKCELAACQRQVEEEVMRHVKAVEVTRAMTLNNL  677

Query  234  RTGLPELFHAMSEFSRACSIMYQTLESITHPLN  136
            +TGLP +F A++ FS   +   QT+ S ++ +N
Sbjct  678  QTGLPNVFQALTSFSSLFTECLQTVCSSSYSIN  710



>emb|CDX73734.1| BnaC08g22690D [Brassica napus]
Length=640

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 127/262 (48%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L++ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T+QL + +Q+
Sbjct  375  PQLVELIKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTFQLELEIQQ  434

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  435  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLARSSYESK-----IYSFCEEWHLAI  489

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q +E K K R     K+ EK+         KY   
Sbjct  490  DRIPDKVASEGINSFLTAVHGIVAQQAEEHKQKKRSDSMLKDFEKKAASLRGLESKYSPY  549

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE++ ++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  550  SVPEG-------RKKNPVIEKRAKVEFLKGKAEEEKSKHEKAVSVTRAMTLNNLQMGFPH  602

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  603  VFQAMVGFSSVC---MQAFESV  621



>ref|XP_010258777.1| PREDICTED: uncharacterized protein LOC104598423 [Nelumbo nucifera]
Length=771

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 143/286 (50%), Gaps = 27/286 (9%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW +M   HE Q  IV  +R L ++S   + TSE H + T  L   V 
Sbjct  481  PQLVELCHGLMYMWRSMNQFHEVQSHIVQQVRGLVNLSTKGESTSELHRQATRHLESAVS  540

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI--DTNLKEKVSSPQR--------------  628
             WHS F ++I +Q++YIR L+ WLKL+L+ +  D+    K +S                 
Sbjct  541  AWHSNFCRLIKYQRDYIRSLHGWLKLSLIHVGNDSTTGSKGASTAAQTYTTGSKDASVAV  600

Query  627  PQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKEL  448
              +  +L L   W+  + +LPD +A  AI SF  VV+ I   Q +E+K K   +   KEL
Sbjct  601  QTSSDLLPLCDEWKLALDRLPDTVASEAIKSFVNVVHVIAVKQTEEIKSKKWAETASKEL  660

Query  447  EKRTRQFED----WYHKY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEE  289
            EK+     +    +YH Y M    P D    DG   D  + + E++L+L + ++R+++E 
Sbjct  661  EKKASALRNIEKKFYHSYSMVGIGPPDGGAADGQVLDARDPLAEKKLELASCQRRVEDEM  720

Query  288  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
              + +     R  +L +++TGLP +F AM+ FS    +  + LE +
Sbjct  721  MKHAKAVEVTRAMTLNNIQTGLPGVFQAMTAFS---GLFTEALEGV  763



>gb|KGN46505.1| hypothetical protein Csa_6G104620 [Cucumis sativus]
Length=815

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 145/278 (52%), Gaps = 33/278 (12%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW +M  +H+ Q  IV  +R L + +     TSE H + T  L  +V 
Sbjct  547  PQLVELCHGLMYMWRSMHQYHDIQNNIVQQVRGLVNQTSHGDSTSELHRQATRDLESMVT  606

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPID----TNLKEKVSSPQRPQNPPILALLHA  592
             WHS F ++I   +++IR L+ WLKL+ +P++    T+ KE           P    L  
Sbjct  607  AWHSSFCRLIKFHRDFIRSLHGWLKLSYIPVNNDSLTDNKE-----------PAEIFLDQ  655

Query  591  WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF----E  424
            W+  + ++PD +A  AI SF  VVN I   Q +E+K+K R +   KE EK++       +
Sbjct  656  WKLALDRVPDTVASVAIKSFINVVNVISAKQTEEIKIKKRTESASKEFEKKSASIMHLEK  715

Query  423  DWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCM  265
             +Y+ Y        DT   GP ++ +++       E++++L A ++R++EE+  + +   
Sbjct  716  KFYNSYSMVGIGLPDT---GPADNGHILDARDPLAEKKIELVACQRRVEEEKIKHSKAVE  772

Query  264  QVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
              R  +L +L+TGLP +F A++ FS   ++  + LES+
Sbjct  773  VTRAMTLNNLQTGLPGVFQALTSFS---ALFTEALESV  807



>ref|XP_004515356.1| PREDICTED: uncharacterized protein LOC101490151 [Cicer arietinum]
Length=739

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/273 (32%), Positives = 145/273 (53%), Gaps = 22/273 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVV  763
            P+L  L   +  MW +M  +HE Q  IV  +R L +S+S K   TSE H + T  L + V
Sbjct  470  PQLVELCHGIIYMWRSMHQYHETQSNIVQQVRGL-VSRSSKGHSTSESHRQTTRDLELAV  528

Query  762  QEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD  583
              WHS F ++I  Q+++I  L+ W KLNL+P++ N K     P         +    W+ 
Sbjct  529  SAWHSNFCRLIKFQRDFILSLHGWFKLNLIPVNNNDKNNNIEPSD-----AFSFCDEWKL  583

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WY  415
             + ++PD +A  AI SF  VV+ I   Q +E+K+K +  +  KELEK+T   ++    +Y
Sbjct  584  ALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKKKTDNAYKELEKKTSSIKNIEKKFY  643

Query  414  HKYMQ-----RRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVK  250
            + Y         + ND+ +  G    + + E++L+L   + R+++E+  + +     R  
Sbjct  644  NSYSMVGIGVPHSVNDNGQ--GLDARDPLAEKKLELSICQLRVEDEKMKHSKAIEVTRAM  701

Query  249  SLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  702  TLNNLQTGLPGVFQALTSFS---SLFIEALESV  731



>emb|CDP09433.1| unnamed protein product [Coffea canephora]
Length=813

 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 142/276 (51%), Gaps = 23/276 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW++M  +HE Q  IV  ++ L + +   + TS+ H + T  L   V 
Sbjct  544  PQLVGLCHGFMYMWKSMNQYHEVQYDIVQQVQGLVNRTTQGESTSDLHKQATRDLESAVS  603

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQN---PPILALLHAW  589
             WHS F +++  Q+E+IR L++W KL  +P        VSS Q   N     + A    W
Sbjct  604  AWHSSFCRLMKFQREFIRSLHEWFKLTFLP--------VSSEQTNGNREHSEVFAFCDEW  655

Query  588  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----  421
            +  + ++PD +A  A+ SF  VVN+I   Q +E+K+K R +   +ELEK+     +    
Sbjct  656  KLALDRIPDTVASEAVKSFINVVNSISLKQREELKIKGRAESVSRELEKKASSLRNIEKK  715

