BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052E10

Length=907
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      271   2e-83   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      268   4e-82   Nicotiana sylvestris
ref|XP_006354142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    265   5e-81   Solanum tuberosum [potatoes]
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    265   6e-81   
ref|XP_010316236.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      265   8e-81   Solanum lycopersicum
gb|KJB23365.1|  hypothetical protein B456_004G094500                    263   5e-80   Gossypium raimondii
gb|KHG18393.1|  hypothetical protein F383_22096                         262   6e-80   Gossypium arboreum [tree cotton]
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    262   9e-80   Citrus sinensis [apfelsine]
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             262   1e-79   
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    262   1e-79   Nelumbo nucifera [Indian lotus]
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    260   4e-79   Sesamum indicum [beniseed]
gb|KJB66065.1|  hypothetical protein B456_010G126400                    259   4e-79   Gossypium raimondii
gb|KJB66066.1|  hypothetical protein B456_010G126400                    259   9e-79   Gossypium raimondii
gb|KHG04722.1|  hypothetical protein F383_29074                         255   3e-77   Gossypium arboreum [tree cotton]
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 255   4e-77   Morus notabilis
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    255   5e-77   Nelumbo nucifera [Indian lotus]
ref|XP_010673492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      253   2e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             253   3e-76   Prunus persica
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      252   4e-76   Fragaria vesca subsp. vesca
ref|XP_011048218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    252   6e-76   Populus euphratica
ref|XP_002297638.2|  hypothetical protein POPTR_0001s04360g             251   8e-76   
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      251   1e-75   Eucalyptus grandis [rose gum]
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      251   2e-75   Prunus mume [ume]
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    250   3e-75   Pyrus x bretschneideri [bai li]
ref|XP_003524953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    250   4e-75   Glycine max [soybeans]
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    249   6e-75   Tarenaya hassleriana [spider flower]
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    248   1e-74   
ref|XP_003531243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    248   2e-74   Glycine max [soybeans]
emb|CDP16794.1|  unnamed protein product                                248   2e-74   Coffea canephora [robusta coffee]
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    247   5e-74   Pyrus x bretschneideri [bai li]
gb|AFK45712.1|  unknown                                                 242   7e-74   Lotus japonicus
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    244   2e-73   
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   1e-72   
gb|AFU52654.1|  beta-1,3-glucanase 21                                   241   2e-72   Solanum tuberosum [potatoes]
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    242   2e-72   
ref|XP_010673491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   3e-72   
ref|XP_003601614.1|  Glucan endo-1,3-beta-glucosidase                   241   8e-72   Medicago truncatula
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    240   8e-72   Nelumbo nucifera [Indian lotus]
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      241   2e-71   Glycine soja [wild soybean]
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   2e-71   Sesamum indicum [beniseed]
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    240   2e-71   Glycine max [soybeans]
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   8e-71   Glycine max [soybeans]
gb|EYU27069.1|  hypothetical protein MIMGU_mgv1a004989mg                238   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_004502208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    237   2e-70   
ref|XP_004502207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    238   3e-70   Cicer arietinum [garbanzo]
emb|CAN72077.1|  hypothetical protein VITISV_020314                     236   4e-70   Vitis vinifera
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    237   4e-70   Cucumis sativus [cucumbers]
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   237   4e-70   Medicago truncatula
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    236   8e-70   Tarenaya hassleriana [spider flower]
ref|XP_011087559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   1e-69   
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    235   1e-69   Cucumis melo [Oriental melon]
gb|AFK37243.1|  unknown                                                 235   2e-69   Medicago truncatula
ref|XP_004504325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   4e-69   Cicer arietinum [garbanzo]
ref|XP_011025159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    234   4e-69   Populus euphratica
ref|XP_010651370.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    232   6e-69   
ref|XP_010651369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    233   1e-68   Vitis vinifera
gb|KDP42112.1|  hypothetical protein JCGZ_01900                         232   3e-68   Jatropha curcas
ref|XP_007161273.1|  hypothetical protein PHAVU_001G056400g             228   2e-66   Phaseolus vulgaris [French bean]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               227   2e-66   
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      227   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_007159412.1|  hypothetical protein PHAVU_002G236300g             224   2e-65   Phaseolus vulgaris [French bean]
ref|XP_010934539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      224   2e-65   Elaeis guineensis
