BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052I01

Length=906
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN64859.1|  hypothetical protein VITISV_030494                     131   6e-33   Vitis vinifera
ref|XP_002278435.1|  PREDICTED: uncharacterized protein LOC100245741    131   7e-33   Vitis vinifera
ref|NP_001237965.1|  uncharacterized protein LOC100527566               130   3e-32   Glycine max [soybeans]
gb|KHN29132.1|  hypothetical protein glysoja_008467                     129   3e-32   Glycine soja [wild soybean]
ref|XP_003525093.1|  PREDICTED: uncharacterized protein LOC100815955    127   2e-31   Glycine max [soybeans]
gb|ACU24594.1|  unknown                                                 125   9e-31   Glycine max [soybeans]
ref|XP_003630138.1|  hypothetical protein MTR_8g092210                  122   2e-29   Medicago truncatula
ref|XP_008237488.1|  PREDICTED: uncharacterized protein LOC103336223    121   4e-29   Prunus mume [ume]
ref|XP_008386362.1|  PREDICTED: uncharacterized protein LOC103448885    120   9e-29   Malus domestica [apple tree]
gb|AFK49616.1|  unknown                                                 120   1e-28   Medicago truncatula
ref|XP_007048173.1|  Uncharacterized protein isoform 1                  119   2e-28   
ref|XP_007019592.1|  Uncharacterized protein TCM_035706                 119   2e-28   
ref|XP_010261019.1|  PREDICTED: uncharacterized protein LOC104599958    118   6e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009335132.1|  PREDICTED: uncharacterized protein LOC103927893    118   7e-28   Pyrus x bretschneideri [bai li]
ref|XP_004503996.1|  PREDICTED: uncharacterized protein LOC101509322    117   8e-28   Cicer arietinum [garbanzo]
ref|XP_010268579.1|  PREDICTED: uncharacterized protein LOC104605493    115   9e-27   Nelumbo nucifera [Indian lotus]
ref|XP_011100069.1|  PREDICTED: uncharacterized protein LOC105178309    114   2e-26   Sesamum indicum [beniseed]
gb|KJB28968.1|  hypothetical protein B456_005G077300                    113   4e-26   Gossypium raimondii
gb|KJB59481.1|  hypothetical protein B456_009G258500                    113   4e-26   Gossypium raimondii
gb|KJB59480.1|  hypothetical protein B456_009G258500                    113   7e-26   Gossypium raimondii
gb|KHG14904.1|  hypothetical protein F383_02753                         112   1e-25   Gossypium arboreum [tree cotton]
gb|AFK43213.1|  unknown                                                 111   2e-25   Lotus japonicus
gb|AFK36877.1|  unknown                                                 111   2e-25   Lotus japonicus
gb|KHG17592.1|  Nuclear receptor subfamily 2 group C member 2           110   4e-25   Gossypium arboreum [tree cotton]
ref|XP_009336494.1|  PREDICTED: uncharacterized protein LOC103929073    109   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_008381858.1|  PREDICTED: uncharacterized protein LOC103444684    109   9e-25   Malus domestica [apple tree]
ref|XP_007048174.1|  Uncharacterized protein isoform 2                  108   3e-24   
gb|KDO57106.1|  hypothetical protein CISIN_1g048552mg                   105   2e-23   Citrus sinensis [apfelsine]
ref|XP_003634526.1|  PREDICTED: uncharacterized protein LOC100854952    105   2e-23   Vitis vinifera
ref|XP_006427929.1|  hypothetical protein CICLE_v10026489mg             105   2e-23   Citrus clementina [clementine]
ref|XP_007159785.1|  hypothetical protein PHAVU_002G267000g             104   8e-23   Phaseolus vulgaris [French bean]
emb|CDP11436.1|  unnamed protein product                                103   1e-22   Coffea canephora [robusta coffee]
ref|XP_002307513.2|  hypothetical protein POPTR_0005s21820g             100   2e-22   
ref|XP_008786494.1|  PREDICTED: uncharacterized protein LOC103704817    102   3e-22   Phoenix dactylifera
ref|XP_010096477.1|  hypothetical protein L484_006724                   102   4e-22   Morus notabilis
ref|NP_001291356.1|  uncharacterized protein LOC105049617               100   1e-21   Elaeis guineensis
ref|XP_006473103.1|  PREDICTED: uncharacterized protein LOC102626479  99.4    4e-21   Citrus sinensis [apfelsine]
gb|KDO83805.1|  hypothetical protein CISIN_1g028515mg                 99.4    4e-21   Citrus sinensis [apfelsine]
gb|KJB18359.1|  hypothetical protein B456_003G048500                  99.0    5e-21   Gossypium raimondii
gb|KJB18360.1|  hypothetical protein B456_003G048500                  99.0    6e-21   Gossypium raimondii
ref|XP_007048172.1|  Uncharacterized protein TCM_001288               97.8    1e-20   Theobroma cacao [chocolate]
ref|XP_006361614.1|  PREDICTED: uncharacterized protein LOC102606378  97.8    1e-20   Solanum tuberosum [potatoes]
ref|XP_008776936.1|  PREDICTED: uncharacterized protein LOC103696971  97.4    2e-20   Phoenix dactylifera
ref|XP_011044272.1|  PREDICTED: uncharacterized protein LOC105139508  95.9    5e-20   Populus euphratica
gb|KHG16765.1|  hypothetical protein F383_20843                       95.9    6e-20   Gossypium arboreum [tree cotton]
ref|XP_008808717.1|  PREDICTED: uncharacterized protein LOC103720668  95.5    9e-20   Phoenix dactylifera
gb|KJB14930.1|  hypothetical protein B456_002G149700                  95.1    1e-19   Gossypium raimondii
ref|XP_004252568.1|  PREDICTED: uncharacterized protein LOC101258927  95.1    1e-19   Solanum lycopersicum
gb|KGN44465.1|  hypothetical protein Csa_7G298810                     93.2    2e-19   Cucumis sativus [cucumbers]
ref|XP_006434518.1|  hypothetical protein CICLE_v10002494mg           93.6    4e-19   Citrus clementina [clementine]
ref|XP_006359041.1|  PREDICTED: uncharacterized protein LOC102584007  93.6    4e-19   Solanum tuberosum [potatoes]
gb|KHN41306.1|  hypothetical protein glysoja_030144                   91.7    7e-19   Glycine soja [wild soybean]
ref|XP_010027746.1|  PREDICTED: uncharacterized protein LOC104418182  92.4    9e-19   Eucalyptus grandis [rose gum]
gb|KHG16766.1|  putative G-protein coupled receptor                   92.4    1e-18   Gossypium arboreum [tree cotton]
ref|XP_003548092.1|  PREDICTED: uncharacterized protein LOC100793841  92.0    1e-18   Glycine max [soybeans]
ref|XP_002524331.1|  conserved hypothetical protein                   92.0    1e-18   Ricinus communis
ref|XP_004139686.1|  PREDICTED: uncharacterized protein LOC101216474  92.0    1e-18   Cucumis sativus [cucumbers]
gb|KJB14929.1|  hypothetical protein B456_002G149700                  91.3    2e-18   Gossypium raimondii
gb|KJB18358.1|  hypothetical protein B456_003G048400                  91.7    2e-18   Gossypium raimondii
ref|XP_008461917.1|  PREDICTED: uncharacterized protein LOC103500405  91.7    2e-18   Cucumis melo [Oriental melon]
ref|XP_010925082.1|  PREDICTED: uncharacterized protein LOC105047727  91.3    3e-18   Elaeis guineensis
gb|KCW54334.1|  hypothetical protein EUGRSUZ_I00298                   92.4    3e-18   Eucalyptus grandis [rose gum]
ref|XP_007200578.1|  hypothetical protein PRUPE_ppa011863mg           90.1    5e-18   
ref|XP_011458474.1|  PREDICTED: uncharacterized protein LOC101309208  90.1    5e-18   Fragaria vesca subsp. vesca
ref|XP_010097650.1|  hypothetical protein L484_023790                 90.5    6e-18   
gb|AFK42100.1|  unknown                                               89.7    8e-18   Lotus japonicus
gb|EYU24058.1|  hypothetical protein MIMGU_mgv1a012421mg              90.5    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_010925339.1|  PREDICTED: uncharacterized protein LOC105047906  89.4    1e-17   Elaeis guineensis
ref|XP_009401877.1|  PREDICTED: uncharacterized protein LOC103985...  88.2    2e-17   
ref|XP_011100916.1|  PREDICTED: uncharacterized protein LOC105179031  88.6    2e-17   Sesamum indicum [beniseed]
ref|XP_009401860.1|  PREDICTED: uncharacterized protein LOC103985...  88.6    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN00739.1|  hypothetical protein glysoja_000407                   87.8    4e-17   Glycine soja [wild soybean]
ref|XP_009392917.1|  PREDICTED: uncharacterized protein LOC103978735  87.0    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011042891.1|  PREDICTED: uncharacterized protein LOC105138502  86.3    1e-16   Populus euphratica
ref|XP_002300905.2|  hypothetical protein POPTR_0002s06540g           85.1    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009761480.1|  PREDICTED: uncharacterized protein LOC104213649  84.7    4e-16   Nicotiana sylvestris
ref|XP_009782198.1|  PREDICTED: uncharacterized protein LOC104230978  84.3    7e-16   Nicotiana sylvestris
ref|XP_009610488.1|  PREDICTED: uncharacterized protein LOC104104...  84.0    7e-16   Nicotiana tomentosiformis
ref|NP_001242150.1|  uncharacterized protein LOC100796484             84.0    8e-16   
ref|XP_010681253.1|  PREDICTED: uncharacterized protein LOC104896...  83.6    1e-15   
ref|XP_010915065.1|  PREDICTED: uncharacterized protein LOC105040293  83.2    1e-15   Elaeis guineensis
ref|XP_007151974.1|  hypothetical protein PHAVU_004G091100g           80.9    2e-15   Phaseolus vulgaris [French bean]
ref|XP_009631427.1|  PREDICTED: uncharacterized protein LOC104121198  82.8    2e-15   Nicotiana tomentosiformis
ref|XP_009610487.1|  PREDICTED: uncharacterized protein LOC104104...  82.4    4e-15   Nicotiana tomentosiformis
ref|XP_010681257.1|  PREDICTED: uncharacterized protein LOC104896...  81.6    5e-15   
ref|XP_009389481.1|  PREDICTED: uncharacterized protein LOC103976031  81.6    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412399.1|  PREDICTED: uncharacterized protein LOC103993894  81.3    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010681250.1|  PREDICTED: uncharacterized protein LOC104896...  81.3    8e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003592057.1|  hypothetical protein MTR_1g098250                79.0    4e-14   Medicago truncatula
ref|XP_004237831.1|  PREDICTED: uncharacterized protein LOC101255194  79.0    4e-14   Solanum lycopersicum
gb|KJB63416.1|  hypothetical protein B456_010G211200                  75.5    1e-13   Gossypium raimondii
ref|XP_003592516.1|  hypothetical protein MTR_1g106890                76.3    3e-13   
ref|XP_003592515.1|  hypothetical protein MTR_1g106890                76.3    3e-13   
gb|EPS64635.1|  hypothetical protein M569_10142                       76.3    4e-13   Genlisea aurea
gb|KDP36560.1|  hypothetical protein JCGZ_08327                       75.9    5e-13   Jatropha curcas
gb|EYU31112.1|  hypothetical protein MIMGU_mgv1a014609mg              74.7    9e-13   Erythranthe guttata [common monkey flower]
gb|ABK22079.1|  unknown                                               73.2    1e-11   Picea sitchensis
ref|XP_002460104.1|  hypothetical protein SORBIDRAFT_02g022820        68.9    1e-10   Sorghum bicolor [broomcorn]
ref|XP_004956648.1|  PREDICTED: uncharacterized protein LOC101777921  67.8    4e-10   Setaria italica
ref|XP_008793512.1|  PREDICTED: uncharacterized protein LOC103709793  67.8    4e-10   
ref|XP_009388166.1|  PREDICTED: uncharacterized protein LOC103974984  67.4    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK32043.1|  hypothetical protein AALP_AA6G192700                  67.4    5e-10   Arabis alpina [alpine rockcress]
ref|NP_001152515.1|  holocarboxylase synthetase                       67.4    5e-10   Zea mays [maize]
ref|XP_010421889.1|  PREDICTED: uncharacterized protein LOC104707271  67.0    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004489928.1|  PREDICTED: uncharacterized protein LOC101504971  66.2    1e-09   Cicer arietinum [garbanzo]
gb|ACG48000.1|  holocarboxylase synthetase                            65.9    1e-09   Zea mays [maize]
ref|XP_010530126.1|  PREDICTED: uncharacterized protein LOC104806765  65.9    1e-09   Tarenaya hassleriana [spider flower]
gb|KHN46391.1|  hypothetical protein glysoja_031709                   65.1    2e-09   Glycine soja [wild soybean]
ref|XP_006606909.1|  PREDICTED: uncharacterized protein LOC100778513  65.5    2e-09   
ref|XP_009113575.1|  PREDICTED: uncharacterized protein LOC103838878  65.5    2e-09   Brassica rapa
ref|XP_006397139.1|  hypothetical protein EUTSA_v10028989mg           65.1    3e-09   Eutrema salsugineum [saltwater cress]
ref|NP_001149250.1|  holocarboxylase synthetase                       64.3    3e-09   Zea mays [maize]
ref|XP_003574456.1|  PREDICTED: uncharacterized protein LOC100833414  65.1    3e-09   Brachypodium distachyon [annual false brome]
gb|ACR36431.1|  unknown                                               64.7    4e-09   Zea mays [maize]
ref|XP_007143574.1|  hypothetical protein PHAVU_007G083200g           64.7    5e-09   Phaseolus vulgaris [French bean]
ref|XP_009407273.1|  PREDICTED: uncharacterized protein LOC103990001  64.7    5e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004969043.1|  PREDICTED: uncharacterized protein LOC101785264  64.3    6e-09   Setaria italica
ref|XP_002872465.1|  hypothetical protein ARALYDRAFT_352054           63.9    6e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_009380423.1|  PREDICTED: uncharacterized protein LOC103968822  64.3    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS62206.1|  hypothetical protein TRIUR3_09092                     64.3    8e-09   Triticum urartu
gb|AEX12503.1|  hypothetical protein 2_4391_01                        60.8    4e-08   Pinus taeda
emb|CDX99511.1|  BnaC09g24810D                                        61.2    6e-08   
ref|XP_010238083.1|  PREDICTED: uncharacterized protein LOC104584661  61.2    7e-08   Brachypodium distachyon [annual false brome]
ref|XP_006660563.1|  PREDICTED: uncharacterized protein LOC102719228  61.2    7e-08   Oryza brachyantha
gb|AFK38910.1|  unknown                                               60.8    8e-08   Medicago truncatula
ref|XP_010455374.1|  PREDICTED: uncharacterized protein LOC104736976  60.1    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010437962.1|  PREDICTED: uncharacterized protein LOC104721627  60.1    2e-07   Camelina sativa [gold-of-pleasure]
emb|CDY60294.1|  BnaC03g72860D                                        58.9    2e-07   Brassica napus [oilseed rape]
gb|AEX12507.1|  hypothetical protein 2_4391_01                        58.9    2e-07   Pinus taeda
ref|XP_010542952.1|  PREDICTED: uncharacterized protein LOC104815997  59.3    3e-07   Tarenaya hassleriana [spider flower]
gb|EEE54897.1|  hypothetical protein OsJ_02417                        58.2    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062977.1|  Os09g0360400                                     59.3    3e-07   
ref|NP_001043444.2|  Os01g0589500                                     58.9    1e-06   
dbj|BAB89033.1|  putative holocarboxylase synthetase                  58.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KJB40433.1|  hypothetical protein B456_007G063000                  57.4    1e-06   Gossypium raimondii
gb|EAY74747.1|  hypothetical protein OsI_02639                        58.2    1e-06   Oryza sativa Indica Group [Indian rice]
gb|AAM62508.1|  unknown                                               57.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288727.1|  hypothetical protein CARUB_v10002038mg           57.4    1e-06   Capsella rubella
ref|NP_192721.1|  uncharacterized protein                             57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17036.1|  hypothetical protein glysoja_011510                   57.8    2e-06   Glycine soja [wild soybean]
dbj|BAJ85416.1|  predicted protein                                    57.8    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX86890.1|  BnaA09g22800D                                        57.0    2e-06   
ref|XP_002458073.1|  hypothetical protein SORBIDRAFT_03g026490        57.0    2e-06   Sorghum bicolor [broomcorn]
gb|EAZ06899.1|  hypothetical protein OsI_29138                        56.6    3e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001242256.1|  uncharacterized protein LOC100801119             56.6    3e-06   
gb|KHG24783.1|  hypothetical protein F383_09417                       56.2    4e-06   Gossypium arboreum [tree cotton]
ref|XP_003569287.1|  PREDICTED: uncharacterized protein LOC100830936  55.8    6e-06   Brachypodium distachyon [annual false brome]
gb|EMS60900.1|  hypothetical protein TRIUR3_28509                     55.1    6e-06   Triticum urartu
gb|EMT31658.1|  hypothetical protein F775_32794                       55.1    9e-06   
gb|AAP80657.1|AF479038_1  holocarboxylase synthetase                  55.1    1e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644324.1|  PREDICTED: uncharacterized protein LOC102720747  54.7    1e-05   Oryza brachyantha
ref|XP_006826290.1|  hypothetical protein AMTR_s00004p00061310        54.7    1e-05   Amborella trichopoda
ref|XP_003567792.1|  PREDICTED: uncharacterized protein LOC100842848  53.9    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_006660106.1|  PREDICTED: uncharacterized protein LOC102709021  54.3    3e-05   Oryza brachyantha
dbj|BAC99427.1|  putative holocarboxylase synthetase                  53.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009134168.1|  PREDICTED: uncharacterized protein LOC103858542  50.8    3e-04   Brassica rapa
ref|NP_001061741.1|  Os08g0397900                                     50.4    4e-04   
emb|CDY05080.1|  BnaC03g28780D                                        49.7    7e-04   
ref|NP_001136541.1|  hypothetical protein                             49.3    9e-04   Zea mays [maize]



>emb|CAN64859.1| hypothetical protein VITISV_030494 [Vitis vinifera]
Length=212

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAP-Q  635
            T D   +L   NEL+YG E+ P SPR   Q Q  Q TMH+ N G PV+ N F   SA   
Sbjct  72   TVDIVAYLQ--NELEYGVEDAPVSPRLPLQHQHTQTTMHMTNSGAPVSSNSFGHPSAVGT  129

Query  634  GLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQS  455
            GLR G+ D QPK++VFSNALSSP+R SLQ+YHLAQGSY  NN MPS  G +N++T   Q+
Sbjct  130  GLRFGNIDQQPKNNVFSNALSSPVRRSLQNYHLAQGSYYSNNVMPSGNGPRNSET---QT  186

Query  454  RDANPPNSSDTLMDMHSDTPDHEFPY  377
            RD NPP+S+D+ MDMH+D+P HE  Y
Sbjct  187  RDXNPPSSNDSSMDMHADSPGHESSY  212



>ref|XP_002278435.1| PREDICTED: uncharacterized protein LOC100245741 [Vitis vinifera]
 emb|CBI21544.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAP-Q  635
            T D   +L   NEL+YG E+ P SPR   Q Q  Q TMH+ N G PV+ N F   SA   
Sbjct  72   TVDIVAYLQ--NELEYGVEDAPVSPRLPLQHQHTQTTMHMTNSGAPVSSNSFGHPSAVGT  129