Query  420  WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVK  250
            +Y+ Y        DT  D  H     + + E++L+L A ++R+ +E   + +     R  
Sbjct  716  YYNSYSMVGIGLPDTGPDNGHALDARDPLAEKKLELAACQRRVADEMLKHSKAVEVTRSH  775

Query  249  SLTSLRTGLPELFHAMSEFSRACSIMYQTLESI-TH  145
            +L +++TGLP +F AM+ FS   +++   LE++ TH
Sbjct  776  TLNNIQTGLPGVFQAMTSFS---AMIAGALEAVCTH  808



>ref|XP_009379364.1| PREDICTED: uncharacterized protein LOC103967785 [Pyrus x bretschneideri]
 ref|XP_009379365.1| PREDICTED: uncharacterized protein LOC103967785 [Pyrus x bretschneideri]
Length=649

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 130/259 (50%), Gaps = 9/259 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  LR L+   S + TSE H +   QL + VQ+
Sbjct  382  PQLIELVKGLMCMWRSMYECHQVQKHIVQQLRYLNTIPSTEPTSEIHRQAALQLELQVQQ  441

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     +   K S   R     I  L   W   I
Sbjct  442  WHLSFCSLVKAQRDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAI  496

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  VV+ IV  Q +E K K + + T KELEK+         +Y   
Sbjct  497  DRIPDKVASEGIKSFLTVVHAIVVQQAEEYKQKRKSESTFKELEKKATVLRSLESRYGPY  556

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P+      G  + N V E++ ++E L+ + +EE+  + +     R  ++++L+ G P 
Sbjct  557  SMPDS----SGNAKKNPVAEKRAKIEVLRAKAEEEKSKHEKLVNVTRTVTISNLQMGFPH  612

Query  216  LFHAMSEFSRACSIMYQTL  160
            +F AM  FS  C   ++ L
Sbjct  613  VFEAMVGFSSVCMQAFEQL  631



>ref|XP_006290733.1| hypothetical protein CARUB_v10016827mg [Capsella rubella]
 gb|EOA23631.1| hypothetical protein CARUB_v10016827mg [Capsella rubella]
Length=640

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/262 (31%), Positives = 129/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  375  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  434

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  435  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAI  489

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct  490  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSASLRALESKYSPY  549

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE++++++ LK + +EE+  + +     R  +L +L+ G P 
Sbjct  550  SVPES-------RKTNPVIEKRVKVDMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  602

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  603  VFQAMVGFSSVC---MQAFESV  621



>ref|XP_002511585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50254.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 136/269 (51%), Gaps = 18/269 (7%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V 
Sbjct  540  PQLVELCHGFMYMWRSMNQYHEVQNNIVQQVRGLVNRSTKGDSTSELHKQATRDLESAVS  599

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI-DTNLKEKVSSPQRPQNPPILALLHAWQD  583
             WHS F ++I  Q+++IR ++ W KL L+P+ D N+   V      ++  + A    W+ 
Sbjct  600  AWHSSFCRLIKFQRDFIRSVHGWFKLTLLPVSDGNVNSNV------EHSDVYAFCDEWKL  653

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WY  415
             + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+     +    +Y
Sbjct  654  TLDRVPDTVASEAIKSFINVVHVISLKQNEELKIKKRTETASKELEKKASSLRNIERKFY  713

Query  414  HKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
            H Y        DT  D        + + E++ +L A ++R+++E   + +     R  +L
Sbjct  714  HSYSMVGIGMPDTGADNGQVLDARDPLAEKKSELAACQRRVEDEMLRHAKAVEVTRAMTL  773

Query  243  TSLRTGLPELFHAMSEFSRACSIMYQTLE  157
             +L+TGLP +F A++ FS   S+  + LE
Sbjct  774  NNLQTGLPGVFQALTSFS---SLFTEALE  799



>ref|XP_011008835.1| PREDICTED: uncharacterized protein LOC105114109 [Populus euphratica]
Length=637

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 132/262 (50%), Gaps = 14/262 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+    MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + V +
Sbjct  369  PQLLELVKGSMCMWRSMYELHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVHQ  428

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   R     I +L   W   +
Sbjct  429  WHQSFCNVVKAQRDYIQSLTGWLRLSLFQFSKNPISRTSQESR-----IYSLCEEWHHAV  483

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKY  406
             ++PD++A   I SF AV++ IV  Q +E K K + +   KE EK+    R  E  Y  Y
Sbjct  484  DRIPDKVASEGIKSFLAVIHAIVVQQAEEHKQKKKSESAFKEFEKKAAELRSLESKYGPY  543

Query  405  MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
                TP+   ++D       V+E++ ++E  + + +EE+  + +     R  ++ +L+ G
Sbjct  544  SMPETPSTTRKKD------PVMEKRAKVEISRAKAEEEKSKHEKSISVTRSMTMNNLQMG  597

Query  225  LPELFHAMSEFSRACSIMYQTL  160
             P +F AM  FS  C   +++L
Sbjct  598  FPHVFQAMVGFSSVCMNAFESL  619



>ref|XP_011089387.1| PREDICTED: uncharacterized protein LOC105170351 [Sesamum indicum]
Length=828

 Score =   128 bits (321),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 79/275 (29%), Positives = 141/275 (51%), Gaps = 22/275 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW +M   HE Q  IV  +R L + +   + TS+ H + T  L   V 
Sbjct  560  PQLVELCHGFMYMWRSMNQFHEVQNDIVQQVRGLVNHTNKGESTSDLHRQATRDLESAVS  619

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPID---TNLKEKVSSPQRPQNPPILALLHAW  589
             WHS F ++I  Q++++R L+ W KL L+P++   TN   ++S         +      W
Sbjct  620  AWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVNSEPTNGNRELSE--------VFTFCDEW  671

Query  588  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----  421
            +  + ++PD +A  AI SF  VV++I   Q++E+K+K R +   KELEK+     +    
Sbjct  672  KLALDRIPDTVASEAIKSFINVVHSISLKQIEELKIKKRTETASKELEKKASSLRNIEKK  731

Query  420  WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVK  250
            +YH Y        DT  D  H     + + +++ +L   ++R+++E   + +     R  
Sbjct  732  YYHSYSMVGIGLPDTGPDNGHALDARDPLADKKAELATCQRRVEDEMLKHAKAVEVTRAM  791