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        222   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             223   1e-64   Capsella rubella
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    222   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             214   3e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      213   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   6e-61   Phoenix dactylifera
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   9e-61   
ref|XP_009388453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    208   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388452.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    208   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      204   1e-57   Brassica rapa
gb|KGN54064.1|  hypothetical protein Csa_4G280410                       204   2e-57   Cucumis sativus [cucumbers]
ref|XP_008449819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   6e-57   Cucumis melo [Oriental melon]
ref|XP_008449817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   7e-57   Cucumis melo [Oriental melon]
dbj|BAH57260.1|  AT3G13560                                              201   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   8e-57   Cucumis melo [Oriental melon]
ref|XP_009413316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      199   7e-56   Brachypodium distachyon [annual false brome]
ref|XP_004173668.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   9e-56   
ref|XP_004162024.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    201   1e-55   
ref|XP_004142250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   1e-55   
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   1e-55   Cucumis melo [Oriental melon]
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   2e-55   Cucumis melo [Oriental melon]
ref|XP_009406533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   2e-55   
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   3e-55   Cucumis sativus [cucumbers]
ref|NP_001149308.1|  glucan endo-1,3-beta-glucosidase 4 precursor       196   2e-54   Zea mays [maize]
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    196   2e-54   
gb|ACF87545.1|  unknown                                                 194   3e-54   Zea mays [maize]
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    195   4e-54   
tpg|DAA63295.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    194   5e-54   
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      194   8e-54   Pyrus x bretschneideri [bai li]
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 192   3e-53   Morus notabilis
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3                 191   4e-53   
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             191   5e-53   
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...    191   5e-53   Zea mays [maize]
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      192   5e-53   Prunus mume [ume]
gb|KDP38099.1|  hypothetical protein JCGZ_04742                         192   6e-53   Jatropha curcas
gb|EMS53703.1|  Glucan endo-1,3-beta-glucosidase 4                      191   6e-53   Triticum urartu
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   6e-53   
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             191   7e-53   Prunus persica
ref|XP_002312452.2|  glucan endo-1 family protein                       191   7e-53   
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      191   9e-53   Sesamum indicum [beniseed]
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   1e-52   Cucumis melo [Oriental melon]
ref|XP_002460914.1|  hypothetical protein SORBIDRAFT_02g037380          191   1e-52   Sorghum bicolor [broomcorn]
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      191   1e-52   Populus euphratica
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            191   1e-52   
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             190   2e-52   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      190   2e-52   Fragaria vesca subsp. vesca
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             190   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             190   2e-52   Citrus clementina [clementine]
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             190   3e-52   
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    190   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      189   3e-52   Glycine soja [wild soybean]
ref|XP_006858991.1|  hypothetical protein AMTR_s00068p00134210          190   3e-52   Amborella trichopoda
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             189   3e-52   
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    189   4e-52   
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   4e-52   
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  189   4e-52   Citrus sinensis [apfelsine]
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        189   4e-52   
emb|CDP01635.1|  unnamed protein product                                189   5e-52   Coffea canephora [robusta coffee]
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             189   6e-52   Eutrema salsugineum [saltwater cress]
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             189   6e-52   Phaseolus vulgaris [French bean]
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   6e-52   Populus euphratica
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   6e-52   Glycine max [soybeans]
gb|AAK85402.2|  beta-1,3-glucanase                                      189   7e-52   Camellia sinensis [black tea]
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   1e-51   Glycine max [soybeans]
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   1e-51   Populus euphratica
gb|EMT28432.1|  Glucan endo-1,3-beta-glucosidase 4                      191   1e-51   
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      188   1e-51   Fragaria vesca subsp. vesca
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   1e-51   Elaeis guineensis