Query  634  GLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQS  455
            GLR G+ D QPK++VFSNALSSP+R SLQ+YHLAQGSY  NN MPS  G +N++T   Q+
Sbjct  130  GLRFGNIDQQPKNNVFSNALSSPVRRSLQNYHLAQGSYYSNNVMPSGNGPRNSET---QT  186

Query  454  RDANPPNSSDTLMDMHSDTPDHEFPY  377
            RD NPP+S+D+ MDMH+D+P HE  Y
Sbjct  187  RDLNPPSSNDSSMDMHADSPGHESSY  212



>ref|NP_001237965.1| uncharacterized protein LOC100527566 [Glycine max]
 gb|ACU16664.1| unknown [Glycine max]
Length=215

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 92/147 (63%), Gaps = 5/147 (3%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YG EE P SPR    +Q  Q  MH  N G  +  N F    A QG
Sbjct  72   TIDIVTHLQ--NELEYGGEEAPVSPRQPMHQQNSQTAMHNTNFGASIPSNAFGATVAGQG  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+G  D QPK+SVFSNALSSPIR SLQ YHLAQGS+P  N M S  G +N+D  Y   Q
Sbjct  130  IRAGQPDQQPKNSVFSNALSSPIRRSLQPYHLAQGSFPSCNIMSSGNGTRNSDMTYPNGQ  189

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NSSD  MDMHSD+P H+F Y
Sbjct  190  NRDTNSSNSSD-CMDMHSDSPGHDFSY  215



>gb|KHN29132.1| hypothetical protein glysoja_008467 [Glycine soja]
Length=215

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 92/147 (63%), Gaps = 5/147 (3%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YG EE P SPR    +   Q  MH  N G  +  N F    A QG
Sbjct  72   TIDIVTHLQ--NELEYGGEEAPVSPRQPMHQHNSQTAMHNTNFGASIPSNAFGATVAGQG  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+GH D QPK+SVFSNALSSPIR SLQ YHLAQGS+P  N M S  G +N+D  Y   Q
Sbjct  130  IRAGHPDQQPKNSVFSNALSSPIRRSLQPYHLAQGSFPSCNIMSSGNGTRNSDMTYPNGQ  189

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NSSD  MDMHSD+P H+F Y
Sbjct  190  NRDTNSSNSSD-CMDMHSDSPGHDFSY  215



>ref|XP_003525093.1| PREDICTED: uncharacterized protein LOC100815955 [Glycine max]
 gb|KHN34025.1| hypothetical protein glysoja_030479 [Glycine soja]
Length=215

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 90/147 (61%), Gaps = 5/147 (3%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+Y  EE P SPR    +Q     MH  N G  +  N F    A QG
Sbjct  72   TIDIVTHLQ--NELEYAGEEAPVSPRQPMHQQNSHTAMHNTNFGASIPSNAFGATVAGQG  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--Q  458
            +R+G  D QPK+SVFSNALSSPIR SLQ YHLAQGS+P  N M S  G +N+D  Y   Q
Sbjct  130  IRAGQPDQQPKNSVFSNALSSPIRRSLQPYHLAQGSFPSGNIMSSGNGTRNSDMTYANGQ  189

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NSSD  MDMHSD+P H+F Y
Sbjct  190  NRDTNSSNSSD-CMDMHSDSPGHDFSY  215



>gb|ACU24594.1| unknown [Glycine max]
Length=215

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 89/147 (61%), Gaps = 5/147 (3%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+Y  EE P SPR    +Q     MH  N G  +  N F    A QG
Sbjct  72   TIDIVTHLQ--NELEYAGEEAPVSPRQPMHQQNSHTAMHNTNFGASIPSNAFGATVAGQG  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--Q  458
            +R+G  D QPK+SVFSNALSSPIR SLQ YHLAQGS+P  N M S  G +N+D  Y   Q
Sbjct  130  IRAGQPDQQPKNSVFSNALSSPIRRSLQPYHLAQGSFPSGNIMSSGNGTRNSDMTYANGQ  189

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NS D  MDMHSD+P H+F Y
Sbjct  190  NRDTNSSNSRD-CMDMHSDSPGHDFSY  215



>ref|XP_003630138.1| hypothetical protein MTR_8g092210 [Medicago truncatula]
 gb|AET04614.1| holocarboxylase synthetase [Medicago truncatula]
Length=212

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 91/147 (62%), Gaps = 8/147 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YGAEE+P SPR S Q Q  Q  +         +        A QG
Sbjct  72   TIDIVSHLQ--NELEYGAEESPVSPRQSIQ-QNSQTAIQTNFAASIPSNAFGSTV-AGQG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+G +D Q K+SVFSNALSSPIR SLQ YHLAQGS P +N M S  G +NN+  Y   Q
Sbjct  128  IRTGQTD-QVKNSVFSNALSSPIRRSLQPYHLAQGSNPSSNVMSSGNGTRNNEMVYPSGQ  186

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NSSD  MDMH+D+P H+FPY
Sbjct  187  NRDTNSSNSSD-CMDMHADSPGHDFPY  212



>ref|XP_008237488.1| PREDICTED: uncharacterized protein LOC103336223 [Prunus mume]
Length=216

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPT-SPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L NELDY  EE P+ SPR   Q Q  Q T+H  N GFPV+     P +  QG+RS   DH
Sbjct  79   LQNELDYCGEEQPSMSPRVPLQHQHLQPTVHFTNSGFPVSSGSSGPTNTGQGIRSEQCDH  138

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNS  431
            Q K+SVFSNALSSP+R SLQHYH++Q  Y P   +PS  G +NN+  +L  +RDANPP+S
Sbjct  139  QSKNSVFSNALSSPVRQSLQHYHISQDGYYPGAGLPSGNGARNNEPSFLHPNRDANPPSS  198

Query  430  SDTLMDMHSDTPDHEFPY  377
            +DT MDMH+D+P H+  Y
Sbjct  199  NDTSMDMHADSPGHDSTY  216



>ref|XP_008386362.1| PREDICTED: uncharacterized protein LOC103448885 [Malus domestica]
Length=215

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  EE   SPR   Q Q  Q T H  N G PV      P +  QG+RS   DHQ
Sbjct  79   LQNELDYCGEEPSMSPRLPLQHQHLQPTAHFSNSGLPVTSGSSGPTNTGQGIRSEQCDHQ  138

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNSS  428
             K+SVFSNALSSP+R SLQHYH++Q  Y P   +PS  G +NN+  +L  +RDANPP+S+
Sbjct  139  SKNSVFSNALSSPVRQSLQHYHISQDGYYPGAVLPSGNGARNNEPSFLHPNRDANPPSSN  198

Query  427  DTLMDMHSDTPDHEFPY  377
            DT MDMH+D+P H+  Y
Sbjct  199  DTSMDMHADSPGHDSTY  215



>gb|AFK49616.1| unknown [Medicago truncatula]
Length=212

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 90/147 (61%), Gaps = 8/147 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YGAEE+P SPR S Q Q  Q  +         +        A QG
Sbjct  72   TIDIVSHLQ--NELEYGAEESPVSPRQSIQ-QNSQTAIQTNFAASIPSNAFGSTV-AGQG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+G +D Q K+SVFSNALSSPIR SLQ YHLAQGS P +N M S  G +NN+  Y   Q
Sbjct  128  IRTGQTD-QVKNSVFSNALSSPIRRSLQPYHLAQGSNPSSNVMSSGNGTRNNEMVYPSGQ  186

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NS D  MDMH+D+P H+FPY
Sbjct  187  NRDTNSSNSGD-CMDMHADSPGHDFPY  212



>ref|XP_007048173.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92330.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=213

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 94/147 (64%), Gaps = 7/147 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NEL+YG EE P SPR   Q    Q    L N   P++ NPF  A   QG
Sbjct  72   TVDVVAYLQ--NELEYGGEEPPMSPRLPLQHPHSQTATQLNNLVGPISSNPFSSAMVGQG  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +RSG  D+Q K+SVFSNALSSP+R SLQHYHLAQG Y  NN + S  G +NN++ Y   Q
Sbjct  130  VRSG--DNQGKNSVFSNALSSPVRRSLQHYHLAQGGYNSNNVLSSVNGQRNNESNYSHQQ  187

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RDAN P+S+D+ MDMH D+P H F Y
Sbjct  188  NRDANSPSSNDS-MDMHGDSPGHGFSY  213



>ref|XP_007019592.1| Uncharacterized protein TCM_035706 [Theobroma cacao]
 gb|EOY16817.1| Uncharacterized protein TCM_035706 [Theobroma cacao]
Length=215

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  EE P SPR+  Q Q  Q TMH  N  F V+       +A  G R    D Q
Sbjct  79   LQNELDYCGEEPPMSPRAPSQHQHSQPTMHFMNTNFMVSSGSSGQ-TAGLGTRPDQCDQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
            PK+ VFSNALSSP+R SLQHYH++QG Y PN  +PS  G +N+++ +L  Q+RD+NP +S
Sbjct  138  PKNLVFSNALSSPVRQSLQHYHISQGGYCPNGGLPSGNGARNHESNFLQHQTRDSNPLSS  197

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P HE  Y
Sbjct  198  NDSSMDMHADSPSHESTY  215



>ref|XP_010261019.1| PREDICTED: uncharacterized protein LOC104599958 [Nelumbo nucifera]
Length=217

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 88/139 (63%), Gaps = 3/139 (2%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcP-ASAPQGLRSGHSDH  608
            L NE+DYG EE P SPR  FQ QQ Q TMH  N       +     A   Q  RS +S+H
Sbjct  79   LQNEIDYGGEEPPMSPRLPFQNQQTQPTMHFMNPPMAQVSSGSFGPALVGQAPRSINSEH  138

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPN  434
            Q K+SVFSNALSSP+R SLQHYHLAQGSY PN+ +P   G +N +  +    +RD+N P 
Sbjct  139  QSKNSVFSNALSSPVRRSLQHYHLAQGSYHPNSIIPPGNGTRNAEASFAHHHNRDSNSPF  198

Query  433  SSDTLMDMHSDTPDHEFPY  377
            S+D+ MDMH+D+P  E  Y
Sbjct  199  SNDSSMDMHADSPGQESSY  217



>ref|XP_009335132.1| PREDICTED: uncharacterized protein LOC103927893 [Pyrus x bretschneideri]
Length=215

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 89/137 (65%), Gaps = 1/137 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  EE   SPR   Q Q  Q T H  N GFPV      P +  QG+RS   DHQ
Sbjct  79   LQNELDYCGEEPSMSPRLPLQHQHLQPTAHFSNSGFPVTSGSSGPTNTGQGIRSEQCDHQ  138

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNSS  428
             K+SVFSNALSSP+R SLQHYH++Q  Y P   +PS  G +N++  +L  +RDANPP+S+
Sbjct  139  SKNSVFSNALSSPVRQSLQHYHISQDGYYPGAGLPSGNGARNSEPSFLHPNRDANPPSSN  198

Query  427  DTLMDMHSDTPDHEFPY  377
            DT MDMH+D+P H+  Y
Sbjct  199  DTSMDMHADSPGHDSTY  215



>ref|XP_004503996.1| PREDICTED: uncharacterized protein LOC101509322 [Cicer arietinum]
Length=212

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 90/147 (61%), Gaps = 8/147 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YGAEE+P SPR S Q Q  Q  M    G    +        A QG
Sbjct  72   TIDIVSHLQ--NELEYGAEESPVSPRQSIQ-QNSQTAMQTNVGASIPSNAFGSTV-AGQG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+G +D Q K+SVFSNALSSPIR SLQ Y LAQGS   +N M S  G +NN+  Y   Q
Sbjct  128  IRTGQTD-QAKNSVFSNALSSPIRRSLQPYQLAQGSCHSSNVMSSGNGTRNNEMTYPSGQ  186

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
            +RD N  NSSD  MDMH+D+P H+FPY
Sbjct  187  NRDTNSSNSSD-CMDMHADSPGHDFPY  212



>ref|XP_010268579.1| PREDICTED: uncharacterized protein LOC104605493 [Nelumbo nucifera]
Length=217

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 94/139 (68%), Gaps = 3/139 (2%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpn-ggfpvnpnpfcPASAPQGLRSGHSDH  608
            L NE+DYG EE   SPR  FQ Q  Q TMH  N  G  ++   F  A+A QG RS HSD+
Sbjct  79   LQNEIDYGGEEPSMSPRQPFQNQHSQPTMHFVNPAGAQISSGSFGLAAAGQGPRSVHSDN  138

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPN  434
            Q K+SVFSNALSSP+R SLQHYHL QG Y PN+ MPS    +N +  +   Q+RD+N P+
Sbjct  139  QAKNSVFSNALSSPVRRSLQHYHLTQGGYYPNSGMPSGNVARNVEASFSHHQNRDSNSPS  198

Query  433  SSDTLMDMHSDTPDHEFPY  377
            S+D+ MDMH+D+P HE PY
Sbjct  199  SNDSSMDMHADSPGHESPY  217



>ref|XP_011100069.1| PREDICTED: uncharacterized protein LOC105178309 [Sesamum indicum]
Length=208

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 92/135 (68%), Gaps = 8/135 (6%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQ-EQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQP  602
            NELDYG EE P+SPR  FQ +QQ    M   + G PV+ N F PA+  QG RS +SD Q 
Sbjct  81   NELDYGTEEPPSSPRLPFQHQQQSHTAMQTTHSGIPVSSNAFGPATVGQGQRSVNSD-QT  139

Query  601  KSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDT  422
            K+SVFSNALSSP+R SLQHYHL+QG    NNA      M+ N+    Q+RD NPP+S+DT
Sbjct  140  KNSVFSNALSSPVRRSLQHYHLSQGGQYANNA------MRGNENTVSQTRDPNPPSSNDT  193

Query  421  LMDMHSDTPDHEFPY  377
             MDMH+D+P H+ PY
Sbjct  194  SMDMHADSPGHDSPY  208



>gb|KJB28968.1| hypothetical protein B456_005G077300 [Gossypium raimondii]
Length=214

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+DY  EE   SPR+  Q+ Q Q TM   N  F V+       +A QG R  +SD Q
Sbjct  79   LKNEIDYCGEEPSMSPRAPSQQHQSQPTMQFMNTSFMVSSGSSGQ-TAVQGTRPDYSDQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNS  431
            PK+S+FSNALSSP+  SLQHYH+AQ  Y P N +PS  G +NN++ +LQ  +RD+NP +S
Sbjct  138  PKNSIFSNALSSPVLQSLQHYHIAQEGYCP-NGLPSGNGDRNNESNFLQPPTRDSNPLSS  196

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P HE  Y
Sbjct  197  NDSSMDMHADSPSHESTY  214



>gb|KJB59481.1| hypothetical protein B456_009G258500 [Gossypium raimondii]
 gb|KJB59482.1| hypothetical protein B456_009G258500 [Gossypium raimondii]
Length=214

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDYG EE   SPR+  Q+Q  Q  M   N GF V+       +A QG R  H D Q
Sbjct  79   LQNELDYG-EEPSMSPRAPSQQQHSQPAMQFMNTGFMVSTGSSGQ-TAVQGTRPDHCDQQ  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+ VFSNALSSP+R SLQHYH+AQ  Y PN  +PS  G +NN+  +L  Q+RD+NP +S
Sbjct  137  SKNLVFSNALSSPVRRSLQHYHIAQEGYCPNGGLPSGNGARNNEPSFLQNQTRDSNPLSS  196

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P HE  Y
Sbjct  197  NDSSMDMHADSPSHESTY  214



>gb|KJB59480.1| hypothetical protein B456_009G258500 [Gossypium raimondii]
Length=243

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 88/136 (65%), Gaps = 4/136 (3%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDYG EE   SPR+  Q+Q  Q  M   N GF V+       +A QG R  H D Q K
Sbjct  110  NELDYG-EEPSMSPRAPSQQQHSQPAMQFMNTGFMVSTGSSGQ-TAVQGTRPDHCDQQSK  167

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            + VFSNALSSP+R SLQHYH+AQ  Y PN  +PS  G +NN+  +L  Q+RD+NP +S+D
Sbjct  168  NLVFSNALSSPVRRSLQHYHIAQEGYCPNGGLPSGNGARNNEPSFLQNQTRDSNPLSSND  227

Query  424  TLMDMHSDTPDHEFPY  377
            + MDMH+D+P HE  Y
Sbjct  228  SSMDMHADSPSHESTY  243



>gb|KHG14904.1| hypothetical protein F383_02753 [Gossypium arboreum]
Length=263

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 88/136 (65%), Gaps = 4/136 (3%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDYG EE   SPR+  Q+Q  Q  M   N GF V+       +A QG R  H D Q K
Sbjct  130  NELDYG-EEPSMSPRAPSQQQHSQPAMQFMNTGFMVSTGSSGQ-TAGQGTRPDHCDQQSK  187

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            + VFSNALSSP+R SLQHYH+AQ  Y PN  +PS  G +NN+  +L  Q+RD+NP +S+D
Sbjct  188  NLVFSNALSSPVRRSLQHYHIAQEGYCPNGGLPSGNGARNNEPSFLPNQTRDSNPLSSND  247

Query  424  TLMDMHSDTPDHEFPY  377
            + MDMH+D+P HE  Y
Sbjct  248  SSMDMHADSPSHESTY  263



>gb|AFK43213.1| unknown [Lotus japonicus]
Length=213

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YGAEE P SPR     Q  Q TM    G    +          QG
Sbjct  72   TGDVVAHLQ--NELEYGAEEPPMSPRQPVY-QNSQTTMPTNFGASIPSNAFGTTVVG-QG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+G  D QPK+SVFSNALSSPIR SLQ YH+AQGS P +N M S  G +N++  Y   Q
Sbjct  128  MRAGQLDQQPKNSVFSNALSSPIRRSLQPYHMAQGSCPSSNLMSSGNGARNSEITYPNSQ  187

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
             RD N  NSSD  MDMH+++P H+F Y
Sbjct  188  IRDTNSSNSSD-CMDMHAESPGHDFTY  213



>gb|AFK36877.1| unknown [Lotus japonicus]
Length=213

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   HL   NEL+YGAEE P SPR     Q  Q TM    G    +          QG
Sbjct  72   TGDVVAHLQ--NELEYGAEEPPMSPRQPVY-QNSQTTMPTNFGASIPSNAFGTTVVG-QG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +R+G  D QPK+SVFSNALSSPIR SLQ YH+AQGS P +N M S  G +N++  Y   Q
Sbjct  128  MRAGQLDQQPKNSVFSNALSSPIRRSLQPYHMAQGSCPSSNLMSSGNGARNSEITYPNSQ  187

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
             RD N  NSSD  MDMH+++P H+F Y
Sbjct  188  IRDTNSSNSSD-CMDMHAESPGHDFTY  213



>gb|KHG17592.1| Nuclear receptor subfamily 2 group C member 2 [Gossypium arboreum]
Length=214

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+DY  EE   SPR+  Q+ Q Q TM   N  F V+       +A QG R  +SD Q
Sbjct  79   LQNEIDYCGEEPSMSPRAPSQQHQSQPTMQFMNTSFMVSSGSSGQ-TAVQGTRPDYSDQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNS  431
            PK+S+FSNALSSPI  SLQHYH+AQ  Y   N +PS  G +NN++ +LQ  +RD+NP +S
Sbjct  138  PKNSIFSNALSSPILQSLQHYHIAQEGY-CTNGLPSENGDRNNESNFLQPPTRDSNPFSS  196

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P HE  Y
Sbjct  197  NDSSMDMHADSPSHESTY  214



>ref|XP_009336494.1| PREDICTED: uncharacterized protein LOC103929073 [Pyrus x bretschneideri]
Length=208