Query  249  SLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  145
            +L +++TGLP +F AM+ FS   +++ + LE++ +
Sbjct  792  TLNNIQTGLPGVFQAMTSFS---ALITEALETVCY  823



>ref|XP_009115808.1| PREDICTED: uncharacterized protein LOC103841050 [Brassica rapa]
Length=639

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 127/262 (48%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L++ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T+QL + +Q+
Sbjct  374  PQLVELIKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTFQLELEIQQ  433

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  434  WHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAI  488

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q +E K K R     K+ EK+         KY   
Sbjct  489  DRIPDKVASEGINSFLTAVHGIVAQQAEEHKQKKRSDSMLKDFEKKAASLRGLESKYSPY  548

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE++ ++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  549  SVPEG-------RKKNPVIEKRAKVEFLKGKAEEEKSKHEKAVSVTRAMTLNNLQMGFPH  601

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  602  VFQAMVGFSSVC---MQAFESV  620



>ref|XP_006660902.1| PREDICTED: uncharacterized protein LOC102703332 [Oryza brachyantha]
Length=392

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 127/264 (48%), Gaps = 17/264 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV  +  MW  M   H+ Q  +V  L  L+ S S   TS  H +   QL + V  
Sbjct  124  PQLLELVAGLMSMWRGMYECHQVQTHMVQQLEYLNNSLSTNPTSNVHRQAALQLEIEVDR  183

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRP--QNPPILALLHAWQD  583
            W+S F  ++  Q++Y+  L  WL+L+L        +    P     QN  I +L   WQ 
Sbjct  184  WYSAFCSLVKSQRDYVYSLTGWLRLSLF-------QSYHDPHSKGHQNSDIYSLCEEWQL  236

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYH  412
             I ++PD++A   I +   V++ +V  Q +E K K R +   KELEK+T   R  E  Y 
Sbjct  237  AIDRIPDKVASEGIKTLLTVIHAVVVQQAEEQKQKKRSESAFKELEKKTEELRSLESKYG  296

Query  411  KYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  232
             Y        D  +  P     V +++ ++EAL+ R  EE+  Y +     R  +L +L+
Sbjct  297  PYSGAEGGFGDMSRKSP-----VSDKRAKVEALRCRADEEKSKYEKSIGVTRAMTLNNLQ  351

Query  231  TGLPELFHAMSEFSRACSIMYQTL  160
            TG P +F AM+ F+  C   ++++
Sbjct  352  TGFPNVFQAMTGFASVCMEAFESV  375



>ref|XP_002529641.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32728.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 129/252 (51%), Gaps = 8/252 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L++ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct  369  PQLLELLKGLMCMWRSMYEAHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVQQ  428

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  +I  Q++YI+ L  WL+L+L     N   + S   R     I +L   W   I
Sbjct  429  WHQSFCNLIKAQRDYIQSLTGWLRLSLFQFSNNPLSRTSQESR-----IYSLCEEWHHAI  483

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  V++ IV  Q +E K K + + T KE EK+  +      KY   
Sbjct  484  DRIPDKVASEGIKSFLTVIHAIVVQQAEEHKQKKKSELTFKEFEKKVSELRSLETKYGPY  543

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P  DT  +   +D  V E++ ++E L+ + +EE+  + +     R  ++ +L+ G P 
Sbjct  544  SMP--DTSGNTRIKD-PVTEKRAKVEILRSKAEEEKSKHEKSVSITRAMTINNLQMGFPH  600

Query  216  LFHAMSEFSRAC  181
            +F A+  FS  C
Sbjct  601  VFQAIVGFSSVC  612



>gb|KFK34370.1| hypothetical protein AALP_AA5G136500 [Arabis alpina]
Length=628

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/262 (31%), Positives = 127/262 (48%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  363  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  422

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q+EYI+ L  WL+L+L     N   + S   +     I +    W   +
Sbjct  423  WHHSFCNLVKAQREYIQALTGWLRLSLFQFSNNPLVRSSYESK-----IYSFCEEWHLAV  477

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q DE K K + +   K  EK++        KY   
Sbjct  478  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKKSESMLKGFEKKSAALRALESKYSPY  537

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE++ ++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  538  SVPES-------RKKNPVIEKRAKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH  590

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  591  VFQAMVGFSSVC---MQAFESV  609



>ref|XP_008352431.1| PREDICTED: uncharacterized protein LOC103415926 [Malus domestica]
Length=642

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 131/269 (49%), Gaps = 9/269 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV  +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct  375  PQLIELVNGLMCMWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQATLQLELQVQQ  434

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q +YI+ L  WL+L+L     +   K S   R     I  L   W   I
Sbjct  435  WHLSFCSLVKAQCDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAI  489

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  VV+ IV  Q DE K K + + T KELEK+         KY   
Sbjct  490  DRIPDKVASEGIKSFLTVVHAIVVQQADEYKQKRKSESTFKELEKKATALRSLESKYGPY  549

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P+  +      + N V E++ ++E ++ + +EE+  + +     R  ++ +L+ G P 
Sbjct  550  SMPDSSSNA----KKNPVAEKRAKVEVIRAKAEEEKSKHEKLVSVTRTMTINNLQMGFPH  605

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNRE  130
            +F AM  FS  C   ++ L +     N E
Sbjct  606  VFEAMVGFSSVCMQAFEQLYNQAKSANEE  634



>ref|XP_008808616.1| PREDICTED: uncharacterized protein LOC103720605, partial [Phoenix 
dactylifera]
Length=552

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/263 (31%), Positives = 134/263 (51%), Gaps = 13/263 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV  +  MW +M   H+ Q  IV  L  L+ + S   T++ H + + QL + V  
Sbjct  284  PQLLELVTGLMGMWRSMYECHQVQTHIVQQLEYLNNASSTNPTTDIHRQASLQLELEVNH  343

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            W+S F  ++  Q+EY+  L  WL+L+L   D N+  K       Q+  I +L   WQ  +
Sbjct  344  WYSAFCSLVKSQREYMYALTGWLRLSLFQCDHNMLGK-----SQQSSDIYSLCEEWQLAL  398

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  V++ +V  Q +E K K + +   KELEKR ++      K    
Sbjct  399  DRIPDKVASEGIKSFITVIHAVVVQQAEEQKQKRKSELAFKELEKRAQELRSLESKC---  455

Query  396  RTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  220
              P    E  G       V+E++ ++E+LK + +EE+  + +     R  +L +L+TGLP
Sbjct  456  -GPYSAAEGHGEMSRRYPVMEKRAKVESLKTKAEEEKSRHEKSVAVTRAMTLNNLQTGLP  514