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      188   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    188   1e-51   Ricinus communis
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg             188   2e-51   Capsella rubella
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-51   Populus euphratica
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             187   2e-51   Citrus clementina [clementine]
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             187   2e-51   Phaseolus vulgaris [French bean]
ref|XP_009390355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-51   
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-51   Citrus sinensis [apfelsine]
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-51   Populus euphratica
gb|KHG17836.1|  hypothetical protein F383_07126                         188   2e-51   Gossypium arboreum [tree cotton]
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                187   2e-51   Erythranthe guttata [common monkey flower]
dbj|BAJ89950.1|  predicted protein                                      187   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   2e-51   Cucumis sativus [cucumbers]
gb|KJB15378.1|  hypothetical protein B456_002G174100                    187   2e-51   Gossypium raimondii
ref|XP_009406531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   3e-51   
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        187   3e-51   
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   3e-51   Glycine max [soybeans]
gb|KJB30775.1|  hypothetical protein B456_005G159100                    186   4e-51   Gossypium raimondii
ref|XP_006599425.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   4e-51   Glycine max [soybeans]
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      187   4e-51   Glycine soja [wild soybean]
gb|KJB15376.1|  hypothetical protein B456_002G174100                    187   4e-51   Gossypium raimondii
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   4e-51   Eucalyptus grandis [rose gum]
ref|XP_006599427.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   4e-51   Glycine max [soybeans]
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      186   5e-51   Glycine soja [wild soybean]
gb|KJB30776.1|  hypothetical protein B456_005G159100                    186   5e-51   Gossypium raimondii
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   5e-51   Glycine max [soybeans]
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             186   6e-51   Phaseolus vulgaris [French bean]
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      186   6e-51   Nelumbo nucifera [Indian lotus]
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   7e-51   Glycine max [soybeans]
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   7e-51   Glycine max [soybeans]
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   8e-51   Glycine max [soybeans]
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     186   8e-51   Elaeis guineensis
ref|NP_001060087.2|  Os07g0577300                                       186   1e-50   
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   1e-50   
gb|EEE67465.1|  hypothetical protein OsJ_24859                          186   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   1e-50   Glycine max [soybeans]
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   2e-50   Glycine max [soybeans]
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                      185   2e-50   Glycine soja [wild soybean]
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   2e-50   
emb|CDY48807.1|  BnaC02g34070D                                          184   2e-50   Brassica napus [oilseed rape]
ref|XP_010546762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      185   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   3e-50   
ref|XP_009382992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00829.1|  unnamed protein product                                184   3e-50   Coffea canephora [robusta coffee]
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   4e-50   Populus euphratica
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      184   4e-50   Brassica rapa
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   5e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO42272.1|  unknown protein                                         180   5e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         184   6e-50   Jatropha curcas
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      183   6e-50   Tarenaya hassleriana [spider flower]
ref|XP_008802448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   7e-50   Phoenix dactylifera
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   8e-50   Phoenix dactylifera
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   9e-50   Cicer arietinum [garbanzo]
ref|XP_006658732.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   1e-49   
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   1e-49   Cicer arietinum [garbanzo]
gb|KHG06295.1|  hypothetical protein F383_32557                         182   1e-49   Gossypium arboreum [tree cotton]
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   1e-49   
ref|XP_010052861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   2e-49   Eucalyptus grandis [rose gum]
gb|EPS65983.1|  hypothetical protein M569_08793                         181   2e-49   Genlisea aurea
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     182   2e-49   Nelumbo nucifera [Indian lotus]
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           182   3e-49   Medicago truncatula
gb|AES70967.2|  glucan endo-1,3-beta-glucosidase-like protein           181   3e-49   Medicago truncatula
ref|XP_004295275.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   3e-49   Fragaria vesca subsp. vesca
ref|XP_011459999.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    182   3e-49   Fragaria vesca subsp. vesca
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein           183   3e-49   Medicago truncatula
ref|XP_007026106.1|  O-Glycosyl hydrolases family 17 protein            182   3e-49   Theobroma cacao [chocolate]