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELD   EE   SPR   Q Q    T+H  + GFPV      P +  QG+RS   +HQ
Sbjct  75   LQNELDCCGEEPSMSPRLPLQHQP---TVHFSSSGFPVTSGSSGPTNTAQGIRSEQCNHQ  131

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNSS  428
             K+SVFSNALSSP+R SLQHYH++Q  + P + +PS  G +NN+  +L  +RDANPP+S+
Sbjct  132  SKNSVFSNALSSPVRQSLQHYHISQDGHYPGSGLPSGNGARNNEPSFLHPNRDANPPSSN  191

Query  427  DTLMDMHSDTPDHEFPY  377
            DT MDMH+D+P H+  Y
Sbjct  192  DTSMDMHADSPGHDSTY  208



>ref|XP_008381858.1| PREDICTED: uncharacterized protein LOC103444684 [Malus domestica]
Length=212

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELD   EE   SPR   Q Q    T+H  + GFPV      P +  QG+RS   DHQ
Sbjct  79   LQNELDSCGEEPSMSPRLPLQHQP---TVHFSSSGFPVTSGSSGPTNTVQGIRSEPCDHQ  135

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNSS  428
             K+SVFSNALSSP+R SLQHYH++Q  + P + +PS  G +NN+  +L  +RDANPP+S+
Sbjct  136  SKNSVFSNALSSPVRQSLQHYHISQDGHYPGSGLPSGNGARNNEPSFLHPNRDANPPSSN  195

Query  427  DTLMDMHSDTPDHEFPY  377
            DT MDMH+D+P H+  Y
Sbjct  196  DTSMDMHADSPGHDSTY  212



>ref|XP_007048174.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX92331.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=204

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 88/137 (64%), Gaps = 7/137 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NEL+YG EE P SPR   Q    Q    L N   P++ NPF  A   QG
Sbjct  72   TVDVVAYLQ--NELEYGGEEPPMSPRLPLQHPHSQTATQLNNLVGPISSNPFSSAMVGQG  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY--LQ  458
            +RSG  D+Q K+SVFSNALSSP+R SLQHYHLAQG Y  NN + S  G +NN++ Y   Q
Sbjct  130  VRSG--DNQGKNSVFSNALSSPVRRSLQHYHLAQGGYNSNNVLSSVNGQRNNESNYSHQQ  187

Query  457  SRDANPPNSSDTLMDMH  407
            +RDAN P+S+D+ MDMH
Sbjct  188  NRDANSPSSNDS-MDMH  203



>gb|KDO57106.1| hypothetical protein CISIN_1g048552mg [Citrus sinensis]
Length=209

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 93/148 (63%), Gaps = 13/148 (9%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NEL+YGAEE P SPR + Q Q  Q    L N G P +  P+ P++   G
Sbjct  72   TVDIVSYLQ--NELEYGAEEPPMSPRLAVQHQHSQAV--LNNSGLPFSSIPYAPSTVGPG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG---YL  461
            +RSG  DHQ K+SVFSNALSSP+R SLQHY L QG Y     MP   G +N DT    + 
Sbjct  128  VRSGQPDHQAKNSVFSNALSSPVRRSLQHYDLTQGGY----QMPPGNGPRNGDTNNAHHQ  183

Query  460  QSRDANPPNSSDTLMDMHSDTPDHEFPY  377
            Q+RDAN P SSD+ MDMH+D+P HEF Y
Sbjct  184  QNRDANSP-SSDS-MDMHADSPGHEFTY  209



>ref|XP_003634526.1| PREDICTED: uncharacterized protein LOC100854952 [Vitis vinifera]
Length=216

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 91/138 (66%), Gaps = 2/138 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  EE P SPR+    Q  Q  MHLP+ GF V+       +A QG R  H D Q
Sbjct  79   LQNELDYCGEEPPMSPRAPIAYQHAQQIMHLPSSGFLVSSGSSAHTNAGQGPRPEHCDQQ  138

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
            PK+SVFSNALSSP+R SLQ+YH  QG Y PN + P   G++N +T +   Q+RD+NPP+S
Sbjct  139  PKNSVFSNALSSPVRRSLQNYHFPQGGYCPNGSAPLGNGVRNVETNFSHHQNRDSNPPSS  198

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P HE  Y
Sbjct  199  NDSSMDMHADSPGHESTY  216



>ref|XP_006427929.1| hypothetical protein CICLE_v10026489mg [Citrus clementina]
 ref|XP_006464522.1| PREDICTED: uncharacterized protein LOC102606673 [Citrus sinensis]
 gb|ESR41169.1| hypothetical protein CICLE_v10026489mg [Citrus clementina]
Length=209

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 93/148 (63%), Gaps = 13/148 (9%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NEL+YGAEE P SPR + Q Q  Q    L N G P +  P+ P++   G
Sbjct  72   TVDIVSYLQ--NELEYGAEEPPMSPRLAVQHQHSQAV--LNNSGLPFSSIPYAPSTVGPG  127

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG---YL  461
            +RSG  DHQ K+SVFSNALSSP+R SLQHY L QG Y     MP   G +N DT    + 
Sbjct  128  VRSGQPDHQAKNSVFSNALSSPVRRSLQHYDLTQGGY----QMPPGNGPRNGDTNNAHHQ  183

Query  460  QSRDANPPNSSDTLMDMHSDTPDHEFPY  377
            Q+RDAN P SSD+ MDMH+D+P HEF Y
Sbjct  184  QNRDANSP-SSDS-MDMHADSPGHEFTY  209



>ref|XP_007159785.1| hypothetical protein PHAVU_002G267000g [Phaseolus vulgaris]
 gb|ESW31779.1| hypothetical protein PHAVU_002G267000g [Phaseolus vulgaris]
Length=218

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 86/150 (57%), Gaps = 8/150 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NEL+YG EE P SPR    +Q  Q  MH   G    +        A QG
Sbjct  72   TIDIVTYLQ--NELEYGGEEAPVSPRQPVHQQNSQTAMHTNFGSNIPSNAFGATV-AGQG  128

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPS----ACGMQNNDTGY  464
            +R+G  D Q K+SVFSNALSSPIR SLQ YHLAQGSYP  N MPS      G +N++  Y
Sbjct  129  IRAGQPDQQAKNSVFSNALSSPIRRSLQPYHLAQGSYPSGNIMPSGNGNGNGTRNSEMTY  188

Query  463  LQSRD-ANPPNSSDTLMDMHSDTPDHEFPY  377
               ++  +  ++S   MDMHSD+P H+F Y
Sbjct  189  PNGQNRDSNSSNSSDCMDMHSDSPGHDFSY  218



>emb|CDP11436.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L  ELDY  EE P SPR+  Q Q  Q + H  N G  V           QG RS  SD Q
Sbjct  79   LQTELDYSGEEPPISPRAPGQHQHLQ-SAHFANSGMIVPTGSSGLPPGVQGFRSEPSDQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+ VFSNALSSP+R SLQ+YH++ G Y  NN  PS  G +++++ ++  Q+RD NP NS
Sbjct  138  SKNYVFSNALSSPVRRSLQNYHISPGGYFQNNVQPSTNGNRSSESNFIHQQTRDPNPVNS  197

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P HE  Y
Sbjct  198  NDSAMDMHADSPGHESTY  215



>ref|XP_002307513.2| hypothetical protein POPTR_0005s21820g, partial [Populus trichocarpa]
 gb|EEE94509.2| hypothetical protein POPTR_0005s21820g, partial [Populus trichocarpa]
Length=131

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 77/125 (62%), Gaps = 3/125 (2%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+  Q Q  Q      +     + +    A+A QG RS H D QPK
Sbjct  8    NELDYCGEEPSMSPRTPHQHQTSQPIPFTNSTFLVSSGSSGLTATA-QGTRSEHCDQQPK  66

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNSSD  425
            ++VFSNALSSPIR SLQ+YH+ QG Y P    PS  G +NN+  +LQ  +RD NPP+S+D
Sbjct  67   NTVFSNALSSPIRRSLQNYHITQGGYCPQGGSPSGNGTRNNEPNFLQHHNRDPNPPSSND  126

Query  424  TLMDM  410
            + MD+
Sbjct  127  SSMDI  131



>ref|XP_008786494.1| PREDICTED: uncharacterized protein LOC103704817 [Phoenix dactylifera]
Length=213

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 84/135 (62%), Gaps = 4/135 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+DYG E+   SPR  F    PQ TMH  N     +     PA+     R+GHSD Q
Sbjct  79   LQNEIDYGGEDASMSPRLQF-PSHPQTTMHFTNTNIQASSGVSGPATVVIAPRTGHSD-Q  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGY-LQSRDANPPNS  431
             K+S+FSNALSSP+R SLQ Y+LAQ G Y PN A+ +  G +N++  +  Q R +N  NS
Sbjct  137  TKNSIFSNALSSPVRHSLQPYNLAQDGGYYPNCALLNGSGTRNHEVVFPNQIRGSNSLNS  196

Query  430  SDTLMDMHSDTPDHE  386
            +DT MDMHSD+P HE
Sbjct  197  NDTSMDMHSDSPSHE  211



>ref|XP_010096477.1| hypothetical protein L484_006724 [Morus notabilis]
 gb|EXB64487.1| hypothetical protein L484_006724 [Morus notabilis]
Length=214

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 91/148 (61%), Gaps = 10/148 (7%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NELD+G+EE P SPR+  Q+Q  Q  MH           P  PA+A QG
Sbjct  72   TVDIVAYLQ--NELDFGSEEPPMSPRTLLQQQHLQTAMH---SANLGPTIPAAPATAGQG  126

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHL-AQGSYPPNNAMPSACGMQNND--TGY-  464
             R GHS+ + K+SVFSNALSSP+R SLQ Y+L AQGSY   N  P     ++N+    Y 
Sbjct  127  GRWGHSEQRAKNSVFSNALSSPVRRSLQSYNLAAQGSYHSGNFTPHGDAHRSNNEINSYP  186

Query  463  LQSRDANPPNSSDTLMDMHSDTPDHEFP  380
             Q+RD NP  S+D+L DMH+D+PD +FP
Sbjct  187  QQNRDTNPSVSNDSL-DMHTDSPDRDFP  213



>ref|NP_001291356.1| uncharacterized protein LOC105049617 [Elaeis guineensis]
 ref|XP_010927656.1| PREDICTED: uncharacterized protein LOC105049617 [Elaeis guineensis]
 gb|AFS65094.1| holocarboxylase synthetase [Elaeis guineensis]
Length=216

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 81/135 (60%), Gaps = 5/135 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQP--QITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            NE+DYG E+   SPR  FQ Q P  Q  MH  N         F   +     R  HSD Q
Sbjct  81   NEMDYGGEDGIVSPRLQFQHQHPHVQTAMHFTNSNSQPPSGFFGQGAIGLAPRPSHSD-Q  139

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYL-QSRDANPPNS  431
             K+SVFSNALSSP+R SLQ YHLAQGS Y  N  + S  G +N++   L QSR+ N P+S
Sbjct  140  SKNSVFSNALSSPVRRSLQPYHLAQGSGYYANGCLSSGNGARNHEANTLSQSREPNCPSS  199

Query  430  SDTLMDMHSDTPDHE  386
            +D+ MDMHSD+P HE
Sbjct  200  NDSSMDMHSDSPTHE  214



>ref|XP_006473103.1| PREDICTED: uncharacterized protein LOC102626479 [Citrus sinensis]
Length=208

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELD   EE   SPR+  + Q  Q TM   + GFPV        +A QG RS H D QPK
Sbjct  81   NELDCSVEEPTMSPRAQVRHQHSQPTMQFTSPGFPVPSGSSGQ-TAGQGTRSEHCDQQPK  139

Query  598  SSVFSNALSSPIRGSLQHYHLA-QGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSS  428
            +SVFSNALSSPIR SLQHY +A  G Y PN  MP   G +NND  +   Q+RDANPPNS+
Sbjct  140  NSVFSNALSSPIRRSLQHYQIAPGGGYYPNGGMPPTAGGRNNDPNFFHQQNRDANPPNSN  199

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  200  DSSMDMHAD  208



>gb|KDO83805.1| hypothetical protein CISIN_1g028515mg [Citrus sinensis]
Length=208

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELD   EE   SPR+  + Q  Q TM   + GFPV        +A QG RS H D QPK
Sbjct  81   NELDSSVEEPTMSPRAQVRHQHSQPTMQFTSPGFPVPSGSSGQ-TAGQGTRSEHCDQQPK  139

Query  598  SSVFSNALSSPIRGSLQHYHLA-QGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSS  428
            +SVFSNALSSPIR SLQHY +A  G Y PN  MP   G +NND  +   Q+RDANPPNS+
Sbjct  140  NSVFSNALSSPIRRSLQHYQIAPGGGYYPNGGMPPTAGGRNNDPNFFHQQNRDANPPNSN  199

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  200  DSSMDMHAD  208



>gb|KJB18359.1| hypothetical protein B456_003G048500 [Gossypium raimondii]
Length=199

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NEL+YG +E P SPR   Q    Q  M   N G PV  NP    +  QG+R G  D+Q
Sbjct  72   LQNELEYGGDEPPMSPRLPLQHPHSQAPMQSNNLGAPVLSNPLSSVNVGQGVRPG--DNQ  129

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+SVFSNALSSP+R SLQ YHLAQGSY  NN + S  G +NN++ Y   Q+R+AN P+S
Sbjct  130  VKNSVFSNALSSPVRRSLQPYHLAQGSYNSNNILSSVNGQRNNESNYCHQQNREANSPSS  189

Query  430  SDTLMDMHSD  401
            +D  MDMH+D
Sbjct  190  NDC-MDMHAD  198



>gb|KJB18360.1| hypothetical protein B456_003G048500 [Gossypium raimondii]
Length=206

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NEL+YG +E P SPR   Q    Q  M   N G PV  NP    +  QG+R G  D+Q
Sbjct  79   LQNELEYGGDEPPMSPRLPLQHPHSQAPMQSNNLGAPVLSNPLSSVNVGQGVRPG--DNQ  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+SVFSNALSSP+R SLQ YHLAQGSY  NN + S  G +NN++ Y   Q+R+AN P+S
Sbjct  137  VKNSVFSNALSSPVRRSLQPYHLAQGSYNSNNILSSVNGQRNNESNYCHQQNREANSPSS  196

Query  430  SDTLMDMHSD  401
            +D  MDMH+D
Sbjct  197  NDC-MDMHAD  205



>ref|XP_007048172.1| Uncharacterized protein TCM_001288 [Theobroma cacao]
 gb|EOX92329.1| Uncharacterized protein TCM_001288 [Theobroma cacao]
Length=215

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 91/140 (65%), Gaps = 7/140 (5%)
 Frame = -3

Query  784  L*NELDYGAEETP-TSPRS-SFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSD  611
            L N L+YGAEE     P++ +FQ Q PQ    + +   P + NP  PA+  QG RSG  D
Sbjct  79   LQNGLEYGAEECQHQHPQTVTFQHQHPQTVTQVNSLSAPFSTNPISPAAMVQGARSG--D  136

Query  610  HQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPP  437
            +Q K+SVFSNALSSP+R SLQH+H AQG Y  NN + SA G + N+  +   Q+R+ N P
Sbjct  137  YQAKNSVFSNALSSPVRRSLQHFHSAQGGYHSNNVLSSANGPRKNENNHTHQQNREPNSP  196

Query  436  NSSDTLMDMHSDTPDHEFPY  377
            +++D  MDMH+D+P H+F +
Sbjct  197  SAND-CMDMHADSPGHDFHF  215



>ref|XP_006361614.1| PREDICTED: uncharacterized protein LOC102606378 [Solanum tuberosum]
Length=210

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L +ELDY  E+   SPR   Q  QP   +H  N GF V+P P   A    GLRS H D Q
Sbjct  79   LQSELDYNGEDQSMSPRPPPQHSQP---LHFTNSGFHVSPGPVGVAVPGHGLRSDH-DQQ  134

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSD  425
            PK++VFSNALSSP+R SLQ+YH+AQGS+  NNA P      N      Q+RD+N  NS+D
Sbjct  135  PKNNVFSNALSSPVRRSLQNYHIAQGSHFSNNAQPPNATRNNETNSQHQNRDSNGYNSAD  194

Query  424  TLMDMHSDTPDHEFPY  377
              MDMHSD+P H+  Y
Sbjct  195  ASMDMHSDSPGHDSTY  210



>ref|XP_008776936.1| PREDICTED: uncharacterized protein LOC103696971 [Phoenix dactylifera]
Length=216

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 82/135 (61%), Gaps = 5/135 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQP--QITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            NE+DYG E+  +SPR  FQ Q P  Q  MH  N         F   +     R  HSD Q
Sbjct  81   NEMDYGGEDGNSSPRLQFQHQHPHLQTAMHFTNLNSQPPSGFFAQGAIGLAPRPSHSD-Q  139

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYL-QSRDANPPNS  431
             K+SVFSNALSSP+R SLQ YHLAQGS Y  +  +P+  G +N++     QSR+ N P+S
Sbjct  140  AKNSVFSNALSSPVRRSLQPYHLAQGSGYYASGCLPTGNGARNHEANTQSQSREPNCPSS  199

Query  430  SDTLMDMHSDTPDHE  386
            +D+ MDMHSD+P HE
Sbjct  200  NDSSMDMHSDSPTHE  214



>ref|XP_011044272.1| PREDICTED: uncharacterized protein LOC105139508 [Populus euphratica]
 ref|XP_011044273.1| PREDICTED: uncharacterized protein LOC105139508 [Populus euphratica]
Length=204

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (61%), Gaps = 3/125 (2%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELD+  EE   SPR+  Q Q  Q      +     + +    A+A QG RS H D QPK
Sbjct  81   NELDFCGEEPSMSPRTPHQHQTSQPIPFTNSTFLVSSGSSGLTATA-QGTRSEHCDQQPK  139

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNSSD  425
            ++VFSNALSSPIR SLQ+YH+ QG Y      PS  G +NN+  +LQ  +RD NPP+S+D
Sbjct  140  NTVFSNALSSPIRRSLQNYHITQGGYCLQGGSPSGNGTRNNEPNFLQHHNRDPNPPSSND  199

Query  424  TLMDM  410
            + MD+
Sbjct  200  SSMDI  204



>gb|KHG16765.1| hypothetical protein F383_20843 [Gossypium arboreum]
Length=206

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 82/130 (63%), Gaps = 5/130 (4%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NEL+YG +E P SPR   Q    Q      N G PV  NP    +  QG+R G  D+Q
Sbjct  79   LQNELEYGGDEPPVSPRLPLQHPHSQAPTQSNNLGAPVLSNPLSSVNVGQGVRPG--DNQ  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+SVFSNALSSP+R SLQ YHLAQG Y  NN + S  G +NN++ Y   Q+R+AN P+S
Sbjct  137  VKNSVFSNALSSPVRRSLQPYHLAQGGYNSNNVLSSVNGQRNNESNYCHQQNREANSPSS  196

Query  430  SDTLMDMHSD  401
            +D  MDMH+D
Sbjct  197  NDC-MDMHAD  205



>ref|XP_008808717.1| PREDICTED: uncharacterized protein LOC103720668 [Phoenix dactylifera]
Length=216

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 84/135 (62%), Gaps = 5/135 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQP--QITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            N +DYG E+   SPR  FQ Q P  Q TMH  N         F  A+     +   SD Q
Sbjct  81   NAMDYGGEDAIVSPRLQFQHQHPHLQTTMHFTNSIVQQPSVFFGRAAVGLAPQPSPSD-Q  139