Query  219  ELFHAMSEFSRACSIMYQTLESI  151
             +F A++ F+  C    Q  ES+
Sbjct  515  NVFQAITGFASVC---MQAFESV  534



>gb|KDP28858.1| hypothetical protein JCGZ_14629 [Jatropha curcas]
Length=810

 Score =   127 bits (320),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 135/268 (50%), Gaps = 15/268 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L      MW +M  +HE Q  IV  ++ L ++S     TSE H + T  L   V 
Sbjct  540  PQLIELCHGFMYMWRSMHQYHEVQNNIVQQVKGLVNLSAKGDSTSELHRQATRDLESAVS  599

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F  +I  Q+++IR ++ W KL L+P+  N    VS     ++  + A    W+  
Sbjct  600  AWHSSFCHLIKFQRDFIRSVHGWFKLTLLPVSNNDNVNVS----VEHSDVYAFCDEWKLA  655

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  +V+ I   Q +E+K+K R +   KELEK+     +    +YH
Sbjct  656  LDRVPDTVASEAIKSFINIVHAISGKQTEELKIKKRTESASKELEKKASSLRNIERKFYH  715

Query  411  KYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y        DT  D  H     + + E++ +L + ++++++E   + +     R  +L 
Sbjct  716  SYSMVGIGLPDTGPDNGHALDARDPLAEKKSELASCQRKVEDEMLRHAKAVEVTRAMTLN  775

Query  240  SLRTGLPELFHAMSEFSRACSIMYQTLE  157
             L+TGLP +F A++ FS   S+  + LE
Sbjct  776  HLQTGLPGVFQALTSFS---SLFMEALE  800



>ref|XP_009363473.1| PREDICTED: uncharacterized protein LOC103953463 [Pyrus x bretschneideri]
Length=657

 Score =   126 bits (317),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 133/269 (49%), Gaps = 9/269 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct  390  PQLIELVKGLMCMWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQATLQLELQVQQ  449

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     +   K S   R     I  L   W   I
Sbjct  450  WHLSFCSLVKAQRDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAI  504

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  VV+ IV  Q DE K K + + T KELEK+         KY   
Sbjct  505  DRIPDKVASEGIKSFLTVVHAIVVQQADEYKQKRKSESTFKELEKKATALRSLESKYGPY  564

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P+  +      + + V E++ +++ +K + +EE+  + +     R  ++ +L+ G P 
Sbjct  565  SMPDSSSNT----KKSPVAEKRAKVDIIKAKAEEEKSKHEKLVSVTRTMTINNLQMGFPH  620

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNRE  130
            +F AM  FS  C   ++ L +     N E
Sbjct  621  VFEAMVGFSSVCMQAFEQLYNQAKSANEE  649



>ref|XP_008370338.1| PREDICTED: uncharacterized protein LOC103433829 [Malus domestica]
 ref|XP_008370339.1| PREDICTED: uncharacterized protein LOC103433829 [Malus domestica]
Length=650

 Score =   126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 134/269 (50%), Gaps = 9/269 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H +   +L + VQ+
Sbjct  383  PQLFELVKGLMCMWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQAXLELELQVQQ  442

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     +   K S   R     I  L   W   I
Sbjct  443  WHLSFCSLVKAQRDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAI  497

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  VV+ IV  Q +E K K + + T KELEK+         KY   
Sbjct  498  DRIPDKVASEGIKSFLTVVHAIVVQQAEEYKQKRKSESTFKELEKKATVLRSLESKYGPY  557

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P+      G  + N V E++ ++E L+ + +EE+  + +     R  ++++L+ G P 
Sbjct  558  SMPDS----SGNTKKNPVAEKRXKIEVLRAKAEEEKSKHEKLVNVTRTVTISNLQMGFPH  613

Query  216  LFHAMSEFSRACSIMYQTLESITHPLNRE  130
            +F AM  FS  C   ++ L +     N+E
Sbjct  614  VFEAMVGFSSVCMQAFEQLYNQAKSANQE  642



>ref|XP_006403933.1| hypothetical protein EUTSA_v10010132mg [Eutrema salsugineum]
 gb|ESQ45386.1| hypothetical protein EUTSA_v10010132mg [Eutrema salsugineum]
Length=801

 Score =   127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/262 (31%), Positives = 128/262 (49%), Gaps = 15/262 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+
Sbjct  378  PQLVELVKGLMCMWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQ  437

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   +     I +    W   I
Sbjct  438  WHYSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAI  492

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF   V+ IV  Q +E K K R +   K+ EK+         KY   
Sbjct  493  DRIPDKVASEGIKSFLTAVHGIVAQQAEEHKQKKRSESMLKDFEKKAAALRALESKYSPY  552

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P          + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct  553  SVPESK-------KKNPVIEKRVKVEMLKGKAEEEKSKHEKAVSVTRAMTLNNLQMGFPH  605

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F AM  FS  C    Q  ES+
Sbjct  606  VFQAMVGFSSVC---MQAFESV  624



>gb|ABI34654.1| bZIP transcription factor bZIP80 [Glycine max]
Length=426

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/273 (30%), Positives = 138/273 (51%), Gaps = 23/273 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L+     MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V 
Sbjct  158  PQLVDLIHGFMYMWRSMHHYHEIQSNIVQQVRGLVNRSSRGDSTSELHRQATRDLESAVS  217

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI---DTNLKEKVSSPQRPQNPPILALLHAW  589
             WH+ F ++I  Q+E+I  L+ W KL+LVP+   + N +E   + Q             W
Sbjct  218  AWHNSFCRLIKFQREFILSLHGWFKLSLVPVHNDNINGRETSETYQ---------FFDEW  268

Query  588  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK  409
            +  + ++PD +A  AI SF  VV+ I   Q++E+K+K R +   KELEK+     +   K
Sbjct  269  KLALDRVPDTVASEAIKSFINVVHVISSKQVEELKIKKRTETASKELEKKASSLRNLERK  328

Query  408  YMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVK  250
            +    +    +  D   ++  V+       E++++L   ++R+++E   + +     R  
Sbjct  329  FYSSYSMVGISLPDSAPDNGQVLDARDPLAEKKIELATCQRRVEDEMLRHSKAVEVTRAM  388

Query  249  SLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  389  TLNNLQTGLPGVFQALTSFS---SLFAEALESV  418