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   184   3e-49   
gb|KJB10512.1|  hypothetical protein B456_001G204900                    183   3e-49   Gossypium raimondii
ref|XP_004503127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   3e-49   Cicer arietinum [garbanzo]
ref|XP_006417308.1|  hypothetical protein EUTSA_v10006713mg             186   3e-49   
ref|NP_001150141.1|  glucan endo-1,3-beta-glucosidase 3 precursor       181   3e-49   
ref|XP_003558472.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      181   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   4e-49   Sesamum indicum [beniseed]
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   4e-49   Oryza brachyantha
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    182   4e-49   
gb|AIR93909.1|  glucanase                                               180   5e-49   Cicer arietinum [garbanzo]
ref|XP_006828511.1|  hypothetical protein AMTR_s00060p00188740          181   6e-49   
emb|CDY31214.1|  BnaC08g15090D                                          181   6e-49   Brassica napus [oilseed rape]
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             179   6e-49   
gb|KFK43454.1|  hypothetical protein AALP_AA1G127200                    181   6e-49   Arabis alpina [alpine rockcress]
ref|XP_009359235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   7e-49   Pyrus x bretschneideri [bai li]
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     181   7e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      181   7e-49   Eucalyptus grandis [rose gum]
ref|NP_001184967.1|  O-glycosyl hydrolases family 17 protein            181   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   8e-49   Cicer arietinum [garbanzo]
ref|XP_009110702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      181   8e-49   Brassica rapa
emb|CDM84006.1|  unnamed protein product                                180   9e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          180   1e-48   Sorghum bicolor [broomcorn]
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   1e-48   
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     179   1e-48   Eucalyptus grandis [rose gum]
ref|XP_011023920.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   1e-48   Populus euphratica
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    180   1e-48   
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   1e-48   Setaria italica
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   2e-48   Elaeis guineensis
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             179   2e-48   Phaseolus vulgaris [French bean]
dbj|BAJ85556.1|  predicted protein                                      179   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006395868.1|  hypothetical protein EUTSA_v10004013mg             178   2e-48   
gb|KHN03485.1|  Glucan endo-1,3-beta-glucosidase 1                      175   2e-48   Glycine soja [wild soybean]
gb|ACN30650.1|  unknown                                                 179   2e-48   Zea mays [maize]
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           179   2e-48   Medicago truncatula
ref|XP_009589694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   2e-48   Nicotiana tomentosiformis
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg                179   2e-48   Erythranthe guttata [common monkey flower]
gb|ACF80565.1|  unknown                                                 179   2e-48   Zea mays [maize]
gb|EEC82319.1|  hypothetical protein OsI_26597                          179   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_011096055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      179   3e-48   Sesamum indicum [beniseed]
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   3e-48   Oryza brachyantha
ref|XP_010528550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      179   3e-48   Tarenaya hassleriana [spider flower]
ref|NP_001130376.1|  putative O-Glycosyl hydrolase superfamily pr...    179   3e-48   Zea mays [maize]
gb|KJB57756.1|  hypothetical protein B456_009G179400                    179   3e-48   Gossypium raimondii
ref|XP_008365635.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    180   3e-48   
gb|KJB22745.1|  hypothetical protein B456_004G064200                    179   4e-48   Gossypium raimondii
ref|XP_008224690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      179   4e-48   Prunus mume [ume]
ref|XP_007211541.1|  hypothetical protein PRUPE_ppa003984mg             179   4e-48   
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   4e-48   Solanum tuberosum [potatoes]
gb|AET05176.2|  glucan endo-1,3-beta-glucosidase-like protein           178   4e-48   Medicago truncatula
ref|XP_009593892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      179   5e-48   Nicotiana tomentosiformis
gb|KHG03844.1|  hypothetical protein F383_07460                         179   5e-48   Gossypium arboreum [tree cotton]
gb|EEC71452.1|  hypothetical protein OsI_03677                          178   5e-48   Oryza sativa Indica Group [Indian rice]
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          178   5e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044198.1|  Os01g0739700                                       178   5e-48   
ref|NP_001049413.1|  Os03g0221500                                       178   6e-48   
ref|XP_003632942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      179   6e-48   Vitis vinifera
gb|KHG27056.1|  hypothetical protein F383_08405                         178   6e-48   Gossypium arboreum [tree cotton]
ref|XP_002468258.1|  hypothetical protein SORBIDRAFT_01g042560          178   7e-48   Sorghum bicolor [broomcorn]
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     178   7e-48   Phoenix dactylifera
gb|EYU30694.1|  hypothetical protein MIMGU_mgv1a005031mg                178   7e-48   Erythranthe guttata [common monkey flower]
ref|XP_006657748.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   7e-48   Oryza brachyantha
ref|XP_011046950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      178   8e-48   Populus euphratica