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYL-QSRDANPPNS  431
             K+SVFSNALS+P+R SLQ YHLAQGS Y  +  +P+  G +N++   L Q++++N P+S
Sbjct  140  AKNSVFSNALSTPVRRSLQPYHLAQGSEYEASGYLPTGNGARNHEVNSLSQNQESNCPSS  199

Query  430  SDTLMDMHSDTPDHE  386
            +D+LMDMHSD+P +E
Sbjct  200  NDSLMDMHSDSPTYE  214



>gb|KJB14930.1| hypothetical protein B456_002G149700 [Gossypium raimondii]
Length=201

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 79/137 (58%), Gaps = 19/137 (14%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQ-PQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L NE+D+GAEE+P SPR SFQ QQ PQ    L              +SAP    S     
Sbjct  79   LQNEVDFGAEESPMSPRLSFQLQQHPQTATQLNT------------SSAP---FSSTPIS  123

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPN  434
              K+SVFSNALSSP+R SLQHYH  Q  Y  NN + SA G +N +T Y   Q R+ N P+
Sbjct  124  AAKNSVFSNALSSPVRRSLQHYHSVQVGYHSNNVLSSANGSRNTETNYCHQQIREVNSPS  183

Query  433  SSDTLMDMHSDTPDHEF  383
             +D  MDMH+D+P  +F
Sbjct  184  PNDC-MDMHADSPAGDF  199



>ref|XP_004252568.1| PREDICTED: uncharacterized protein LOC101258927 [Solanum lycopersicum]
Length=210

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 83/136 (61%), Gaps = 4/136 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L +ELDY  E+   SPR   Q  QP   +H  N GF V+P P   A+   GLRS H D Q
Sbjct  79   LQSELDYNGEDQSMSPRPPPQHSQP---LHFANSGFHVSPGPVGVAAPGHGLRSDH-DQQ  134

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSD  425
            PK++VFSNALSSP+R SLQ+YH+AQGS+  NNA P      N       +RD+N  NS D
Sbjct  135  PKNNVFSNALSSPVRRSLQNYHIAQGSHFANNAQPPNATRHNETNSQNLNRDSNGYNSVD  194

Query  424  TLMDMHSDTPDHEFPY  377
              MDMHSD+P H+  Y
Sbjct  195  ASMDMHSDSPGHDSTY  210



>gb|KGN44465.1| hypothetical protein Csa_7G298810 [Cucumis sativus]
Length=148

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 5/142 (4%)
 Frame = -3

Query  790  LNL*NELDYGAEETPTSPRSSF-QEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHS  614
            L L NELDY  EE   SPR +  Q Q  Q TM   N  FP +      A+  QG R+ HS
Sbjct  8    LTLQNELDYCGEEPSMSPRPAVHQHQHAQPTMQFTNSSFPASGLSGQ-ATTGQGSRTEHS  66

Query  613  DHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACG-MQNNDTGYLQSRDANP-  440
            ++  KSSVFSNALSSP+R SLQ YH+AQ ++ PN+ M    G  +NN+  +LQ ++ +P 
Sbjct  67   ENHSKSSVFSNALSSPVRRSLQQYHIAQEAHYPNSGMSGGNGATRNNEPNFLQHQNTDPN  126

Query  439  -PNSSDTLMDMHSDTPDHEFPY  377
              +S+D+ MDMH+D+P H+  Y
Sbjct  127  SVSSNDSSMDMHADSPAHDSHY  148



>ref|XP_006434518.1| hypothetical protein CICLE_v10002494mg [Citrus clementina]
 gb|ESR47758.1| hypothetical protein CICLE_v10002494mg [Citrus clementina]
Length=208

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELD   EE   SPR+  + Q  Q TM   + GFPV        +A QG RS H D QPK
Sbjct  81   NELDSSVEEPTMSPRAQVRHQHSQPTMQFTSPGFPVPSGSSGQ-TAGQGTRSEHCDQQPK  139

Query  598  SSVFSNALSSPIRGSLQHYHLA-QGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSS  428
            +SVFSNALSSPIR SLQH  +A  G Y PN  MP   G +NND  +   Q+RDANPPN +
Sbjct  140  NSVFSNALSSPIRRSLQHCQIAPGGGYYPNGGMPPTAGGRNNDPNFFHQQNRDANPPNPN  199

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  200  DSSMDMHAD  208



>ref|XP_006359041.1| PREDICTED: uncharacterized protein LOC102584007 [Solanum tuberosum]
Length=211

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRS-SFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L +ELDY  E+   SPR    Q  QP   MH  N GFPV+      A+   G+RS H D 
Sbjct  79   LQSELDYSGEDHSMSPRPPQNQHSQP---MHFANSGFPVSSGSIGVAAPGHGVRSDH-DP  134

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG-YLQSRDANPPNS  431
            Q K+ VFSNALSSP+R SLQ+Y +AQG Y  NN  PS  G +NN+T  + Q+R++N  NS
Sbjct  135  QSKNYVFSNALSSPVRQSLQNYQVAQGGYFSNNVQPS-NGARNNETNLHHQNRESNSYNS  193

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D  MDMHSD+P H+F Y
Sbjct  194  ADASMDMHSDSPGHDFTY  211



>gb|KHN41306.1| hypothetical protein glysoja_030144 [Glycine soja]
Length=167

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+  Q  Q Q  +H+P+       +    A+  QGLRS H ++Q K
Sbjct  44   NELDYCGEEPSMSPRAPLQ-HQSQAALHVPSFPVTSASSGQTIAA--QGLRSDHCENQSK  100

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            +SVFSNALSSP+R SLQHY + +G     N +    G +N + G+L  QSRD+N  +S+D
Sbjct  101  NSVFSNALSSPVRRSLQHYQIGEGG-CYTNGLSMGNGNRNTEPGFLNQQSRDSNAVSSND  159

Query  424  TLMDMHSD  401
            + MDMH+D
Sbjct  160  SAMDMHAD  167



>ref|XP_010027746.1| PREDICTED: uncharacterized protein LOC104418182 [Eucalyptus grandis]
Length=214

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY A++TP SPR   Q Q  Q  +HL N G P++ NPF PA A QG RSG+SD+Q
Sbjct  79   LQNELDYAADDTPMSPRPPPQLQNSQAAVHLANVGAPISSNPFGPA-AIQGARSGNSDNQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG--YLQSRDANPPNS  431
             K+ VFSNALSSP+R SLQHY   Q  Y  +N   S    ++N+T   + Q RD NP +S
Sbjct  138  GKNPVFSNALSSPVRRSLQHYQSMQAGY-NSNTTSSGNAARHNETNNPHHQIRDNNPTSS  196

Query  430  SDTLMDMHSDTPDHEFPY  377
            +DT MDMH+++P  +  Y
Sbjct  197  NDTSMDMHAESPGQDSHY  214



>gb|KHG16766.1| putative G-protein coupled receptor [Gossypium arboreum]
Length=212

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 12/165 (7%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQ-PQITMHLpng  683
            +   I  Q    L   T D   +L   NEL+YGAE+ P SPR  FQ+QQ P+   H  N 
Sbjct  56   LFEWILRQQEEGLKVMTTDIVAYLQ--NELEYGAEDFPMSPRQPFQQQQHPRPATHQNNL  113

Query  682  gfpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAM  503
            G P + NP    +  QG+RS   D+Q K+SVFSNALSSP+R SLQHYH   G+   NN  
Sbjct  114  GSPFSSNPISAGTIAQGVRSA--DYQAKNSVFSNALSSPVRQSLQHYHSVSGA---NNIS  168

Query  502  PSACGMQNNDTGY--LQSRDANPPNSSDTLMDMHS-DTPDHEFPY  377
             S    +NN+T +  LQ+R+ + P+++D  MDMH+ D+P  +FP+
Sbjct  169  SSTNEPRNNETYHINLQNRETDSPSTND-CMDMHADDSPHQDFPF  212



>ref|XP_003548092.1| PREDICTED: uncharacterized protein LOC100793841 [Glycine max]
Length=204

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+  Q  Q Q  +H+P+       +    A+  QGLRS H ++Q K
Sbjct  81   NELDYCGEEPSMSPRAPLQ-HQSQAALHVPSFPVTSASSGQTIAA--QGLRSDHCENQSK  137

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            +SVFSNALSSP+R SLQHY + +G     N +    G +N + G+L  QSRD+N  +S+D
Sbjct  138  NSVFSNALSSPVRRSLQHYQIGEGG-CYTNGLSMGNGNRNTEPGFLNQQSRDSNAVSSND  196

Query  424  TLMDMHSD  401
            + MDMH+D
Sbjct  197  SAMDMHAD  204



>ref|XP_002524331.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38071.1| conserved hypothetical protein [Ricinus communis]
Length=203

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE P SPR+  Q Q  Q           ++     P +A QG RS H D Q K
Sbjct  81   NELDYSGEEPPASPRAPQQHQSSQPIQF--TNSSFLSSGSSGPITAGQGARSEHCDQQSK  138

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNSSD  425
            +SVFSNALSSPIR SLQ+YH+AQG Y P    PS  G ++N+  + Q  +RD NP +S+D
Sbjct  139  NSVFSNALSSPIRRSLQNYHIAQGGYYPTGGPPSGNGPRSNEANFTQHPNRDPNPVSSND  198

Query  424  TLMDM  410
            + MD+
Sbjct  199  SSMDI  203



>ref|XP_004139686.1| PREDICTED: uncharacterized protein LOC101216474 [Cucumis sativus]
 ref|XP_004161902.1| PREDICTED: uncharacterized protein LOC101229005 [Cucumis sativus]
Length=217

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 86/138 (62%), Gaps = 5/138 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPR-SSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQP  602
            NELDY  EE   SPR +  Q Q  Q TM   N  FP +      A+  QG R+ HS++  
Sbjct  81   NELDYCGEEPSMSPRPAVHQHQHAQPTMQFTNSSFPASGLSGQ-ATTGQGSRTEHSENHS  139

Query  601  KSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACG-MQNNDTGYLQSRDANP--PNS  431
            KSSVFSNALSSP+R SLQ YH+AQ ++ PN+ M    G  +NN+  +LQ ++ +P   +S
Sbjct  140  KSSVFSNALSSPVRRSLQQYHIAQEAHYPNSGMSGGNGATRNNEPNFLQHQNTDPNSVSS  199

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P H+  Y
Sbjct  200  NDSSMDMHADSPAHDSHY  217



>gb|KJB14929.1| hypothetical protein B456_002G149700 [Gossypium raimondii]
Length=199

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 77/134 (57%), Gaps = 19/134 (14%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQ-PQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            ++D+GAEE+P SPR SFQ QQ PQ    L              +SAP    S       K
Sbjct  80   QVDFGAEESPMSPRLSFQLQQHPQTATQLNT------------SSAP---FSSTPISAAK  124

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            +SVFSNALSSP+R SLQHYH  Q  Y  NN + SA G +N +T Y   Q R+ N P+ +D
Sbjct  125  NSVFSNALSSPVRRSLQHYHSVQVGYHSNNVLSSANGSRNTETNYCHQQIREVNSPSPND  184

Query  424  TLMDMHSDTPDHEF  383
              MDMH+D+P  +F
Sbjct  185  C-MDMHADSPAGDF  197



>gb|KJB18358.1| hypothetical protein B456_003G048400 [Gossypium raimondii]
Length=212

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 98/165 (59%), Gaps = 12/165 (7%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQ-PQITMHLpng  683
            +   I  Q    L   T D   +L   NEL+YGAE+ P SPR  FQ+QQ P+   H  N 
Sbjct  56   LFEWILRQQEEGLKVMTTDIVAYLQ--NELEYGAEDFPMSPRQPFQQQQHPRPATHQNNL  113

Query  682  gfpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAM  503
            G P + NP    +  QG+RS   D+Q K+SVFSNALSSP+R SLQHYH   G+   NN  
Sbjct  114  GSPFSSNPISAGTIAQGVRSA--DYQAKNSVFSNALSSPVRQSLQHYHSVPGA---NNIS  168

Query  502  PSACGMQNNDTGY--LQSRDANPPNSSDTLMDMHS-DTPDHEFPY  377
             S    +NN+T +  LQ+R+ + P+++D  MDMH+ D+P  +FP+
Sbjct  169  SSTNEPRNNETYHTNLQNRETDSPSTNDC-MDMHADDSPHQDFPF  212



>ref|XP_008461917.1| PREDICTED: uncharacterized protein LOC103500405 [Cucumis melo]
Length=217

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 5/138 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPR-SSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQP  602
            NELDY  EE   SPR +  Q    Q TM   N  FP +      A+  QG R+ HS++  
Sbjct  81   NELDYCGEEPSMSPRPAVHQHHHAQPTMQFTNSSFPASGLSGQ-ATTGQGSRTEHSENHS  139

Query  601  KSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACG-MQNNDTGYLQSRDANP--PNS  431
            KSSVFSNALSSP+R SLQ YH+AQ ++ PN+ M    G  +NN++ +LQ ++  P   +S
Sbjct  140  KSSVFSNALSSPVRRSLQQYHIAQEAHYPNSGMSGGNGATRNNESNFLQHQNTEPNSVSS  199

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH+D+P H+  Y
Sbjct  200  NDSSMDMHADSPAHDSHY  217



>ref|XP_010925082.1| PREDICTED: uncharacterized protein LOC105047727 [Elaeis guineensis]
Length=215

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 78/134 (58%), Gaps = 6/134 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGL--RSGHSDHQ  605
            NELDYG E+   SPR  FQ Q P +   L      V         AP GL  R  HSD Q
Sbjct  81   NELDYGGEDAIVSPRLQFQHQHPHLQSTLHFTNLSVQQPSGFFGQAPVGLASRPSHSD-Q  139

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYL-QSRDANPPNS  431
             K+SVFSNALSSP R   Q YHLAQGS Y   + +P+  G +N++   L Q++  + P+S
Sbjct  140  AKNSVFSNALSSPFRRG-QPYHLAQGSDYHATSYLPTGTGARNHEVNSLSQNQGPHCPSS  198

Query  430  SDTLMDMHSDTPDH  389
             D+LMDMHSD+P H
Sbjct  199  IDSLMDMHSDSPAH  212



>gb|KCW54334.1| hypothetical protein EUGRSUZ_I00298 [Eucalyptus grandis]
Length=287

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 93/147 (63%), Gaps = 6/147 (4%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   +L   NELDY A++TP SPR   Q Q  Q  +HL N G P++ NPF PA A QG
Sbjct  145  TIDIISYLQ--NELDYAADDTPMSPRPPPQLQNSQAAVHLANVGAPISSNPFGPA-AIQG  201

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG--YLQ  458
             RSG+SD+Q K+ VFSNALSSP+R SLQHY   Q  Y  +N   S    ++N+T   + Q
Sbjct  202  ARSGNSDNQGKNPVFSNALSSPVRRSLQHYQSMQAGY-NSNTTSSGNAARHNETNNPHHQ  260

Query  457  SRDANPPNSSDTLMDMHSDTPDHEFPY  377
             RD NP +S+DT MDMH+++P  +  Y
Sbjct  261  IRDNNPTSSNDTSMDMHAESPGQDSHY  287



>ref|XP_007200578.1| hypothetical protein PRUPE_ppa011863mg [Prunus persica]
 gb|EMJ01777.1| hypothetical protein PRUPE_ppa011863mg [Prunus persica]
Length=193

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPT-SPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L NELDY  EE P+ SPR   Q Q  Q T+H  N GFPV+     P +  QG+RS   DH
Sbjct  79   LQNELDYCGEEQPSMSPRVPLQHQHLQPTVHFTNSGFPVSSGSSGPTNTGQGIRSEQCDH  138

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL  461
            Q K+SVFSNALSSP+R SLQHYH++Q  Y P   +PS  G +NN+  +L
Sbjct  139  QSKNSVFSNALSSPVRQSLQHYHISQDGYYPGAGLPSGNGARNNEPSFL  187



>ref|XP_011458474.1| PREDICTED: uncharacterized protein LOC101309208 [Fragaria vesca 
subsp. vesca]
Length=203

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 87/136 (64%), Gaps = 16/136 (12%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAP---QGLRSGHS  614
            L NELDY  EE   SPR + Q Q    + H  N GFP++      +SAP   QG+RS   
Sbjct  79   LQNELDYCGEEPSMSPRVTVQHQHTP-SSHFTNSGFPISSG----SSAPNTGQGIRSEQC  133

Query  613  DHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPP  437
            DHQ K+SVFSNALSSP+R SLQHYH+   SY P   +PSA   +NN+  +LQ +RD N  
Sbjct  134  DHQSKNSVFSNALSSPVRQSLQHYHI---SY-PGAGLPSA---RNNEPNFLQPNRDVNAL  186

Query  436  NSSDTLMDMHSDTPDH  389
            +S+D+ MDMH+D+P H
Sbjct  187  SSNDSSMDMHADSPGH  202



>ref|XP_010097650.1| hypothetical protein L484_023790 [Morus notabilis]
 gb|EXB70605.1| hypothetical protein L484_023790 [Morus notabilis]
Length=233

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR   Q Q  Q  MH  N GFPV+     P +A Q + + H DHQ K
Sbjct  97   NELDYCGEEPSMSPRVLAQNQHTQAPMHSTNSGFPVSSGSSVPTNAGQRVHTEHCDHQSK  156

Query  598  SSVFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSS  428
            +SVFSNALSSP+R SLQHYH++Q   Y PN+++ S  G +NN+  +L  Q+RD+NPP+S+
Sbjct  157  NSVFSNALSSPVRRSLQHYHISQERGYYPNSSLSSGNGPRNNEPNFLQPQNRDSNPPSSN  216

Query  427  DTLMDMHSDTPDHEFPY  377
            D+ MDMH+D+P  +  Y
Sbjct  217  DSSMDMHADSPAQDSNY  233



>gb|AFK42100.1| unknown [Lotus japonicus]
Length=207

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 82/129 (64%), Gaps = 5/129 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  E+   SPR+  Q QQ Q  +H+P+ GFPV           QGLRS   D+Q K
Sbjct  81   NELDYFGEDPTMSPRAPLQHQQLQPAVHVPSSGFPVTSGSSGHTIVGQGLRSEQCDNQTK  140

Query  598  SSVFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSS  428
            +SVFSNALSSP+R SLQHY + + G+YP   +M +  G +N +  ++  QSRDA   +S+
Sbjct  141  NSVFSNALSSPVRRSLQHYEIGEGGNYPSGLSMGN--GNRNTEHSFVHQQSRDATGFSSN  198

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  199  DSAMDMHAD  207



>gb|EYU24058.1| hypothetical protein MIMGU_mgv1a012421mg [Erythranthe guttata]
Length=251

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 78/136 (57%), Gaps = 13/136 (10%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHS--DHQ  605
            NELDY  EE P SPR   Q+QQP     LP       P     AS  QG RSG    D  
Sbjct  125  NELDYATEEPPPSPRLPAQQQQPPPHSGLPISSNAFGP-----ASVGQGHRSGSGNPDQT  179

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSD  425
              SSVFSNALSSP+R SLQ+YHL QG +  NN       M+ N+    Q RD NPP+S+D
Sbjct  180  RSSSVFSNALSSPVRRSLQNYHLPQGGFSANNP------MRTNENSINQIRDTNPPSSND  233

Query  424  TLMDMHSDTPDHEFPY  377
            T MDMH D+P H+ PY
Sbjct  234  TSMDMHGDSPGHDSPY  249



>ref|XP_010925339.1| PREDICTED: uncharacterized protein LOC105047906 [Elaeis guineensis]
Length=209