>ref|XP_006380598.1| proline-rich family protein [Populus trichocarpa]
 gb|ERP58395.1| proline-rich family protein [Populus trichocarpa]
Length=654

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 131/262 (50%), Gaps = 14/262 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+    MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + V +
Sbjct  386  PQLLELVKGSMCMWRSMYELHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVHQ  445

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + S   R     I +L   W   +
Sbjct  446  WHQSFCNVVKAQRDYIQSLTGWLRLSLFQFSKNPISRTSQESR-----IYSLCEEWHHAV  500

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKY  406
             ++PD++A   I SF AV++ IV  Q +E K K + +   KE EK+    R  E  Y  Y
Sbjct  501  DRIPDKVASEGIKSFLAVIHAIVVQQAEEHKQKKKSESAFKEFEKKAAELRSLESKYGPY  560

Query  405  MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  226
                TP+   ++D       V+E++ + E  + + +EE+  + +     R  ++ +L+ G
Sbjct  561  SMPETPSTTRKKD------PVMEKRAKAEISRAKAEEEKSKHEKSISVTRSMTMNNLQMG  614

Query  225  LPELFHAMSEFSRACSIMYQTL  160
             P +F AM  FS  C   +++L
Sbjct  615  FPHVFQAMVGFSSVCMNAFESL  636



>gb|EPS68751.1| hypothetical protein M569_06016 [Genlisea aurea]
Length=816

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/277 (29%), Positives = 142/277 (51%), Gaps = 16/277 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL---DMSQSPKETSEHHYERTYQLGVV  766
            P+L  L      MW +M   HE+Q  IV  +R L     ++  + TS+ H   T  L   
Sbjct  538  PQLVELCHGFMYMWRSMNRFHESQNDIVQQVRGLVNGHANRGGESTSDLHRRATSYLESA  597

Query  765  VQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRP-QNPPILALLHAW  589
            V EWHS F ++I  Q+++IR L+ W KL ++P+++     ++S  R  Q   +   +  W
Sbjct  598  VSEWHSSFCRLIKFQRDFIRSLHGWFKLTVLPVNSEQMMTMNSNGREVQLGEVFGFIDEW  657

Query  588  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK  409
            +  + ++PD +A  AI SF  VV++I   Q +E+K++ R +   KELE++         K
Sbjct  658  KLALDRVPDTVASEAIKSFINVVHSISAKQAEELKIRKRTESVSKELERKASSLRSIEKK  717

Query  408  YMQRRT------PNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVR  256
            Y    +      P+   + DG H     + + E++ +L   ++R++EE   + +     R
Sbjct  718  YYLSYSTVGIGLPDPGPDHDGGHALDARDPLAEKKAELATCQRRVEEEMVRHSKAVEVTR  777

Query  255  VKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  145
              +L +L+TGLP +F AM+ FS    ++ + L+++ +
Sbjct  778  AMTLNNLQTGLPGVFQAMTGFS---GLITEALQAVCN  811



>ref|XP_009383946.1| PREDICTED: uncharacterized protein LOC103971612 [Musa acuminata 
subsp. malaccensis]
Length=772

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 142/275 (52%), Gaps = 22/275 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  +  ++  MW  M   HE Q  IV  +R L + + + + TS+ H   T  L   V 
Sbjct  500  PQLVEICYALLNMWRQMNKFHEIQNHIVQQVRGLVNRASTGESTSDLHRLATRDLEAAVS  559

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHA----  592
             WHS F ++I +Q++Y+  L  WLKL L+ + ++      +PQ+  + P+   L A    
Sbjct  560  AWHSSFNRLIKYQRDYVHALYGWLKLTLLQVSSD------NPQKDHSSPVAVELTAFCDE  613

Query  591  WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYH  412
            W+  + +LPD +A  A+ SF  V++ I   Q++E+K+K R +   KELEK++    +   
Sbjct  614  WKQALDRLPDTVASEAVKSFMNVIHVIYTKQVEELKIKKRAETYSKELEKKSTALRNTEK  673

Query  411  KYMQRRT------PNDDTEQDGPHEDNN--VIERQLQLEALKQRLKEEEEAYMRQCMQVR  256
            KY Q  +      P    + DG   D    + E++ ++ A ++++++E   + +     R
Sbjct  674  KYYQSYSMVGLALPGGGHDNDGQVFDTRDPLAEKKSEIAACRRKVEDEMMRHAKAVEVTR  733

Query  255  VKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
              +L +++TGLP +F A++ FS    +  + LE +
Sbjct  734  SMTLNNIQTGLPGVFQALTGFS---GMFVEALEGV  765



>gb|KEH17841.1| BZIP transcription factor bZIP80, putative [Medicago truncatula]
Length=723

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 143/273 (52%), Gaps = 17/273 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW +M  +HE Q  IV  +R L + S     TSE H + T  L   + 
Sbjct  449  PQLVELCHGIIYMWRSMHQYHEMQSNIVQQVRGLVNRSTKGHSTSESHKQATRDLESALS  508

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ-RPQNPPILALLHAWQD  583
             WHS F ++I  Q+++I  L+ W KLNL+P++ +      S +  P +   L+    W+ 
Sbjct  509  AWHSSFIRIIKFQRDFILSLHGWFKLNLIPVNNDNNNSSISNKMEPSDA--LSFCDGWKL  566

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT-------RQFE  424
             + ++PD +A  AI SF  VV+ I   Q  E+K+K +     KEL K++       ++F 
Sbjct  567  ALDRVPDTVASEAIKSFINVVHVISVKQCQELKIKRKTDTAYKELVKKSSSLKNIEKKFY  626

Query  423  DWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVK  250
            + Y      + PN  +D  Q G    + + E++L+LEA ++R+ +E+  + +     R  
Sbjct  627  NSYSMVGIGKIPNSVEDIGQ-GLDARDPLAEKKLELEACQRRVDDEKLKHSKAIEVTRAM  685

Query  249  SLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
            +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  686  TLNNLQTGLPGMFQALTSFS---SLFIEALESV  715



>gb|KFK42583.1| hypothetical protein AALP_AA1G014300 [Arabis alpina]
Length=715

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/273 (32%), Positives = 142/273 (52%), Gaps = 17/273 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V 
Sbjct  454  PQLVELCHGLMYMWKSMHEYHEIQNNIVQQVRGLINQTERGESTSEVHRQVTRDLESAVS  513