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 6/134 (4%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+DYG E+   SPR  F    PQ TMH  N     +     PA+     R+GHSD Q
Sbjct  79   LQNEIDYGGEDASMSPRLQF-PCHPQTTMHFTNPNIQASSGVSGPATVVIAPRTGHSD-Q  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY-LQSRDANPPNSS  428
             K+S+FSNALSSP+  SLQ Y    G Y P+ A+ +  G +N++  +  QSRD+N  N +
Sbjct  137  MKNSIFSNALSSPVCSSLQPY---DGGYYPSGAVLNGSGTRNHEVVFPNQSRDSNSLNFN  193

Query  427  DTLMDMHSDTPDHE  386
            D+ MDMHSD+P HE
Sbjct  194  DSSMDMHSDSPPHE  207



>ref|XP_009401877.1| PREDICTED: uncharacterized protein LOC103985764 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=185

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 79/133 (59%), Gaps = 5/133 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NE+DY  E +  SPRS FQ Q  Q T+HL N G       F   +     RSGHSD Q K
Sbjct  54   NEMDYAGEGSLVSPRSPFQHQHHQTTIHLTNSGIQPASGLFGQPTVGLASRSGHSD-QAK  112

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAM--PSACGMQNNDTGYLQSRDANPPNSSD  425
            +SVFSNALSS +  SLQ YHLAQGS    NA+      G +N+D    Q+RD N  +S+ 
Sbjct  113  NSVFSNALSSQVCRSLQPYHLAQGSGLYANAVIPTGTAGARNHDPN--QNRDTNSLSSNY  170

Query  424  TLMDMHSDTPDHE  386
            + MD+H+D+P HE
Sbjct  171  SSMDIHTDSPPHE  183



>ref|XP_011100916.1| PREDICTED: uncharacterized protein LOC105179031 [Sesamum indicum]
Length=205

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 88/134 (66%), Gaps = 9/134 (7%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDYG EE P SPR     QQ Q  M LP+ G PV+ N F P +  QG R G+SD Q K
Sbjct  81   NELDYGTEEPPPSPRLP--PQQQQTLMPLPHSGLPVSSNAFGPTTLGQGQRPGNSD-QSK  137

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSP+R SLQHYH++QG Y  NNA  S      N+    Q+RD NP +S+DT 
Sbjct  138  NSVFSNALSSPVRRSLQHYHISQGGYSANNATRS------NENNSNQNRDTNPLSSNDTS  191

Query  418  MDMHSDTPDHEFPY  377
            MDMH ++P H+ PY
Sbjct  192  MDMHPESPGHDSPY  205



>ref|XP_009401860.1| PREDICTED: uncharacterized protein LOC103985764 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401868.1| PREDICTED: uncharacterized protein LOC103985764 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=212

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 79/133 (59%), Gaps = 5/133 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NE+DY  E +  SPRS FQ Q  Q T+HL N G       F   +     RSGHSD Q K
Sbjct  81   NEMDYAGEGSLVSPRSPFQHQHHQTTIHLTNSGIQPASGLFGQPTVGLASRSGHSD-QAK  139

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAM--PSACGMQNNDTGYLQSRDANPPNSSD  425
            +SVFSNALSS +  SLQ YHLAQGS    NA+      G +N+D    Q+RD N  +S+ 
Sbjct  140  NSVFSNALSSQVCRSLQPYHLAQGSGLYANAVIPTGTAGARNHDPN--QNRDTNSLSSNY  197

Query  424  TLMDMHSDTPDHE  386
            + MD+H+D+P HE
Sbjct  198  SSMDIHTDSPPHE  210



>gb|KHN00739.1| hypothetical protein glysoja_000407 [Glycine soja]
Length=205

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 75/128 (59%), Gaps = 5/128 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+  Q QQ Q  +H P+       +     +  QGLRS H ++Q K
Sbjct  81   NELDYCGEEPSMSPRAPLQHQQSQPALHAPSFPVTSASSGQTIVA--QGLRSDHCENQSK  138

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            + VFSNALSSPI  SLQHY + +G     N +    G  N + G+L  QSRD+N  +S+D
Sbjct  139  NYVFSNALSSPICRSLQHYQIGEGG-CYTNGLSMGNGNWNTEPGFLHQQSRDSNAMSSND  197

Query  424  TLMDMHSD  401
            + MDMH+D
Sbjct  198  SNMDMHAD  205



>ref|XP_009392917.1| PREDICTED: uncharacterized protein LOC103978735 [Musa acuminata 
subsp. malaccensis]
Length=210

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 79/143 (55%), Gaps = 7/143 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
              D   H+   +E+DY  E+   SPRS FQ Q    TMH+ N G       F   +    
Sbjct  72   VADIVTHMQ--SEMDYAGEDALVSPRSPFQHQS---TMHVTNSGIQPTSGIFGQPTVGLA  126

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQS  455
             RSGHSD Q K+SVFSNALSSP+R SLQ YH AQG  +  N  +P+      ND G  ++
Sbjct  127  PRSGHSD-QAKNSVFSNALSSPVRRSLQPYHFAQGGGFYGNGVLPTGNAESRNDHGPNEN  185

Query  454  RDANPPNSSDTLMDMHSDTPDHE  386
            R  N   S+D+ MD+H+D+  HE
Sbjct  186  RGTNSLGSNDSSMDIHTDSRPHE  208



>ref|XP_011042891.1| PREDICTED: uncharacterized protein LOC105138502 [Populus euphratica]
Length=204

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (61%), Gaps = 3/125 (2%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+  Q Q  Q  +   N  F V+      A++ QG RS   D Q K
Sbjct  81   NELDYCGEEPSVSPRTPHQHQSSQ-PIPFTNSTFLVSSGSSGLAASGQGTRSEQCDQQSK  139

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNSSD  425
            ++VFSNALSSP+R SLQ+YH+AQG Y P    PS  G + N+  +LQ  +RD N P+S+D
Sbjct  140  NTVFSNALSSPVRRSLQNYHIAQGGYCPPGGSPSGNGTRANEPNFLQNHNRDPNLPSSND  199

Query  424  TLMDM  410
            + MD+
Sbjct  200  SSMDI  204



>ref|XP_002300905.2| hypothetical protein POPTR_0002s06540g [Populus trichocarpa]
 gb|EEE80178.2| hypothetical protein POPTR_0002s06540g [Populus trichocarpa]
Length=204

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 75/127 (59%), Gaps = 3/127 (2%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  EE   SPR+  Q Q  Q      +     + +   PA+  QG RS H D Q
Sbjct  79   LQNELDYCGEEPSMSPRTPHQHQNSQPIPSTNSTFLVSSGSSGLPATG-QGTRSEHCDQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ--SRDANPPNS  431
             K++VFSNALSSP+R SLQ+YH+AQG Y P     S  G + N+  +LQ  +RD N P+S
Sbjct  138  SKNTVFSNALSSPVRRSLQNYHIAQGGYCPPGGSLSGNGTRANEPNFLQNHNRDPNLPSS  197

Query  430  SDTLMDM  410
            +D+ MD+
Sbjct  198  NDSSMDI  204



>ref|XP_009761480.1| PREDICTED: uncharacterized protein LOC104213649 [Nicotiana sylvestris]
Length=211

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 85/138 (62%), Gaps = 7/138 (5%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRS-SFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L +ELDY  E+   SPR    Q  QP   MH  N  FPV+      A+   G+RS H D 
Sbjct  79   LQSELDYSGEDHSISPRPPQNQHSQP---MHFANSAFPVSSGSIGVAAPGHGVRSDH-DL  134

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNS  431
            Q K+ VFSNALSSP+R SLQ+Y +AQG +  NN  PS  G +NN+T   Q +R++N  NS
Sbjct  135  QSKNYVFSNALSSPVRRSLQNYQIAQGGFLLNNVQPSN-GARNNETNVQQQNRESNSSNS  193

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D  MDMHSD+P H+F Y
Sbjct  194  ADASMDMHSDSPGHDFTY  211



>ref|XP_009782198.1| PREDICTED: uncharacterized protein LOC104230978 [Nicotiana sylvestris]
Length=212

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 79/136 (58%), Gaps = 2/136 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L +ELD   E+   SPR   Q Q  Q  MH  N GF V+P P   A+   GLRS H D Q
Sbjct  79   LQSELDCNGEDQSMSPRPPPQHQHSQ-PMHFANSGFHVSPGPVGVAAPGHGLRSDH-DQQ  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSD  425
            PK++VFSNALSSP+R SLQ+YH+AQG    NN  P             Q+RD+N   S+D
Sbjct  137  PKNNVFSNALSSPVRRSLQNYHIAQGGQFSNNVQPPNGTRHIETNSQHQNRDSNSYISAD  196

Query  424  TLMDMHSDTPDHEFPY  377
              MDMHSD+P H+  Y
Sbjct  197  ASMDMHSDSPGHDSTY  212



>ref|XP_009610488.1| PREDICTED: uncharacterized protein LOC104104186 isoform X2 [Nicotiana 
tomentosiformis]
Length=213

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 77/136 (57%), Gaps = 1/136 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L +ELDY  E+   SPR    +      MH  N GF V+  P   A+   GLRS H D Q
Sbjct  79   LQSELDYNGEDQSMSPRPPPPQHHHSQPMHFANSGFHVSSGPVGVAAPGHGLRSDH-DQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSD  425
            PK++VFSNALSSP+R SLQ+YH+AQG    NN  P             Q+RD+N   S+D
Sbjct  138  PKNNVFSNALSSPVRRSLQNYHIAQGGQFSNNVQPPNGTRHIETNSQHQNRDSNSYISAD  197

Query  424  TLMDMHSDTPDHEFPY  377
              MDMHSD+P H+  Y
Sbjct  198  ASMDMHSDSPGHDSTY  213



>ref|NP_001242150.1| uncharacterized protein LOC100796484 [Glycine max]
 gb|ACU19912.1| unknown [Glycine max]
Length=205

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 5/128 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+  Q QQ Q  +H P+       +     +  QGLRS H ++Q K
Sbjct  81   NELDYCGEEPSMSPRAPLQHQQSQPALHAPSFPVTSASSGQTIFA--QGLRSDHCENQSK  138

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSD  425
            + VFSNALSSPI  SLQHY + +G     N +    G  N + G+L  QSRD+N  +S+D
Sbjct  139  NYVFSNALSSPICRSLQHYQIGEGG-CYTNGLSMGNGNWNTEPGFLHQQSRDSNAMSSND  197

Query  424  TLMDMHSD  401
            + M MH+D
Sbjct  198  SNMGMHAD  205



>ref|XP_010681253.1| PREDICTED: uncharacterized protein LOC104896231 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=212

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 78/138 (57%), Gaps = 6/138 (4%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  +E   SPR+       Q   H  N GF V+       +A Q  RS   D+Q
Sbjct  79   LQNELDYCGDEPSMSPRAPVPHHYSQAPTHFANTGFLVSGPSALSPAA-QTPRSEQCDNQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+SVFSNALSSP+R +LQHY +AQG Y P+   P     + N++ Y   Q+RD+   NS
Sbjct  138  TKNSVFSNALSSPVRRTLQHYQIAQGGYCPSGGTPQGNAARTNESNYANNQNRDS---NS  194

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D+ MDMH D+P  E  Y
Sbjct  195  NDSSMDMHQDSPGQESNY  212



>ref|XP_010915065.1| PREDICTED: uncharacterized protein LOC105040293 [Elaeis guineensis]
Length=213

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+DYG E+   SPR  F    PQ TMH  N     +     P       R GHSD Q
Sbjct  79   LQNEIDYGGEDVSMSPRLQF-PSHPQPTMHFTNTNNQASSGVSGPTVVGLASRIGHSD-Q  136

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGY-LQSRDANPPNS  431
             K+ VFSNALSSP+  SLQ YHLAQ G Y PN    +  G +NN+  +  Q R +N  +S
Sbjct  137  TKNPVFSNALSSPVPYSLQPYHLAQGGGYYPNGVPLNGSGTRNNEVVFPNQIRGSNSLSS  196

Query  430  SDTLMDMHSDTPDHE  386
            +D  MDMHSD+P HE
Sbjct  197  NDLSMDMHSDSPSHE  211



>ref|XP_007151974.1| hypothetical protein PHAVU_004G091100g [Phaseolus vulgaris]
 gb|ESW23968.1| hypothetical protein PHAVU_004G091100g [Phaseolus vulgaris]
Length=117

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = -3

Query  742  SPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPI  563
            SPR+  Q  Q Q TMH+P+ GFPV    F    A QGLR+   ++QPK+SVFSNALSSPI
Sbjct  2    SPRAPLQHHQSQPTMHVPSLGFPVTSASFVQTIAAQGLRAEPGENQPKNSVFSNALSSPI  61

Query  562  RGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSSDTLMDMHSD  401
            R SLQHY +++G    N       G +N + G+L  + R++   +S+D+ MDMH+D
Sbjct  62   RRSLQHYQISEGGCYSNGPSMGGNGNRNTELGFLPQEGRESVVVSSNDSAMDMHAD  117



>ref|XP_009631427.1| PREDICTED: uncharacterized protein LOC104121198 [Nicotiana tomentosiformis]
Length=211

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 85/138 (62%), Gaps = 7/138 (5%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRS-SFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L +ELDY  E+   SPR    Q  QP   MH  N GFPV+      A+   G+RS H D 
Sbjct  79   LQSELDYSGEDHSISPRPPQNQHSQP---MHFANSGFPVSSGSIGVAAPGHGVRSDH-DL  134

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-SRDANPPNS  431
            Q K+ VFSNALSSP+R SLQ+Y +AQG +  NN  P   G +NN+T   Q +R++N  NS
Sbjct  135  QSKNYVFSNALSSPVRRSLQNYQIAQGGFLLNNVQP-LNGARNNETNVQQQNRESNSSNS  193

Query  430  SDTLMDMHSDTPDHEFPY  377
            +D  MDMHSD+P H+F Y
Sbjct  194  ADASMDMHSDSPGHDFTY  211



>ref|XP_009610487.1| PREDICTED: uncharacterized protein LOC104104186 isoform X1 [Nicotiana 
tomentosiformis]
Length=239

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 75/131 (57%), Gaps = 1/131 (1%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L +ELDY  E+   SPR    +      MH  N GF V+  P   A+   GLRS H D Q
Sbjct  79   LQSELDYNGEDQSMSPRPPPPQHHHSQPMHFANSGFHVSSGPVGVAAPGHGLRSDH-DQQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSD  425
            PK++VFSNALSSP+R SLQ+YH+AQG    NN  P             Q+RD+N   S+D
Sbjct  138  PKNNVFSNALSSPVRRSLQNYHIAQGGQFSNNVQPPNGTRHIETNSQHQNRDSNSYISAD  197

Query  424  TLMDMHSDTPD  392
              MDMHSD+PD
Sbjct  198  ASMDMHSDSPD  208



>ref|XP_010681257.1| PREDICTED: uncharacterized protein LOC104896231 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=207

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 76/132 (58%), Gaps = 6/132 (5%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  +E   SPR+       Q   H  N GF V+       +A Q  RS   D+Q
Sbjct  79   LQNELDYCGDEPSMSPRAPVPHHYSQAPTHFANTGFLVSGPSALSPAA-QTPRSEQCDNQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+SVFSNALSSP+R +LQHY +AQG Y P+   P     + N++ Y   Q+RD+   NS
Sbjct  138  TKNSVFSNALSSPVRRTLQHYQIAQGGYCPSGGTPQGNAARTNESNYANNQNRDS---NS  194

Query  430  SDTLMDMHSDTP  395
            +D+ MDMH D+P
Sbjct  195  NDSSMDMHQDSP  206



>ref|XP_009389481.1| PREDICTED: uncharacterized protein LOC103976031 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 80/132 (61%), Gaps = 6/132 (5%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E+DY  E+   +PRS FQ +  Q TMH+ N G       F   +     RSGH+D Q K+
Sbjct  82   EMDYTGEDALITPRSPFQHEHQQTTMHIANSGVQPPSGLFGQPTVGLAPRSGHAD-QAKN  140

Query  595  SVFSNALSSPIRGSLQHYHLAQGS--YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDT  422
            SVFSNALSSP+R SLQ Y LAQGS  +P  +      G +N D+   Q+R+AN  +S+D+
Sbjct  141  SVFSNALSSPVRRSLQPYQLAQGSGFFPNADLQTGNAGARNQDSN--QNREANSLSSNDS  198

Query  421  LMDMHSDTPDHE  386
             MD ++++P HE
Sbjct  199  SMD-NAESPPHE  209



>ref|XP_009412399.1| PREDICTED: uncharacterized protein LOC103993894 [Musa acuminata 
subsp. malaccensis]
Length=211

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 78/144 (54%), Gaps = 8/144 (6%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
              D   H+   N +DY  E+   SPRSSF  Q     MH  N         F   +    
Sbjct  72   VADIVTHIQ--NVMDYAGEDALVSPRSSFPHQH-HTPMHATNSSAQPPSALFGQPTVGLA  128

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQG-SYPPNNAMPSA-CGMQNNDTGYLQ  458
             RSGHSD Q K+SVFSNALSSP+R SLQ YH+AQG  +  N  +P+   G +N D    Q
Sbjct  129  SRSGHSD-QTKNSVFSNALSSPVRRSLQPYHVAQGDGFYVNGVVPAGNTGSRNPDAN--Q  185

Query  457  SRDANPPNSSDTLMDMHSDTPDHE  386
             R+ N  + SD+ MD+H+D+P HE
Sbjct  186  HRETNSLSFSDSSMDIHTDSPPHE  209



>ref|XP_010681250.1| PREDICTED: uncharacterized protein LOC104896231 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=224

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 76/132 (58%), Gaps = 6/132 (5%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NELDY  +E   SPR+       Q   H  N GF V+       +A Q  RS   D+Q
Sbjct  79   LQNELDYCGDEPSMSPRAPVPHHYSQAPTHFANTGFLVSGPSALSPAA-QTPRSEQCDNQ  137

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNS  431
             K+SVFSNALSSP+R +LQHY +AQG Y P+   P     + N++ Y   Q+RD+   NS
Sbjct  138  TKNSVFSNALSSPVRRTLQHYQIAQGGYCPSGGTPQGNAARTNESNYANNQNRDS---NS  194

Query  430  SDTLMDMHSDTP  395
            +D+ MDMH D+P
Sbjct  195  NDSSMDMHQDSP  206



>ref|XP_003592057.1| hypothetical protein MTR_1g098250 [Medicago truncatula]
 gb|AES62308.1| holocarboxylase synthetase [Medicago truncatula]
Length=207

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 78/129 (60%), Gaps = 5/129 (4%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE  TSPR+  Q QQ Q  +H+ + GFPV     C     QGLRS + D+Q K
Sbjct  81   NELDYFGEEQSTSPRAPLQHQQLQPAVHVASSGFPVTSGSSCQTVIGQGLRSENWDNQSK  140

Query  598  SSVFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGYL--QSRDANPPNSS  428
            S  FSNA S+ +  SL+HY + + GSY  + +M S     N+++ +L  Q RD+   NS+
Sbjct  141  SFEFSNASSNSVHRSLEHYQIGEGGSYLSSPSMGSES--LNSESSFLHQQRRDSTGFNSN  198

Query  427  DTLMDMHSD  401
            D+ MDMHSD
Sbjct  199  DSTMDMHSD  207



>ref|XP_004237831.1| PREDICTED: uncharacterized protein LOC101255194 [Solanum lycopersicum]
Length=211

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRS-SFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L +ELDY  E+   SPR    Q  QP     L         +     +AP      H D 
Sbjct  79   LQSELDYSGEDHSMSPRPPQNQHSQPM----LFPNSGFPVSSGSIGVAAPGHDVRLHHDP  134

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG-YLQSRDANPPNS  431
            Q K+ VFSNALSSP+R SLQ+Y +AQG Y  NN   S  G +NN+T  + Q+ D+N  NS
Sbjct  135  QSKNYVFSNALSSPVRQSLQNYQVAQGGYFSNNVQLS-IGARNNETNLHHQNGDSNSYNS  193

Query  430  SDTLMDMHSDTPDHEF  383
            +D  MDMHSD+P H+F
Sbjct  194  ADAAMDMHSDSPGHDF  209



>gb|KJB63416.1| hypothetical protein B456_010G211200 [Gossypium raimondii]
Length=115

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 5/81 (6%)
 Frame = -3

Query  637  QGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL-  461
            QG+R G  D+Q K+SVFSNALSSP+  SLQ YHLAQGSY  N  + S  G +NN++ Y  
Sbjct  37   QGVRPG--DNQVKNSVFSNALSSPVCRSLQPYHLAQGSYNSNIILSSVNGHRNNESNYCH  94

Query  460  -QSRDANPPNSSDTLMDMHSD  401
             Q+R+AN P+S+D  MDMH+D
Sbjct  95   QQNREANSPSSNDC-MDMHAD  114



>ref|XP_003592516.1| hypothetical protein MTR_1g106890 [Medicago truncatula]
 gb|KEH26051.1| holocarboxylase synthetase [Medicago truncatula]
Length=190

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 17/129 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpngg--fpvnpnpfcPASAPQGLRSGHSDHQ  605
            NELDY  EE   SPR+  Q QQPQ  M + + G       +    A A QGLRS + ++Q
Sbjct  76   NELDYCGEEPSMSPRAPLQNQQPQPMMPVTSSGFPVTSGSSGQTIAGAGQGLRSDYCENQ  135

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNS-S  428
            PK+SVFSNALSSP+R +LQ Y + +G               N    + QS ++N  +S +
Sbjct  136  PKNSVFSNALSSPVRRNLQLYQIGEGG--------------NRSFLHNQSSESNAVSSNN  181

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  182  DSAMDMHAD  190



>ref|XP_003592515.1| hypothetical protein MTR_1g106890 [Medicago truncatula]
 gb|AFK49104.1| unknown [Medicago truncatula]
 gb|KEH26050.1| holocarboxylase synthetase [Medicago truncatula]
Length=195

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 17/129 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpngg--fpvnpnpfcPASAPQGLRSGHSDHQ  605
            NELDY  EE   SPR+  Q QQPQ  M + + G       +    A A QGLRS + ++Q
Sbjct  81   NELDYCGEEPSMSPRAPLQNQQPQPMMPVTSSGFPVTSGSSGQTIAGAGQGLRSDYCENQ  140

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNS-S  428
            PK+SVFSNALSSP+R +LQ Y + +G               N    + QS ++N  +S +
Sbjct  141  PKNSVFSNALSSPVRRNLQLYQIGEGG--------------NRSFLHNQSSESNAVSSNN  186

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  187  DSAMDMHAD  195



>gb|EPS64635.1| hypothetical protein M569_10142 [Genlisea aurea]
Length=212

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 6/138 (4%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+D+  +E+P SPR + Q+ Q  + + +P                   LRS     Q
Sbjct  79   LRNEVDHVTDESPQSPRLALQQNQASVHLGIPLSSSTAFGPAPGGHHH-HHLRSAD---Q  134

Query  604  PKSSVFSNALSSPIRGSLQHYH-LAQGSYPPNNAMPSACGMQNNDTGYLQS-RDANPPNS  431
             K+SVFSNALSSPIR SLQ YH L+ GS+  N++        NN +   Q  RD NPP+S
Sbjct  135  SKNSVFSNALSSPIRRSLQSYHHLSAGSHYVNDSGRGNNNENNNGSSNNQIPRDPNPPSS  194

Query  430  SDTLMDMHSDTPDHEFPY  377
            +DT MDMH+D+P H+ PY
Sbjct  195  NDTSMDMHADSPGHDSPY  212



>gb|KDP36560.1| hypothetical protein JCGZ_08327 [Jatropha curcas]
Length=205

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 8/128 (6%)
 Frame = -3

Query  778  NELDYGAEETPTSPRS-SFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQP  602
            NELDY  EE P SPR+ S Q  QP   +   N GF V+     P +  QG RS H D QP
Sbjct  81   NELDYCGEEPPLSPRAPSHQNSQP---IQFTNSGFLVSSGSSGPITTGQGTRSEHCDQQP  137

Query  601  KSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGY---LQSRD-ANPPN  434
            K+SVFSNALSSPIR SL +Y   QG Y P     S   +++N+  +    Q+RD  NP +
Sbjct  138  KNSVFSNALSSPIRRSLPNYPFTQGGYYPTGGQQSGNAIRSNEPNFPQQHQNRDHNNPVS  197

Query  433  SSDTLMDM  410
            S+D+ M++
Sbjct  198  SNDSSMEI  205



>gb|EYU31112.1| hypothetical protein MIMGU_mgv1a014609mg [Erythranthe guttata]
Length=184

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 72/133 (54%), Gaps = 30/133 (23%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDYG EE P S +S+ Q     I +         + N   PA+  QG RSG    Q +
Sbjct  81   NELDYGIEE-PQS-QSALQPTHSGIPV--------SSSNSLGPATVGQGFRSGQVTEQSR  130

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFS+ALSSP+R SLQHYHL QG            G QN        RD+NPP S+DT 
Sbjct  131  NSVFSSALSSPVRRSLQHYHLPQG------------GQQN--------RDSNPPGSTDTS  170

Query  418  MDMHSDTPDHEFP  380
            MDMH  +P ++ P
Sbjct  171  MDMHPYSPGNDSP  183



>gb|ABK22079.1| unknown [Picea sitchensis]
Length=253

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 76/174 (44%), Gaps = 41/174 (24%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQ-QPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            L NELDYG +E   SP + +Q Q   Q            +      A+A QG R G SD 
Sbjct  79   LQNELDYGGDEVSMSPATQYQHQPHAQQQNQFSVTNTQTSSGVVGLATAGQGPRLGLSD-  137

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQ------NNDTGYL----  461
            Q K+SVFSNALSSP+R SLQ +H+AQG  Y  NN+     G +      + D G      
Sbjct  138  QNKNSVFSNALSSPVRRSLQPFHIAQGGYYSANNSSQVGNGGRRTGSTTDQDQGVFHGGH  197

Query  460  ----------------------------QSRDANPPNSSDTLMDMHSDTPDHEF  383
                                        Q RD N    +D+ MDMH+D+P H F
Sbjct  198  TLAGPQNSEPNGMNSMVSPSNVYGQQPHQIRDVNSYGENDSSMDMHADSPAHGF  251



>ref|XP_002460104.1| hypothetical protein SORBIDRAFT_02g022820 [Sorghum bicolor]
 gb|EER96625.1| hypothetical protein SORBIDRAFT_02g022820 [Sorghum bicolor]
Length=195

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 72/161 (45%), Gaps = 27/161 (17%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D   H+   +E+ YG +    SPRS +  Q    T+H+PN  
Sbjct  57   LYEWILRQHENGLRLTVADVASHIQ--HEIQYGGDNASASPRSQYPSQSTAPTVHIPNTS  114

Query  679  fpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMP  500
                         P GL          S VFSNALSSPIR SLQ YHL QG         
Sbjct  115  SQQPSPSLFAPGNP-GL-----TQSKNSMVFSNALSSPIRRSLQPYHLEQG---------  159

Query  499  SACGMQNNDTGYL---QSRDANPPNSSDTLMDMHSDTPDHE  386
                    D GY     SRD NP  S+D+ MDMHSD+P H+
Sbjct  160  -------GDAGYFANGASRDVNPTASNDSSMDMHSDSPAHD  193



>ref|XP_004956648.1| PREDICTED: uncharacterized protein LOC101777921 [Setaria italica]
Length=195

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 76/162 (47%), Gaps = 29/162 (18%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D   H+   +E+ YG +    SPRS +  Q    T+H+PN  
Sbjct  57   LYEWILRQHENGLRLTVADIASHIQ--HEIQYGGDNASASPRSQYPSQITAPTVHIPNTS  114

Query  679  fpvnpnpfcPASAPQGLRSGHSDHQPKSS-VFSNALSSPIRGSLQHYHLAQGSYPPNNAM  503
                         P GL       Q K+S VFSNALSSPIR SLQ YHL QG        
Sbjct  115  NQQPSPSSFVPGNP-GLA------QSKNSMVFSNALSSPIRRSLQPYHLEQG--------  159

Query  502  PSACGMQNNDTGYL---QSRDANPPNSSDTLMDMHSDTPDHE  386
                     + GY     SRDANP  S+D+ MDMHSD+P H+
Sbjct  160  --------GEAGYFANGASRDANPTASNDSSMDMHSDSPAHD  193



>ref|XP_008793512.1| PREDICTED: uncharacterized protein LOC103709793 [Phoenix dactylifera]
Length=205

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = -3

Query  772  LDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKSS  593
            +D G E+    PR  F    PQ TMH  N     +     P +     R GHSD Q K+ 
Sbjct  75   IDCGGEDVSMPPRLQF-PSHPQPTMHFTNTNIQASSGVSGPTTVGLAPRIGHSD-QTKNP  132

Query  592  VFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGY-LQSRDANPPNSSDTL  419
            VFSNALS P+  SLQ YHLAQ G + PN  + +  G +NN+  +  Q R +N  +SSD  
Sbjct  133  VFSNALSGPVPHSLQPYHLAQGGGFYPNGVLLNGSGTRNNEVVFPNQIRGSNSLSSSDLS  192

Query  418  MDMHSDTPDHE  386
            MDMHSD+P HE
Sbjct  193  MDMHSDSPPHE  203



>ref|XP_009388166.1| PREDICTED: uncharacterized protein LOC103974984 [Musa acuminata 
subsp. malaccensis]
Length=207

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NE+D+  E   TSP S FQ QQ Q TMH  N       +P   AS      SG SD Q K
Sbjct  83   NEMDFEVENPSTSPISEFQ-QQTQSTMHFMNSSAQPLFDPSSQASTGCVPPSGDSD-QAK  140

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            + VFSN LS P RGS QH HLAQG     N      G +N+D  + Q  + N   S+++ 
Sbjct  141  NCVFSNPLSGPARGSFQHCHLAQGCGVYANG-----GARNHDPNHNQ--ELNSLRSNESS  193

Query  418  MDMHSDTPDHE  386
            MDM+ D+P H+
Sbjct  194  MDMNLDSPTHQ  204



>gb|KFK32043.1| hypothetical protein AALP_AA6G192700 [Arabis alpina]
Length=190

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 66/126 (52%), Gaps = 16/126 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+      PQ TMH+ N G   +    CP   P  +RS   ++Q K
Sbjct  81   NELECCVEEPPMSPRT----LPPQPTMHVTNSGLMASSGTSCPTGVPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSPIR SLQ+Y + QG Y       S             +R +  P S D+ 
Sbjct  136  NSVFSNALSSPIRRSLQNYQIPQGGYISGGTRSSEV-----------NRGSISPGSIDSS  184

Query  418  MDMHSD  401
            MDMH+D
Sbjct  185  MDMHAD  190



>ref|NP_001152515.1| holocarboxylase synthetase [Zea mays]
 gb|ACN27860.1| unknown [Zea mays]
 tpg|DAA39945.1| TPA: holocarboxylase synthetase [Zea mays]
Length=195

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 73/161 (45%), Gaps = 27/161 (17%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D   H+   +E+ YG +    SPRS +  Q    TMH+PN  
Sbjct  57   LYEWILRQHENGLRLTVADVASHIQ--HEIQYGGDNASASPRSQYPSQSTAPTMHIPNTS  114

Query  679  fpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMP  500
                      +  P GL          S VFS+ALSSPIR SLQ YHL Q          
Sbjct  115  NQQPSPSLFASGNP-GL-----TQSKNSMVFSSALSSPIRRSLQPYHLEQ----------  158

Query  499  SACGMQNNDTGYLQ---SRDANPPNSSDTLMDMHSDTPDHE  386
                  + D GY     SRD NP  S+D+ MDMHSD+P H+
Sbjct  159  ------DGDAGYFANGASRDVNPTASNDSSMDMHSDSPAHD  193



>ref|XP_010421889.1| PREDICTED: uncharacterized protein LOC104707271 [Camelina sativa]
Length=190

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 69/126 (55%), Gaps = 16/126 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            +EL+   EE P SPR+      P  TMH+ + G   +    CP +AP  +RS   ++Q K
Sbjct  81   SELECCTEEPPMSPRAP----TPLPTMHITHSGLMASSGTSCPIAAPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSPIR SLQ+Y + QG Y    A  S             +R +N P S D+ 
Sbjct  136  NSVFSNALSSPIRRSLQNYQIPQGGYTSGGARSSEL-----------NRGSNSPGSIDSS  184

Query  418  MDMHSD  401
            MDMH++
Sbjct  185  MDMHAE  190



>ref|XP_004489928.1| PREDICTED: uncharacterized protein LOC101504971 [Cicer arietinum]
Length=196

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 78/138 (57%), Gaps = 14/138 (10%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
            T D   ++   NELDY  EE   SPR+  Q+QQPQ  M + + GFPV           QG
Sbjct  72   TVDVLNYIQ--NELDYN-EEPSMSPRAPPQQQQPQPMMPVTSSGFPVTSGSSGQTVPGQG  128

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLA-QGSYPPNNAMPSACGMQNNDTGYLQS  455
            LRS +S++QPK+ VFSNALSSP+R SLQ Y +  +G +   N  PS          + Q 
Sbjct  129  LRSEYSENQPKNIVFSNALSSPVRRSLQLYQIGEEGGFSVGNGNPSFL--------HNQG  180

Query  454  RDANPPNSSDTLMDMHSD  401
            RD+N  N  D+ MDMH+D
Sbjct  181  RDSNSNN--DSAMDMHAD  196



>gb|ACG48000.1| holocarboxylase synthetase [Zea mays]
Length=195

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 72/161 (45%), Gaps = 27/161 (17%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D   H+   +E+ YG +    SPRS +  Q    TMH+PN  
Sbjct  57   LYEWILRQHENGLRLTVADVASHIQ--HEIQYGGDNASASPRSQYPSQSTAPTMHIPNTS  114

Query  679  fpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMP  500
                         P GL          S VFS+ALSSPIR SLQ YHL Q          
Sbjct  115  NQQPSPSLFAPGNP-GL-----TQSKNSMVFSSALSSPIRRSLQPYHLEQ----------  158

Query  499  SACGMQNNDTGYLQ---SRDANPPNSSDTLMDMHSDTPDHE  386
                  + D GY     SRD NP  S+D+ MDMHSD+P H+
Sbjct  159  ------DGDAGYFANGASRDVNPTASNDSSMDMHSDSPAHD  193



>ref|XP_010530126.1| PREDICTED: uncharacterized protein LOC104806765 [Tarenaya hassleriana]
Length=192

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 20/129 (16%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGL---RSGHSDH  608
            NELD   EE   SPR+     QP  T+H+ N GF          S P  +   R   +++
Sbjct  81   NELDSYVEEASMSPRA---PSQP--TVHVTNSGFMACSG----TSCPTAVSVSRPEQNEN  131

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSS  428
            QPK+SVFSNALSSPIR SLQ+Y + QG   P++   +    QN        R +N P S+
Sbjct  132  QPKNSVFSNALSSPIRRSLQNYQIQQGGCFPSSGATTRSNEQN--------RGSNSPRSN  183

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  184  DSSMDMHAD  192



>gb|KHN46391.1| hypothetical protein glysoja_031709, partial [Glycine soja]
Length=167

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 68/132 (52%), Gaps = 17/132 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+   +QQ Q  M +   GFPV           QGLRS H D+Q K
Sbjct  47   NELDYCGEEPCMSPRAPQHQQQSQPVMQVTGSGFPVTSGFSGQTIVGQGLRSEHCDNQSK  106

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG------YLQSRDANPP  437
            + VFSNA S+P+R       + +G Y      PS   M N +        + QSRD+   
Sbjct  107  NYVFSNASSNPVR------QIGEGGY-----HPSGLSMGNVNRSIEPNLLHQQSRDSAAF  155

Query  436  NSSDTLMDMHSD  401
            +S+D+ MDMH+D
Sbjct  156  SSNDSAMDMHAD  167



>ref|XP_006606909.1| PREDICTED: uncharacterized protein LOC100778513, partial [Glycine 
max]
Length=175

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 67/132 (51%), Gaps = 17/132 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE   SPR+   +QQ Q  M +   GFPV           QGLRS H D Q K
Sbjct  55   NELDYCGEEPCMSPRAPQHQQQSQPVMQVTGSGFPVTSGFSGQTIVGQGLRSEHCDKQSK  114

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTG------YLQSRDANPP  437
            + VFSNA S+P+R       + +G Y      PS   M N +        + QSRD+   
Sbjct  115  NYVFSNASSNPVR------QIGEGGY-----HPSGLSMGNVNRSIEPNLLHQQSRDSAAF  163

Query  436  NSSDTLMDMHSD  401
            +S+D+ MDMH+D
Sbjct  164  SSNDSAMDMHAD  175



>ref|XP_009113575.1| PREDICTED: uncharacterized protein LOC103838878 [Brassica rapa]
Length=190

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 68/126 (54%), Gaps = 16/126 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+     QP   M++ + G   +    CP + P  +RS   ++Q K
Sbjct  81   NELECCTEEPPISPRAP--PTQP--AMNVTSSGLMASSGTSCPTAVPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSPIR SLQ+YH+ QG Y       S             +R +N P S D+ 
Sbjct  136  NSVFSNALSSPIRRSLQNYHIPQGGYISGGTRSSEL-----------NRGSNSPGSFDSS  184

Query  418  MDMHSD  401
            MDMH+D
Sbjct  185  MDMHAD  190



>ref|XP_006397139.1| hypothetical protein EUTSA_v10028989mg [Eutrema salsugineum]
 gb|ESQ38592.1| hypothetical protein EUTSA_v10028989mg [Eutrema salsugineum]
Length=190

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 67/126 (53%), Gaps = 16/126 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE   SPR+      PQ TMH+ N G   +    CP + P  +RS   ++Q K
Sbjct  81   NELECCIEEPSMSPRAP----PPQPTMHVTNSGLMTSSGTSCPTAVPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSP+R SLQ+Y + QG Y       S             +R +N P S D+ 
Sbjct  136  NSVFSNALSSPVRRSLQNYQIPQGGYISGATRSSEL-----------NRGSNSPGSIDSS  184

Query  418  MDMHSD  401
            MDMH+D
Sbjct  185  MDMHAD  190



>ref|NP_001149250.1| holocarboxylase synthetase [Zea mays]
 gb|ACG34716.1| holocarboxylase synthetase [Zea mays]
Length=157

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 71/161 (44%), Gaps = 27/161 (17%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D    + L  E+ YG +    SPR  +  Q    T+H+PN  
Sbjct  19   LYEWILRQHENGLRLTVADVASRIQL--EIQYGGDNASASPRPQYPSQSTAPTVHIPNTS  76

Query  679  fpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMP  500
                         P GL          S VFSNALSSPIR SLQ YHL            
Sbjct  77   NQQPSPSLFAPGNP-GL-----TQSKNSMVFSNALSSPIRRSLQPYHLE-----------  119