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+E+I  L+ W KL+LVP+     +K       Q     AL   W+  
Sbjct  514  LWHSSFCRIIKFQREFISSLHAWFKLSLVPLSNEDPKK-------QRSDSFALCEEWKLS  566

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  400
            + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q
Sbjct  567  LERVPDTVASEAIKSFVNVVHVISIKQGEEVKMKKRTESAGKELEKKASSLRSIERKYYQ  626

Query  399  RRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL  235
              +    T   GP  +     + + E++ +L A ++++++E   +++     R  +L +L
Sbjct  627  AYS----TVGIGPGPETLDARDPLSEKKSELAACQRQVEDEVMRHVKAVEVTRAMTLNNL  682

Query  234  RTGLPELFHAMSEFSRACSIMYQTLESITHPLN  136
            +TGLP LF A++ FS   +   QT+ S ++ +N
Sbjct  683  QTGLPNLFQALTSFSSLFTDSLQTICSRSYSIN  715



>gb|KDP24001.1| hypothetical protein JCGZ_25389 [Jatropha curcas]
Length=624

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 129/262 (49%), Gaps = 11/262 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct  356  PQLLELVKGLMCMWRSMYEAHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVQQ  415

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + +   R     I ++   W   +
Sbjct  416  WHQSFCNLVKSQRDYIQSLTGWLRLSLFQFSKNPLSRTNQESR-----IYSICEEWHHAV  470

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF  V++ IV  Q +E K K + +   KE EK+  +      KY   
Sbjct  471  DRIPDKVASEGIKSFLTVIHAIVVQQAEEHKQKKKSESAFKEFEKKVSELRSLEIKYGPY  530

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
              P   +        + V E++ ++E L+ + +EE+  + +     R  +L +L+ G P 
Sbjct  531  SVPETSS---STRSKDPVAEKRAKVEILRAKAEEEKTKHEKSVSITRAMTLNNLQMGFPH  587

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            +F A+  FS  C    Q  ES+
Sbjct  588  VFQAIVGFSSVC---MQAFESV  606



>gb|KHN40553.1| hypothetical protein glysoja_001051 [Glycine soja]
Length=259

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 133/261 (51%), Gaps = 23/261 (9%)
 Frame = -1

Query  900  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  724
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  3    MWRSMHHYHEIQSNIVQQVRGLVNRSSRGDSTSELHRQATRDLESAVSAWHSSFCRLIKF  62

Query  723  QKEYIRGLNDWLKLNLVPI---DTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  553
            Q+++I  L+ W KL+LVP+   + N +E   + Q             W+  + ++PD +A
Sbjct  63   QRDFILSLHGWFKLSLVPVHNDNINSRETSDTYQ---------FFDEWKLALDRVPDTVA  113

Query  552  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  373
              AI SF  VV+ I   Q++E+K+K R +   KELEK+     +   K+    +    + 
Sbjct  114  SEAIKSFINVVHVISSKQVEELKIKKRTETASKELEKKASSLRNLERKFYSSYSMVGISL  173

Query  372  QDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  214
             D   ++  V+       E++L+L   ++R+++E   + +     R  +L +L+TGLP +
Sbjct  174  PDSAPDNGQVLDARDPLAEKKLELATCQRRVEDEMLRHSKAVEVTRAMTLNNLQTGLPGV  233

Query  213  FHAMSEFSRACSIMYQTLESI  151
            F A++ FS   S+  + LES+
Sbjct  234  FQALTSFS---SLFTEALESV  251



>ref|XP_010275436.1| PREDICTED: uncharacterized protein LOC104610494 [Nelumbo nucifera]
Length=756

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 134/258 (52%), Gaps = 9/258 (3%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  L   +  MW  M   HE Q  IV  +R L + +   + TSE H + T  L   V 
Sbjct  481  PQLVELCHGLMYMWRYMNQFHEIQYHIVQQVRGLVNQATKGESTSELHRQATRHLESTVS  540

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLN--LVPIDTNLKEKVSSPQRPQNPPILALLHAWQ  586
             WHS F +++ +Q++YIR L+ WLKL+  LV  D     K +S     N  +      W+
Sbjct  541  AWHSNFCRLVKYQRDYIRSLHGWLKLSYILVGDDNISGSKDASLAVQANSDLFTFCDEWK  600

Query  585  DLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFE-DW  418
              + +LPD +A  AI SF  VV+ IV  Q +E+K+K R +   K+LEK++   R  E  +
Sbjct  601  LALDRLPDTVASEAIKSFVNVVHAIVVKQTEEIKIKKRTETASKDLEKKSLALRNIEKKF  660

Query  417  YHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
            Y  Y        +   DG   D  + + E++L+L + ++R+++E   + +     R  +L
Sbjct  661  YLSYSMVGIAPPEGGSDGHVLDARDPLAEKKLELASCRRRVEDEMMKHAKAIEVTRAMTL  720

Query  243  TSLRTGLPELFHAMSEFS  190
             +++TGLP +F AM+ FS
Sbjct  721  NNIQTGLPGVFQAMTGFS  738



>ref|NP_001065395.1| Os10g0562700 [Oryza sativa Japonica Group]
 gb|AAK31266.1|AC079890_2 putative leucine zipper protein [Oryza sativa Japonica Group]
 gb|AAK01315.2| bZIP [Oryza sativa Indica Group]
 gb|AAK13058.1| bZIP protein [Oryza sativa]
 gb|AAP55028.1| bZIP, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27232.1| Os10g0562700 [Oryza sativa Japonica Group]
 gb|EAZ16987.1| hypothetical protein OsJ_32472 [Oryza sativa Japonica Group]
 dbj|BAH01606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=767

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 129/258 (50%), Gaps = 11/258 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L  ++  MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  
Sbjct  494  PQLVELCFALLSMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSA  553

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS F ++I +Q++YIR L  WLKL L  +D+N+ ++  +    +   +      W+  +
Sbjct  554  WHSNFNRLIKYQRDYIRALYGWLKLTLFQVDSNIPQEAYTSLISRE--LTTFCDEWKQAL  611

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LPD  A  AI SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q 
Sbjct  612  DRLPDASASEAIKSFVNVVHVIYTKQAEEMKIKKRTETYSKELEKKTNSLRAIEKKYYQS  671

Query  396  ---------RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
                      +  D  E       + + E++ ++   ++++++E   + +     R  +L
Sbjct  672  YSMVGLGLPGSGRDGIESHSFDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTL  731