Query  499  SACGMQNNDTGYL---QSRDANPPNSSDTLMDMHSDTPDHE  386
                 Q+ DTGY     SRD NP  S+D+ MDMHSD+P H+
Sbjct  120  -----QDGDTGYFVNGASRDMNPTASNDSSMDMHSDSPVHD  155



>ref|XP_003574456.1| PREDICTED: uncharacterized protein LOC100833414 [Brachypodium 
distachyon]
Length=199

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 69/131 (53%), Gaps = 18/131 (14%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E++YG E+   SPRS    Q  Q +MH+PN             + P GL       QPK+
Sbjct  85   EIEYGGEDPLVSPRSQCTVQSFQASMHIPNTSNQQASPSLLAQAIP-GL-------QPKN  136

Query  595  S-VFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            S VF +ALSSP+R SLQ YHL Q S   ++A    C      TG   + ++N   S+D+ 
Sbjct  137  SMVFCSALSSPVRQSLQPYHLQQDSGTGHSADGILC------TG---THESNSAASNDSF  187

Query  418  MDMHSDTPDHE  386
            MDMHSD P HE
Sbjct  188  MDMHSDNPAHE  198



>gb|ACR36431.1| unknown [Zea mays]
 tpg|DAA61150.1| TPA: holocarboxylase synthetase [Zea mays]
Length=195

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 71/161 (44%), Gaps = 27/161 (17%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D    + L  E+ YG +    SPR  +  Q    T+H+PN  
Sbjct  57   LYEWILRQHENGLRLTVADVASRIQL--EIQYGGDNASASPRPQYPSQSTAPTVHIPNTS  114

Query  679  fpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMP  500
                         P GL          S VFSNALSSPIR SLQ YHL            
Sbjct  115  NQQPSPSLFAPGNP-GL-----TQSKNSMVFSNALSSPIRRSLQPYHLE-----------  157

Query  499  SACGMQNNDTGYL---QSRDANPPNSSDTLMDMHSDTPDHE  386
                 Q+ DTGY     SRD NP  S+D+ MDMHSD+P H+
Sbjct  158  -----QDGDTGYFVNGASRDMNPTASNDSSMDMHSDSPVHD  193



>ref|XP_007143574.1| hypothetical protein PHAVU_007G083200g [Phaseolus vulgaris]
 gb|ESW15568.1| hypothetical protein PHAVU_007G083200g [Phaseolus vulgaris]
Length=203

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 69/132 (52%), Gaps = 15/132 (11%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMH--LpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            NELDY  EE   SPR+  Q QQ Q  MH  +   GFPV           QGLRS H D Q
Sbjct  81   NELDYCGEEPSMSPRAPQQHQQSQPLMHATVTGSGFPVTTGFPGQTIMGQGLRSEHCDIQ  140

Query  604  PKSSVFSNALSSPIR--GSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL--QSRDANPP  437
             K+SVFSN LS+P+R  G + +Y         ++ +    G +N +  +L  QSRD+   
Sbjct  141  SKNSVFSNVLSNPVRQFGEVGNY---------SSGLSMGIGSRNTEGNFLHQQSRDSAAF  191

Query  436  NSSDTLMDMHSD  401
              +D  MDMH+D
Sbjct  192  IFNDAAMDMHAD  203



>ref|XP_009407273.1| PREDICTED: uncharacterized protein LOC103990001 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 73/143 (51%), Gaps = 7/143 (5%)
 Frame = -3

Query  811  TCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQG  632
              D   H+   NE+ YG +++ TSP   FQ QQ Q   H  N      P      S    
Sbjct  73   VADVVTHIQ--NEMGYGGDDSSTSPVLEFQ-QQTQSASHFTNSSIQPFPGLSGQVSTGIA  129

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQ-GSYPPNNAMPSACGMQNNDTGYLQS  455
             RSG SDH  KSS FSNALSS   GSL HY LAQ G Y  N       G +++D    Q+
Sbjct  130  PRSGDSDH-AKSSAFSNALSSSACGSLPHYRLAQGGGYYTNGPSTGDAGARSHDPN--QN  186

Query  454  RDANPPNSSDTLMDMHSDTPDHE  386
            ++ +  + +D+ MDM+ D+P HE
Sbjct  187  QELHSLSFNDSSMDMNPDSPKHE  209



>ref|XP_004969043.1| PREDICTED: uncharacterized protein LOC101785264 [Setaria italica]
Length=203

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E+DYG  +   SPR     Q PQI     N   P     +   +A    R   SD Q K+
Sbjct  83   EMDYGGTDAHVSPRV---HQHPQIANPFTNSVAPPATGLYGQTAAGFAPRPSLSD-QSKN  138

Query  595  SVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            ++FSNALSSP+R SLQ+YHLAQG+     N  P+  G          +R+ N  +S+DT 
Sbjct  139  TIFSNALSSPVRRSLQNYHLAQGAGNGGRNTEPNLAGA---------NRETNSASSNDTS  189

Query  418  MDMHSDTPDHEF  383
            MDM SD+  +EF
Sbjct  190  MDMVSDSAGNEF  201



>ref|XP_002872465.1| hypothetical protein ARALYDRAFT_352054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48724.1| hypothetical protein ARALYDRAFT_352054 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 16/126 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   +E P SPR+     QP  TMH+ N G         P   P  +RS   ++Q K
Sbjct  81   NELECCIDEPPISPRAP--PTQP--TMHVTNSGLMATSGTSFPTPVPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSPIR SLQ+Y + QG+Y       ++ G ++++     +R +N P S D+ 
Sbjct  136  NSVFSNALSSPIRRSLQNYQIPQGAY-------TSGGTRSSEV----NRGSNSPGSIDSS  184

Query  418  MDMHSD  401
            MDMH++
Sbjct  185  MDMHAE  190



>ref|XP_009380423.1| PREDICTED: uncharacterized protein LOC103968822 [Musa acuminata 
subsp. malaccensis]
Length=209

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 10/136 (7%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQ  605
            L NE+ +G E+T  SP      Q PQ +M   +     +      A      R+GH + +
Sbjct  78   LQNEIGHGGEDTAMSPIPQLPHQYPQSSMQFGSTNIHDSSTIGTAAVCLA--RTGHRE-E  134

Query  604  PKSSVFSNALSSPIRGSLQHYHLAQ----GSYPPNNAMPSACGMQNNDTGYL-QSRDANP  440
             K +VFSNALSSP+R SL+ YH AQ    G    + A+P    ++N+ + +L QS+D+  
Sbjct  135  TKDTVFSNALSSPVRRSLESYHPAQGGGDGGASHDTALPQENTIRNHGSNHLDQSQDSR-  193

Query  439  PNSSDTLMDMHSDTPD  392
               SD+ MDMHSD  D
Sbjct  194  -TCSDSSMDMHSDRAD  208



>gb|EMS62206.1| hypothetical protein TRIUR3_09092 [Triticum urartu]
Length=214

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 75/167 (45%), Gaps = 29/167 (17%)
 Frame = -3

Query  874  VHRFDIIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMH  695
             H   +   I  Q+ + L     D   H+   +E+ YG +    SPRS +  Q    T+H
Sbjct  71   CHEEKLYEWILRQHENGLRLTVGDIASHVQ--HEIQYGGDNPLASPRSQYASQSTHATVH  128

Query  694  LpnggfpvnpnpfcPASAPQGLRSGHSDHQPK-SSVFSNALSSPIRGSLQHYHLAQGSYP  518
            +PN               P GL       QPK S+VFSNALSSP+R  LQ YHL  G   
Sbjct  129  MPNTSNQQPSASLFALGNP-GLT------QPKNSAVFSNALSSPVRRGLQPYHLDHG---  178

Query  517  PNNAMPSACGMQNNDTGYLQ---SRDANPPNSSDTLMDMHSDTPDHE  386
                          D GY     +R+ NP  S+D+ MDMHSD+P H+
Sbjct  179  -------------GDAGYFANGLAREPNPTASNDSSMDMHSDSPAHD  212



>gb|AEX12503.1| hypothetical protein 2_4391_01, partial [Pinus taeda]
 gb|AEX12504.1| hypothetical protein 2_4391_01, partial [Pinus taeda]
 gb|AEX12505.1| hypothetical protein 2_4391_01, partial [Pinus taeda]
 gb|AEX12506.1| hypothetical protein 2_4391_01, partial [Pinus taeda]
Length=128

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 60/124 (48%), Gaps = 40/124 (32%)
 Frame = -3

Query  637  QGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMP-------------  500
            QG R GHSD Q K+SVFSNALSSP+R SLQ +H+AQG  Y  NNA+              
Sbjct  4    QGPRQGHSD-QNKNSVFSNALSSPVRRSLQPFHMAQGGYYSANNALQVGNGGRRMGATTD  62

Query  499  ----------SACGMQNNDTGYL---------------QSRDANPPNSSDTLMDMHSDTP  395
                      +  G QN+++  +               Q RD N    +D+ MDMH D+P
Sbjct  63   QDQGGFHGGHTLAGPQNSESNVMNSMVSLSNAYGQQPHQIRDVNSYGENDSSMDMHPDSP  122

Query  394  DHEF  383
             H F
Sbjct  123  AHGF  126



>emb|CDX99511.1| BnaC09g24810D [Brassica napus]
Length=191

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 72/126 (57%), Gaps = 15/126 (12%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+  Q  QP   M++ N G   +    CP + P  +RS   ++Q K
Sbjct  81   NELECCTEEPPISPRA--QPTQP--AMNVTNSGLMASSGTSCPTAVPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSPIR SLQ+Y + QG          + G ++++     +R +N P S D+ 
Sbjct  136  NSVFSNALSSPIRRSLQNYQIPQG------GGYISVGTRSSEL----NRGSNSPGSFDSS  185

Query  418  MDMHSD  401
            MDMH+D
Sbjct  186  MDMHAD  191



>ref|XP_010238083.1| PREDICTED: uncharacterized protein LOC104584661 [Brachypodium 
distachyon]
Length=195

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 63/132 (48%), Gaps = 25/132 (19%)
 Frame = -3

Query  772  LDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKSS  593
            + +G +    SPRS +  Q  Q  +H+PN               P GL          S+
Sbjct  84   IQHGGDNPSASPRSQYASQNMQANVHMPNTSNQQPSPSLFALGNP-GL-----TQSKNSA  137

Query  592  VFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ---SRDANPPNSSDT  422
            VFSNALSSP+R SLQ YHL QG                 D GY     +R++NP  S+D+
Sbjct  138  VFSNALSSPVRRSLQPYHLEQGG----------------DAGYFANGLNRESNPTASNDS  181

Query  421  LMDMHSDTPDHE  386
             MDMHSD+P H+
Sbjct  182  SMDMHSDSPAHD  193



>ref|XP_006660563.1| PREDICTED: uncharacterized protein LOC102719228 [Oryza brachyantha]
Length=196

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 75/163 (46%), Gaps = 31/163 (19%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D   H+   +E+ YG++    SPRS    Q  Q T+H+PN  
Sbjct  58   LYEWILRQHENGLRLTVADIASHIQ--HEIQYGSDNASASPRSQHASQSTQATVHIPNTM  115

Query  679  fpvnpnpfcPASAPQGLRSGHSD--HQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNA  506
                        +P     G++       S+VFS+ALSSP+R SLQ +HL QG       
Sbjct  116  NQQP--------SPSLFALGNTGLVQSKNSAVFSSALSSPVRRSLQPFHLEQG-------  160

Query  505  MPSACGMQNNDTGYLQ---SRDANPPNSSDTLMDMHSDTPDHE  386
                      D GY     +RD N   S+D+ MDMHSD+P H+
Sbjct  161  ---------GDAGYFANGVNRDQNSTASNDSSMDMHSDSPAHD  194



>gb|AFK38910.1| unknown [Medicago truncatula]
Length=168

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NELDY  EE  TSPR+  Q QQ Q  +H+ + GFPV     C     QGLRS + D+Q K
Sbjct  81   NELDYFGEEQSTSPRAPLQHQQLQPAVHVASSGFPVTSGSSCQTVIGQGLRSENWDNQSK  140

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPP  515
            S  FSNA S+ +  SL+HY + +G   P
Sbjct  141  SFEFSNASSNSVHRSLEHYQIGEGRELP  168



>ref|XP_010455374.1| PREDICTED: uncharacterized protein LOC104736976 [Camelina sativa]
Length=190

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 12/101 (12%)
 Frame = -3

Query  703  TMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGS  524
            TMH+ + G   +    CP +AP  +RS   ++Q K+SVFSNALSSPIR SLQ+Y + QG 
Sbjct  102  TMHITHSGLMASSGTSCPIAAPV-VRSEQCENQAKNSVFSNALSSPIRRSLQNYQIPQGG  160

Query  523  YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTLMDMHSD  401
            Y    A  S             +R +N P S D+ MDMH++
Sbjct  161  YTSGGARSSEL-----------NRGSNSPGSIDSSMDMHAE  190



>ref|XP_010437962.1| PREDICTED: uncharacterized protein LOC104721627 [Camelina sativa]
Length=190

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 57/101 (56%), Gaps = 12/101 (12%)
 Frame = -3

Query  703  TMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGS  524
            TMH+ + G   +    CP +AP  +RS   ++Q K+SVFSNALSSPIR SLQ+Y + QG 
Sbjct  102  TMHITHSGLMASSGTSCPLAAPV-VRSEQCENQAKNSVFSNALSSPIRRSLQNYQIPQGG  160

Query  523  YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTLMDMHSD  401
            Y    A  S             +R +N P S D+ MDMH++
Sbjct  161  YTSGGARSSEL-----------NRGSNSPGSIDSSMDMHAE  190



>emb|CDY60294.1| BnaC03g72860D [Brassica napus]
Length=134

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+      PQ TMH+ N G   + +  CP + P  +RS   ++Q K
Sbjct  31   NELESCTEEHPISPRAP----PPQPTMHVTNSGLITSSDTSCPTAVPV-VRSEQCENQAK  85

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSY  521
            SSVFSNALS P+R SLQ+Y + QG Y
Sbjct  86   SSVFSNALSIPVRRSLQNYQIPQGGY  111



>gb|AEX12507.1| hypothetical protein 2_4391_01, partial [Pinus taeda]
Length=128

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 59/124 (48%), Gaps = 40/124 (32%)
 Frame = -3

Query  637  QGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMP-------------  500
            QG R GHSD Q K+SVFSNALSSP+R SLQ +H+AQG  Y  NNA               
Sbjct  4    QGPRQGHSD-QNKNSVFSNALSSPVRRSLQPFHMAQGGYYSANNASQVGNGGRRMGATTD  62

Query  499  ----------SACGMQNNDTGYL---------------QSRDANPPNSSDTLMDMHSDTP  395
                      +  G QN+++  +               Q RD N    +D+ MDMH D+P
Sbjct  63   QDQGGFHGGHTLAGPQNSESNVMNSMVSLSNAYGQQPHQIRDVNSYGENDSSMDMHPDSP  122

Query  394  DHEF  383
             H F
Sbjct  123  AHGF  126



>ref|XP_010542952.1| PREDICTED: uncharacterized protein LOC104815997 [Tarenaya hassleriana]
Length=188

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 69/129 (53%), Gaps = 24/129 (19%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSD---H  608
            NELD   EE   S R+     QP  TM + N G           S P  +  G +D   +
Sbjct  81   NELDCCMEEASMSSRA---PSQP--TMQVNNSG----------TSCPAAVSVGRTDQSEN  125

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSS  428
            Q K+SVFSNALSSPIR SLQ+Y + QG    ++   S  G  NN+    Q+R +N P S+
Sbjct  126  QSKNSVFSNALSSPIRRSLQNYQIPQGG---SHFHSSTRGGSNNNE---QNRGSNSPGSN  179

Query  427  DTLMDMHSD  401
            D+ MDMH+D
Sbjct  180  DSSMDMHAD  188



>gb|EEE54897.1| hypothetical protein OsJ_02417 [Oryza sativa Japonica Group]
Length=124

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 62/132 (47%), Gaps = 16/132 (12%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            ELDYG  +   SPR       P     +              A  P       SD Q K+
Sbjct  7    ELDYGGNDPHVSPRVHQHSANPFANSSIQPSAGSYGQATVGFAPRPS-----ISD-QSKN  60

Query  595  SVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL-QSRDANPPNSSDTL  419
            ++FSNALSSP+R SLQ YHL QG         S  G +N +T    Q+R+ N   S+DT 
Sbjct  61   TIFSNALSSPVRRSLQSYHLTQG---------SGNGGRNAETNSAGQNRETNSGGSNDTS  111

Query  418  MDMHSDTPDHEF  383
            MDM SD+  +E+
Sbjct  112  MDMVSDSAGNEY  123



>ref|NP_001062977.1| Os09g0360400 [Oryza sativa Japonica Group]
 dbj|BAD23319.1| putative holocarboxylase synthetase [Oryza sativa Japonica Group]
 dbj|BAF24891.1| Os09g0360400 [Oryza sativa Japonica Group]
 gb|EAZ08783.1| hypothetical protein OsI_31044 [Oryza sativa Indica Group]
 gb|EAZ44445.1| hypothetical protein OsJ_29059 [Oryza sativa Japonica Group]
 dbj|BAG92474.1| unnamed protein product [Oryza sativa Japonica Group]
Length=196

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 73/163 (45%), Gaps = 31/163 (19%)
 Frame = -3

Query  859  IIHVINPQNNSCLLHHTCDSCYHLNL*NELDYGAEETPTSPRSSFQEQQPQITMHLpngg  680
            +   I  Q+ + L     D   H+   +E+ YG +    SPRS    Q  Q T+ +PN  
Sbjct  58   LYEWILRQHENGLRLTVADIASHIQ--HEIQYGGDNASASPRSQHASQSTQATVPIPNTM  115

Query  679  fpvnpnpfcPASAPQGLRSGHSD--HQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNA  506
                        +P     G++       S+VFSNALSSP+R SLQ +HL QG       
Sbjct  116  SQQP--------SPNLFALGNTGLVQSKNSAVFSNALSSPVRRSLQPFHLEQG-------  160

Query  505  MPSACGMQNNDTGYLQ---SRDANPPNSSDTLMDMHSDTPDHE  386
                      D GY     +RD N   S+D+ MDMHSD+P H+
Sbjct  161  ---------GDAGYFANGVNRDQNSTASNDSSMDMHSDSPAHD  194



>ref|NP_001043444.2| Os01g0589500 [Oryza sativa Japonica Group]
 dbj|BAF05358.2| Os01g0589500, partial [Oryza sativa Japonica Group]
Length=244

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNS  431
            Q K+++FSNALSSP+R SLQ YHL QGS     NA  ++ G         Q+R+ N   S
Sbjct  177  QSKNTIFSNALSSPVRRSLQSYHLTQGSGNGGRNAETNSAG---------QNRETNSGGS  227

Query  430  SDTLMDMHSDTPDHEF  383
            +DT MDM SD+  +E+
Sbjct  228  NDTSMDMVSDSAGNEY  243



>dbj|BAB89033.1| putative holocarboxylase synthetase [Oryza sativa Japonica Group]
 dbj|BAC78568.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG88159.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94159.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNS  431
            Q K+++FSNALSSP+R SLQ YHL QGS     NA  ++ G         Q+R+ N   S
Sbjct  133  QSKNTIFSNALSSPVRRSLQSYHLTQGSGNGGRNAETNSAG---------QNRETNSGGS  183

Query  430  SDTLMDMHSDTPDHEF  383
            +DT MDM SD+  +E+
Sbjct  184  NDTSMDMVSDSAGNEY  199



>gb|KJB40433.1| hypothetical protein B456_007G063000 [Gossypium raimondii]
Length=170