Query  243  TSLRTGLPELFHAMSEFS  190
             +++TGLP +F A++ FS
Sbjct  732  NNIQTGLPGMFQAIAGFS  749



>ref|XP_010550476.1| PREDICTED: uncharacterized protein LOC104821337 [Tarenaya hassleriana]
Length=605

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 131/262 (50%), Gaps = 21/262 (8%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV+ +  MW +M   H+ Q  IV  L+ L+   S + TSE H + T +L + +Q 
Sbjct  357  PQLVHLVKGLMGMWRSMYESHQVQSHIVQQLKYLNTVPSTEPTSELHRQSTLRLELEIQR  416

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WH  F  ++  Q++YI+ L  WL+L+L     N   + SS  +     I +    WQ   
Sbjct  417  WHQSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLARGSSESK-----IYSFCEEWQLAA  471

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             ++PD++A   I SF A V+ IV  Q +E K K R +   K+ EK+  + ++   KY   
Sbjct  472  DRVPDKVAVEGIKSFMAAVHGIVVQQAEEHKQKKRSESVLKDFEKKAAELKEHGSKY---  528

Query  396  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  217
                      GP   + + E++ ++E LK + +EE+  Y +     R  ++++L+ G P 
Sbjct  529  ----------GPFSSDGLGEKRGKVERLKGKAEEEKNKYEQAVKVTRDMTVSNLKMGFPH  578

Query  216  LFHAMSEFSRACSIMYQTLESI  151
            L  AM  FS   S+  Q  ES+
Sbjct  579  LLQAMIGFS---SVSMQAFESV  597



>ref|XP_010089322.1| hypothetical protein L484_021854 [Morus notabilis]
 gb|EXB37647.1| hypothetical protein L484_021854 [Morus notabilis]
Length=851

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 134/258 (52%), Gaps = 14/258 (5%)
 Frame = -1

Query  900  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  724
            MW +M  +HE Q  IV  +R L + S   + TSE H + T  L   V  WHS F ++I  
Sbjct  592  MWRSMHQYHEIQNNIVQQVRGLVNQSTKGESTSELHRQATRDLESAVSAWHSSFCRLIKF  651

Query  723  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  544
            Q++++R L+ W KL L+P+D +     S+ +R     + A    W+  + ++PD +A  A
Sbjct  652  QRDFVRSLHGWFKLTLLPVDNDNVNMNSNRERSD---VYAFCDEWKLALERVPDTVASEA  708

Query  543  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDG  364
            I SF  VV+ I   Q +E+K+K R +   KELEK+         K+ Q  +       D 
Sbjct  709  IKSFINVVHVISFKQSEELKVKKRTESASKELEKKASSIRTLERKFYQSYSMVGIGLPDA  768

Query  363  PHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  205
              ++  V+       E++ +L A ++R+++E   + +     R  +L +L+TGLP +F A
Sbjct  769  GPDNGQVLDARDPLAEKKTELAACQRRVEDEMMRHAKAVEVTRAMTLNNLQTGLPGVFQA  828

Query  204  MSEFSRACSIMYQTLESI  151
            ++ FS   S+  + LES+
Sbjct  829  LTSFS---SLFTEALESV  843



>gb|EAY79532.1| hypothetical protein OsI_34661 [Oryza sativa Indica Group]
Length=767

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 129/258 (50%), Gaps = 11/258 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L  ++  MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  
Sbjct  494  PQLVELCFALLSMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSA  553

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS F ++I +Q++YIR L  WLKL L  +D+N+ ++  +    +   +      W+  +
Sbjct  554  WHSNFNRLIKYQRDYIRALYGWLKLTLFQVDSNIPQEAYTSLISRE--LTTFCDEWKQAL  611

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LPD  A  AI SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q 
Sbjct  612  DRLPDASASEAIKSFVNVVHVIYTKQAEEMKIKKRTETYSKELEKKTNSLRAIEKKYYQS  671

Query  396  ---------RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
                      +  D  E       + + E++ ++   ++++++E   + +     R  +L
Sbjct  672  YSMVGLGLPGSGRDGIESHSFDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTL  731

Query  243  TSLRTGLPELFHAMSEFS  190
             +++TGLP +F A++ FS
Sbjct  732  NNIQTGLPGMFQAIAGFS  749



>ref|XP_009373242.1| PREDICTED: uncharacterized protein LOC103962279 [Pyrus x bretschneideri]
Length=438

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 143/271 (53%), Gaps = 17/271 (6%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVV  763
            P+L  L      MW +M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V
Sbjct  168  PQLVELCHGFMYMWRSMHQYHEVQNDIVQQVRGL-VNQSAKGDSTSELHRQATRDLESAV  226

Query  762  QEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD  583
              WHS F ++I  ++++IR ++ W KL L+P++ ++   V +    ++  + +    W+ 
Sbjct  227  SAWHSSFCRLIKFKRDFIRSVHGWFKLTLLPVNNDMTFNVHN----ESSDVYSFCDEWKL  282

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WY  415
             + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   +ELEK+     +    +Y
Sbjct  283  ALERVPDTVASEAINSFINVVHVISLKQSEELKIKKRTETASRELEKKASSLRNIEKKFY  342

Query  414  HKY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
            H Y M      D   ++G   D  + + E++ +L   ++R+++E   + +     R  +L
Sbjct  343  HSYSMVGIGLPDSGPENGQVLDARDPLAEKKSELTTCQRRVEDEMMRHTKAVEVTRAMTL  402

Query  243  TSLRTGLPELFHAMSEFSRACSIMYQTLESI  151
             +L+TGLP +F A++ FS    +  + LES+
Sbjct  403  NNLQTGLPGVFQALTSFS---GLFTEALESV  430



>ref|XP_002467482.1| hypothetical protein SORBIDRAFT_01g028920 [Sorghum bicolor]
 gb|EER94480.1| hypothetical protein SORBIDRAFT_01g028920 [Sorghum bicolor]
Length=785

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 130/258 (50%), Gaps = 11/258 (4%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L  ++  MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  
Sbjct  512  PQLVQLCFALLGMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVAA  571

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS F ++I +Q++YIR L  WLKL L  +D ++ ++  +    +   + +    W+  +
Sbjct  572  WHSNFNRLIKYQRDYIRSLYGWLKLTLCQVDNSVPQEAHASMISRE--LTSFCDEWKQAL  629

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LPD +A  AI SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q 
Sbjct  630  DRLPDAVASEAIKSFVNVVHVIYTKQAEEMKIKKRTETLSKELEKKTNSLRSIEKKYYQS  689