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 28/147 (19%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSF---QEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHS  614
            L NEL+YGAEE+P SPR SF   Q+Q PQ  MH+     P +  P   ++  QG+RSG  
Sbjct  41   LQNELEYGAEESPMSPRLSFQQQQQQHPQTAMHMNTLSAPFSSTPISASTDGQGVRSG--  98

Query  613  DHQPKSSVFSNALSSPIRGSLQHYHLA--QGSYPPNNAMPSACGM---QNNDTG--YLQS  455
                             RGSLQHYH    Q  +  NN + S+      +N++T   + Q+
Sbjct  99   ---------------DYRGSLQHYHSVHHQVGFHSNNVVASSFAANRPRNHETNCSHQQN  143

Query  454  RDANPPNSSDTL-MDMHSDTPDHEFPY  377
               N   S+D + M MH+++P H  P+
Sbjct  144  GGGNSSISNDCMDMPMHAESPVHALPF  170



>gb|EAY74747.1| hypothetical protein OsI_02639 [Oryza sativa Indica Group]
Length=225

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNS  431
            Q K+++FSNALSSP+R SLQ YHL QGS     NA  ++ G         Q+R+ N   S
Sbjct  158  QSKNTIFSNALSSPVRRSLQSYHLTQGSGNGGRNAETNSAG---------QNRETNSGGS  208

Query  430  SDTLMDMHSDTPDHEF  383
            +DT MDM SD+  +E+
Sbjct  209  NDTSMDMVSDSAGNEY  224



>gb|AAM62508.1| unknown [Arabidopsis thaliana]
Length=191

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 10/77 (13%)
 Frame = -3

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSR  452
            +RS   ++Q K+SVFSNALSSPIR SLQ+Y + QG Y       S+            +R
Sbjct  125  VRSEQCENQAKNSVFSNALSSPIRRSLQNYQIPQGGYTSGGTTRSS----------EVNR  174

Query  451  DANPPNSSDTLMDMHSD  401
             +N P S D+ MDMH++
Sbjct  175  GSNSPGSIDSSMDMHAE  191



>ref|XP_006288727.1| hypothetical protein CARUB_v10002038mg [Capsella rubella]
 gb|EOA21625.1| hypothetical protein CARUB_v10002038mg [Capsella rubella]
Length=190

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 53/101 (52%), Gaps = 12/101 (12%)
 Frame = -3

Query  703  TMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGS  524
            TMH+ + G   +    CP S P   RS H ++Q K+SVFSNALSSPIR SLQ Y +  G 
Sbjct  102  TMHITHSGLMASSGTSCPISVPVA-RSEHCENQAKNSVFSNALSSPIRRSLQSYQIPHGG  160

Query  523  YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTLMDMHSD  401
            Y       S             +R +N P S D+ MDMH++
Sbjct  161  YTSGGTRSSEV-----------NRGSNSPGSIDSSMDMHAE  190



>ref|NP_192721.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB39650.1| putative protein [Arabidopsis thaliana]
 emb|CAB78106.1| putative protein [Arabidopsis thaliana]
 gb|AAL67034.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14309.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82803.1| uncharacterized protein AT4G09830 [Arabidopsis thaliana]
Length=191

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 10/77 (13%)
 Frame = -3

Query  631  LRSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSR  452
            +RS   ++Q K+SVFSNALSSPIR SLQ+Y + QG Y       S+            +R
Sbjct  125  VRSEQCENQAKNSVFSNALSSPIRRSLQNYQIPQGGYTSGGTTRSS----------EVNR  174

Query  451  DANPPNSSDTLMDMHSD  401
             +N P S D+ MDMH++
Sbjct  175  GSNSPGSIDSSMDMHAE  191



>gb|KHN17036.1| hypothetical protein glysoja_011510 [Glycine soja]
Length=225

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 63/127 (50%), Gaps = 16/127 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfp-vnpnpfcPASAPQGLRSGHSDHQP  602
            NELDY  EE   SPR+   +QQ Q  M +  G    V           Q LR  H D+Q 
Sbjct  114  NELDYCGEEPCMSPRAPLHQQQSQPVMQVTTGAGFPVTTGFSGQTIVGQELRPEHCDNQS  173

Query  601  KSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDT  422
            K+S+FSNALS+P+R       + +G        PS   M N +    QS D+   +S+D+
Sbjct  174  KNSMFSNALSNPVR------QIGEG-----GNHPSGLSMGNGN----QSTDSAAFSSNDS  218

Query  421  LMDMHSD  401
             MDMH+D
Sbjct  219  AMDMHAD  225



>dbj|BAJ85416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 61/139 (44%), Gaps = 40/139 (29%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSS--------FQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSG  620
            E+DYG  +   SPR          F   QP   ++                       SG
Sbjct  113  EIDYGGTDAHVSPRVHQHPMTVNPFTSIQPSAGLYAQAT-------------------SG  153

Query  619  HS-----DHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQS  455
            H+     + Q K+++FSNALSSP+R SLQ YHL QG+           G         Q+
Sbjct  154  HAPRPSLNDQSKNTIFSNALSSPVRRSLQTYHLTQGA--------GNGGRNTEANSAAQN  205

Query  454  RDANPPNSSDTLMDMHSDT  398
            R+AN P+S+DT MDM SD 
Sbjct  206  REANSPSSNDTSMDMVSDI  224



>emb|CDX86890.1| BnaA09g22800D [Brassica napus]
Length=187

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 66/126 (52%), Gaps = 19/126 (15%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+     QP   M++ N G   +    CP + P  +RS   ++Q K
Sbjct  81   NELECCTEEPPISPRAP--PTQP--AMNVTNSGLMASSGTSCPTAVPV-VRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            +SVFSNALSSPIR SLQ+Y   QG Y       S             +R +N P S D+ 
Sbjct  136  NSVFSNALSSPIRRSLQNY---QGGYISGGTRSSEL-----------NRGSNSPGSFDSS  181

Query  418  MDMHSD  401
            MDMH+D
Sbjct  182  MDMHAD  187



>ref|XP_002458073.1| hypothetical protein SORBIDRAFT_03g026490 [Sorghum bicolor]
 gb|EES03193.1| hypothetical protein SORBIDRAFT_03g026490 [Sorghum bicolor]
Length=203

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E+DYG  +   SPR +   Q PQI     N   P     +  ++     R   +D Q K+
Sbjct  83   EIDYGGTDAHVSPRVN---QHPQIANPFTNSVVPPGTGLYGQSAPGFAPRPSVTD-QSKN  138

Query  595  SVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            ++FSNALSSP+R SLQ+YH+ QG+     NA  +  G          +R+ N  +S+DT 
Sbjct  139  TIFSNALSSPVRRSLQNYHITQGAGNGGRNAEANLAGA---------NRETNSASSNDTS  189

Query  418  MDMHSDTPDHEF  383
            MDM +D+  +EF
Sbjct  190  MDMVADSAGNEF  201



>gb|EAZ06899.1| hypothetical protein OsI_29138 [Oryza sativa Indica Group]
Length=196

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 33/137 (24%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E++YG +   TSPRS    Q  Q  MH+PN      P+     S P             S
Sbjct  85   EIEYGGDNALTSPRSQHAFQNLQAPMHIPNTSTQQPPSCSITPSNPS----------KDS  134

Query  595  SVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-------SRDANPP  437
             +FS ALSSP+R +LQ YH+ QG                 DTG          +RD++P 
Sbjct  135  MIFSKALSSPVRQNLQLYHVQQG----------------GDTGCFADGIFCPGNRDSDPA  178

Query  436  NSSDTLMDMHSDTPDHE  386
             S+D+ +DMHSD+P H+
Sbjct  179  ASNDSSVDMHSDSPGHD  195



>ref|NP_001242256.1| uncharacterized protein LOC100801119 [Glycine max]
 gb|ACU20752.1| unknown [Glycine max]
Length=192

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 16/127 (13%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfp-vnpnpfcPASAPQGLRSGHSDHQP  602
            NELDY  EE   SPR+   +QQ Q  M +  G    V           Q +R  H D+Q 
Sbjct  81   NELDYCGEEPCMSPRAPLHQQQSQPVMQVTTGAGFPVTTGFSGQTIVGQEVRPEHCDNQS  140

Query  601  KSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDT  422
            K+S+FSNALS+P+R       + +G        PS   M N +    QS D+   +S+D+
Sbjct  141  KNSMFSNALSNPVR------QIGEG-----GNHPSGLSMGNGN----QSTDSAAFSSNDS  185

Query  421  LMDMHSD  401
             MDMH+D
Sbjct  186  AMDMHAD  192



>gb|KHG24783.1| hypothetical protein F383_09417 [Gossypium arboreum]
Length=208

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (48%), Gaps = 28/147 (19%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSF---QEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHS  614
            L NEL+YG EE+P SPR SF   Q+Q PQ  MH+     P +  P   ++  QG+RSG  
Sbjct  79   LQNELEYGVEESPMSPRLSFQQQQQQHPQTAMHMNTLSAPFSSTPISASTDGQGVRSG--  136

Query  613  DHQPKSSVFSNALSSPIRGSLQHYHLA--QGSYPPNNAMPSACGM-----QNNDTGYLQS  455
                             RG+LQHYH    Q  +  NN + S+           +  + Q+
Sbjct  137  ---------------DCRGNLQHYHSVHHQVGFHSNNVVASSFAANRPRNHEINCSHQQN  181

Query  454  RDANPPNSSDTL-MDMHSDTPDHEFPY  377
             + N   S+D + M MH+D+P H  P+
Sbjct  182  GEGNSSISNDCMDMPMHADSPVHALPF  208



>ref|XP_003569287.1| PREDICTED: uncharacterized protein LOC100830936 [Brachypodium 
distachyon]
Length=200

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 10/71 (14%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYL-QSRDANPPNS  431
            QPK+ +FSNALSSP+  +LQ+YHL QG         +  G +NN+   + Q R+AN  +S
Sbjct  133  QPKNMIFSNALSSPVCRTLQNYHLTQG---------AGSGGRNNEANSVGQHREANSASS  183

Query  430  SDTLMDMHSDT  398
            +DT MDM SD+
Sbjct  184  NDTSMDMVSDS  194



>gb|EMS60900.1| hypothetical protein TRIUR3_28509 [Triticum urartu]
Length=162

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSS  428
            Q K+++FSNALSSP+R SLQ YHL QG      A       + N  G  Q+R+AN  +S+
Sbjct  95   QSKNTIFSNALSSPVRRSLQTYHLTQG------AGNGGRNTEANSAG--QNREANSASSN  146

Query  427  DTLMDMHSDT  398
            DT MDM SD+
Sbjct  147  DTSMDMVSDS  156



>gb|EMT31658.1| hypothetical protein F775_32794 [Aegilops tauschii]
 emb|CDM83257.1| unnamed protein product [Triticum aestivum]
Length=200

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSS  428
            Q K+++FSNALSSP+R SLQ YHL QG      A       + N  G  Q+R+AN  +S+
Sbjct  133  QSKNTIFSNALSSPVRRSLQTYHLTQG------AGNGGRNTEANSAG--QNREANSASSN  184

Query  427  DTLMDMHSDT  398
            DT MDM SD+
Sbjct  185  DTSMDMVSDS  194



>gb|AAP80657.1|AF479038_1 holocarboxylase synthetase, partial [Triticum aestivum]
Length=208

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNSS  428
            Q K+++FSNALSSP+R SLQ YHL QG      A       + N  G  Q+R+AN  +S+
Sbjct  141  QSKNTIFSNALSSPVRRSLQTYHLTQG------AGNGGRNTEANSAG--QNREANSASSN  192

Query  427  DTLMDMHSDT  398
            DT MDM SD+
Sbjct  193  DTSMDMVSDS  202



>ref|XP_006644324.1| PREDICTED: uncharacterized protein LOC102720747 [Oryza brachyantha]
Length=200

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 10/76 (13%)
 Frame = -3

Query  607  QPKSSVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNS  431
            Q K+++FSNALSSP+R SLQ YHL QGS     NA  ++ G         Q+ + N   S
Sbjct  133  QSKNTIFSNALSSPVRRSLQSYHLTQGSGNGGRNAETNSAG---------QNIETNSGGS  183

Query  430  SDTLMDMHSDTPDHEF  383
            +DT MDM SD+  +E+
Sbjct  184  NDTSMDMVSDSAGNEY  199



>ref|XP_006826290.1| hypothetical protein AMTR_s00004p00061310 [Amborella trichopoda]
 gb|ERM93527.1| hypothetical protein AMTR_s00004p00061310 [Amborella trichopoda]
Length=207

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 61/130 (47%), Gaps = 11/130 (8%)
 Frame = -3

Query  784  L*NELDYGAEETPTSPRSSFQEQQPQIT--MHLpnggfpvnpnpfcPASAPQGLRSGHSD  611
            L NELDYG EE   SP    Q   P +   MH P     ++        + Q  R+ + D
Sbjct  79   LQNELDYGGEEASVSPARQLQ-HHPNLNPHMHFPTPSSQMHNVASGQLVSSQAQRAMNQD  137

Query  610  HQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPNS  431
             Q K+S+FSNALSSPIR SLQ     QG Y  N    +  G   N   +      N  N+
Sbjct  138  -QAKNSIFSNALSSPIRRSLQ-----QGGYYSNR--RNGSGDSENVGSHGSQSSQNEMNN  189

Query  430  SDTLMDMHSD  401
             D+ MDMH +
Sbjct  190  GDSTMDMHEE  199



>ref|XP_003567792.1| PREDICTED: uncharacterized protein LOC100842848 [Brachypodium 
distachyon]
Length=195

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 16/82 (20%)
 Frame = -3

Query  628  RSGHSDHQPKSSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRD  449
            R+ +SD     ++FSNALSSP+R SLQ YH  QG          A GM N      +S +
Sbjct  129  RASNSDQSKNPTLFSNALSSPVRRSLQSYHPTQG----------AAGMGN------RSVE  172

Query  448  ANPPNSSDTLMDMHSDTPDHEF  383
            AN  +S+DT MDM SD+  +E+
Sbjct  173  ANSTSSNDTTMDMVSDSVANEY  194



>ref|XP_006660106.1| PREDICTED: uncharacterized protein LOC102709021 [Oryza brachyantha]
Length=237

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 66/136 (49%), Gaps = 24/136 (18%)
 Frame = -3

Query  787  NL*NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDH  608
            N+ +E+ YG +   TSPRS +  Q  Q   H+PN             ++ Q L S  S  
Sbjct  123  NIEHEIAYGGDGALTSPRSQYTTQNLQAQSHIPN-------------TSTQQLSSCSSAA  169

Query  607  QPK--SSVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQSRDANPPN  434
             P   S VFS ALSSP R +LQ YH+ QG +          G   +      +RD+N   
Sbjct  170  NPSKDSMVFSKALSSPFRQNLQLYHIQQGGH---------AGCFADGIFSTGNRDSNLAV  220

Query  433  SSDTLMDMHSDTPDHE  386
             +D+ +DMHSD+P H+
Sbjct  221  PNDSSVDMHSDSPGHD  236



>dbj|BAC99427.1| putative holocarboxylase synthetase [Oryza sativa Japonica Group]
 gb|EAZ42639.1| hypothetical protein OsJ_27204 [Oryza sativa Japonica Group]
 dbj|BAG93839.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87324.1| unnamed protein product [Oryza sativa Japonica Group]
Length=196

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 33/137 (24%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E++YG +   TSPRS    Q  Q  MH+PN      P+     S P             S
Sbjct  85   EIEYGGDNALTSPRSQHAFQNLQAPMHIPNTSTQQPPSCSITPSNPS----------KDS  134

Query  595  SVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-------SRDANPP  437
             +FS ALSSP+R +LQ YH+ Q            CG    DTG          + D++P 
Sbjct  135  MIFSKALSSPVRQNLQLYHVQQ------------CG----DTGCFADGIFCPGNGDSDPA  178

Query  436  NSSDTLMDMHSDTPDHE  386
             S+D+ +DMHSD+P H+
Sbjct  179  ASNDSSVDMHSDSPGHD  195



>ref|XP_009134168.1| PREDICTED: uncharacterized protein LOC103858542 [Brassica rapa]
 emb|CDX90738.1| BnaA03g24180D [Brassica napus]
Length=190

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+     QP  TMH+ N G   +    CP + P  +RS   ++Q K
Sbjct  81   NELECCTEEPPISPRAP--PPQP--TMHVTNSGLIASSGTSCPTAVP-AIRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSY  521
            +SVFSNALSSPIR SLQ+Y + QG Y
Sbjct  136  NSVFSNALSSPIRRSLQNYQIPQGGY  161



>ref|NP_001061741.1| Os08g0397900 [Oryza sativa Japonica Group]
 dbj|BAD73670.1| putative holocarboxylase synthetase [Oryza sativa Japonica Group]
 dbj|BAF23655.1| Os08g0397900 [Oryza sativa Japonica Group]
 dbj|BAG98910.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 33/134 (25%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E++YG +   TSPRS    Q  Q  MH+PN      P+     S P             S
Sbjct  85   EIEYGGDNALTSPRSQHAFQNLQAPMHIPNTSTQQPPSCSITPSNPS----------KDS  134

Query  595  SVFSNALSSPIRGSLQHYHLAQGSYPPNNAMPSACGMQNNDTGYLQ-------SRDANPP  437
             +FS ALSSP+R +LQ YH+ Q            CG    DTG          + D++P 
Sbjct  135  MIFSKALSSPVRQNLQLYHVQQ------------CG----DTGCFADGIFCPGNGDSDPA  178

Query  436  NSSDTLMDMHSDTP  395
             S+D+ +DMHSD+P
Sbjct  179  ASNDSSVDMHSDSP  192



>emb|CDY05080.1| BnaC03g28780D [Brassica napus]
Length=190

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = -3

Query  778  NELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPK  599
            NEL+   EE P SPR+     QP  TMH+ N G   +    CP + P  +RS   ++Q K
Sbjct  81   NELECCTEEPPISPRAP--PPQP--TMHVTNSGLIASSGTSCPTAVP-AVRSEQCENQAK  135

Query  598  SSVFSNALSSPIRGSLQHYHLAQGSY  521
            +SVFSNALSSP+R SLQ+Y + QG Y
Sbjct  136  NSVFSNALSSPVRRSLQNYQVPQGGY  161



>ref|NP_001136541.1| hypothetical protein [Zea mays]
 gb|ACF82126.1| unknown [Zea mays]
 tpg|DAA58748.1| TPA: hypothetical protein ZEAMMB73_814484 [Zea mays]
Length=201

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 14/127 (11%)
 Frame = -3

Query  775  ELDYGAEETPTSPRSSFQEQQPQITMHLpnggfpvnpnpfcPASAPQGLRSGHSDHQPKS  596
            E+DY   +   SPR     Q PQI     N   P     +  ++A    R   +D Q K+
Sbjct  83   EIDYVGTDAHVSPRVP---QHPQIANPFANSVVPPGTGLYGQSAAGFAPRPSVTD-QSKN  138

Query  595  SVFSNALSSPIRGSLQHYHLAQGS-YPPNNAMPSACGMQNNDTGYLQSRDANPPNSSDTL  419
            ++FSNALSSP+R SLQ+ H  QG+     NA  +  G          +R+AN  +S+DT 
Sbjct  139  TIFSNALSSPVRRSLQNSHTTQGAGNGGRNAEANLAGA---------NREANSTSSNDTS  189

Query  418  MDMHSDT  398
            MDM SDT
Sbjct  190  MDMVSDT  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2035318454400