Query  396  ---------RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL  244
                      +  D  E       + + E++ ++   ++++++E   + +     R  +L
Sbjct  690  YSMVGLGLPGSGRDGIESHAYDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTL  749

Query  243  TSLRTGLPELFHAMSEFS  190
             +++TGLP +F A++ FS
Sbjct  750  NNIQTGLPGIFQAIAGFS  767



>ref|XP_011032057.1| PREDICTED: uncharacterized protein LOC105131006 [Populus euphratica]
Length=790

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 140/270 (52%), Gaps = 19/270 (7%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVV  763
            P+L  L      MW +M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V
Sbjct  520  PQLVELCHGFMYMWRSMHQYHEVQNHIVQQVRGL-VNQSAKGDSTSELHKQATRDLESAV  578

Query  762  QEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD  583
              WHS F  +I  Q+++I+ ++ W KL L+P+ +   + +++   P +  + A    W+ 
Sbjct  579  SAWHSSFCHLIKFQRDFIQSIHGWFKLTLIPVSS---DNMNANMEPSD--VYAFFDEWKL  633

Query  582  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WY  415
             I ++PD +A  AI SF  VV+ I   Q +E+K+K R     KELEK+          +Y
Sbjct  634  AIDRVPDTVASEAIKSFINVVHVISTKQTEELKIKKRTDTASKELEKKASSLRSLERKFY  693

Query  414  HKY--MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKS  247
            H Y  +    P+     +G   D  + + E++ +L A ++R+++E   + +     R  +
Sbjct  694  HSYSMVGIGLPDTGGSDNGQFLDARDPLAEKKSELVACQRRVEDEMLRHAKAVEVTRAMT  753

Query  246  LTSLRTGLPELFHAMSEFSRACSIMYQTLE  157
            L +L+TGLP +F A++ FS   S+  + LE
Sbjct  754  LNNLQTGLPGVFQALTSFS---SLFMEALE  780



>ref|XP_007052313.1| BZIP domain class transcription factor [Theobroma cacao]
 gb|EOX96470.1| BZIP domain class transcription factor [Theobroma cacao]
Length=823

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 130/257 (51%), Gaps = 13/257 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ  760
            P+L  +      MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V 
Sbjct  554  PQLVDICHGFRYMWGSMHQYHEVQNNIVQQVRGLINRSGKGDSTSELHRQATRDLESAVS  613

Query  759  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL  580
             WHS F ++I  Q+++I  L+ W KL L+P+     + V   + P +  + A    W+  
Sbjct  614  AWHSSFCRLIKFQRDFIHSLHGWFKLTLLPVSN---DNVDGNREPSD--VFAFCDEWKLA  668

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYH  412
            + ++PD +A  AI SF  VVN I   Q +E+K+K R +   KELEK+     +    +YH
Sbjct  669  LDRVPDTVASEAIKSFINVVNVISVKQTEELKIKKRTETVSKELEKKASSLRNIERKFYH  728

Query  411  KYMQRRTPNDDTEQD-GPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT  241
             Y        D+  D G   D  + + E++ +L   ++R+++E   + +     R  +L 
Sbjct  729  SYSMVGIGLPDSGPDHGQVLDARDPLAEKKSELAGCQRRVEDEMLRHAKAVEVTRAMTLN  788

Query  240  SLRTGLPELFHAMSEFS  190
            +L+TGLP +F AM+ FS
Sbjct  789  NLQTGLPGVFQAMTSFS  805



>ref|XP_008643472.1| PREDICTED: uncharacterized protein LOC100381684 isoform X1 [Zea 
mays]
 tpg|DAA46309.1| TPA: hypothetical protein ZEAMMB73_743906 [Zea mays]
Length=779

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 133/259 (51%), Gaps = 12/259 (5%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  L  ++  MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  
Sbjct  505  PQLVQLCFALLGMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVAA  564

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI  577
            WHS F ++I +Q++YIR L  WLKL L  +D+++ ++V +    +   + +    W+  +
Sbjct  565  WHSNFNRLIKYQRDYIRSLYGWLKLTLCQVDSSVPQEVHASMISRE--LTSFCDEWKQAL  622

Query  576  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR  397
             +LPD +A  AI SF  VV+ I   Q +EMK+K R +   KELEK+         KY Q 
Sbjct  623  DRLPDAVASEAIKSFVNVVHVIYTKQAEEMKIKKRAETYSKELEKKANSLRSIEKKYYQS  682

Query  396  ---------RTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKS  247
                      +  D  E    ++  + + E++ ++   ++++++E   + +     R  +
Sbjct  683  YSMVGLGLPGSGRDGIESHAAYDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMT  742

Query  246  LTSLRTGLPELFHAMSEFS  190
            L +++TGLP +F A++ FS
Sbjct  743  LNNIQTGLPGIFQAIAGFS  761



>gb|EMT28305.1| hypothetical protein F775_06020 [Aegilops tauschii]
Length=557

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 138/291 (47%), Gaps = 31/291 (11%)
 Frame = -1

Query  936  PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE  757
            P+L  LV  +  MW  M   H+ Q  +V  L  L MS SP  TS  H +   QL + V  
Sbjct  266  PQLLELVAGLMSMWRGMYECHQVQTHMVQQLEYLTMSTSP--TSNDHRQAALQLEIEVDR  323

Query  756  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTN-LKEKVSSPQRPQNPPILALLHAWQDL  580
            W+S F  ++  Q++Y+  L  WL+L+L     N L + +      QN  I +L   WQ  
Sbjct  324  WYSAFCSLVKSQRDYVYSLTGWLRLSLFQCLHNPLMKDI------QNSDIYSLCEEWQLA  377

Query  579  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHK  409
            I ++PD++A   I +  +V++ +V  Q +E K K R     K+ EK+T   R  E  Y  
Sbjct  378  IDRIPDKVASEGIKTLLSVIHAVVVQQAEEQKQKKRSDAAFKDFEKKTEELRSLESKYGP  437

Query  408  Y-------MQRRTPNDDTEQD---GPHEDNN---------VIERQLQLEALKQRLKEEEE  286
            Y       M R+TP  +       GP+             V E++ ++EAL+ R  +E+ 
Sbjct  438  YSAEGYGEMTRKTPVAEKRAKSKYGPYSAEGYGEMTRKTPVAEKRAKVEALRSRADDEKT  497

Query  285  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  133
             + +     R  +L +L+TG P +F AM+ F+  C   ++++ +     +R
Sbjct  498  KHEKSVGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKRSSDR  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2143947116585