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     178   8e-48   Eucalyptus grandis [rose gum]
ref|XP_010324461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   8e-48   
gb|KJB57757.1|  hypothetical protein B456_009G179400                    177   8e-48   Gossypium raimondii
ref|XP_006348130.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   8e-48   Solanum tuberosum [potatoes]
gb|KJB15377.1|  hypothetical protein B456_002G174100                    176   8e-48   Gossypium raimondii
ref|XP_009772723.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      178   9e-48   Nicotiana sylvestris
ref|XP_011008030.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   1e-47   Populus euphratica
ref|XP_006383906.1|  hypothetical protein POPTR_0004s01110g             177   1e-47   
ref|NP_001275288.1|  glucan endo-1,3-beta-glucosidase 2-like prec...    177   1e-47   Solanum tuberosum [potatoes]
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    177   1e-47   
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     178   1e-47   
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   1e-47   Solanum lycopersicum
ref|XP_010686818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      177   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006389594.1|  hypothetical protein POPTR_0021s00450g             177   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010476120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010493346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      177   1e-47   
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          178   1e-47   
gb|KHG14816.1|  hypothetical protein F383_17797                         177   1e-47   
gb|KHG27055.1|  hypothetical protein F383_08405                         178   1e-47   
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   1e-47   
ref|XP_004958122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    179   1e-47   
ref|XP_006602009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   2e-47   
ref|XP_010458588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-47   
ref|XP_010458590.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-47   
ref|XP_010458589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-47   
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-47   
gb|KHN21581.1|  Glucan endo-1,3-beta-glucosidase 3                      175   2e-47   
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     177   2e-47   
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    175   2e-47   
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                   177   2e-47   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-47   
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   2e-47   
ref|XP_002265396.3|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   2e-47   
ref|XP_002518468.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    177   3e-47   
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     176   3e-47   
gb|KHG26459.1|  hypothetical protein F383_04538                         176   3e-47   
ref|XP_010916187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   3e-47   
ref|XP_006451337.1|  hypothetical protein CICLE_v10008080mg             176   3e-47   
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   3e-47   
ref|XP_009792882.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   3e-47   
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    178   3e-47   
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   3e-47   
emb|CBI26850.3|  unnamed protein product                                176   3e-47   
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   3e-47   
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   4e-47   
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   4e-47   
gb|AAO64485.1|  putative beta 1-3-glucanase                             169   4e-47   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   4e-47   
gb|KDP20735.1|  hypothetical protein JCGZ_21206                         176   4e-47   
ref|XP_010916186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   4e-47   
gb|EMT05308.1|  Glucan endo-1,3-beta-glucosidase 3                      176   5e-47   
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   5e-47   
ref|XP_009792881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   5e-47   
gb|AFU52641.1|  beta-1,3-glucanase 6                                    176   6e-47   
ref|XP_004232702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      176   6e-47   
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        175   6e-47   
gb|KJB27172.1|  hypothetical protein B456_004G282300                    176   7e-47   
ref|XP_006391369.1|  hypothetical protein EUTSA_v10018427mg             176   7e-47   
ref|XP_010415170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   7e-47   
ref|XP_008775310.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   7e-47   
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   7e-47   
gb|KHN16561.1|  Glucan endo-1,3-beta-glucosidase 3                      173   7e-47   
ref|XP_003549783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    176   7e-47   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         175   8e-47   
ref|XP_003610449.1|  Glucan endo-1,3-beta-glucosidase                   176   8e-47   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    175   8e-47   
ref|XP_006600304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   9e-47   
gb|EMS60322.1|  Glucan endo-1,3-beta-glucosidase 4                      176   1e-46   
ref|XP_010476119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   1e-46   
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   1e-46   
ref|XP_008384081.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    175   1e-46   
ref|XP_009388881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    175   1e-46   
ref|XP_009127478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   2e-46   
ref|XP_006306488.1|  hypothetical protein CARUB_v10012467mg             177   2e-46   
gb|EEC82125.1|  hypothetical protein OsI_26155                          175   2e-46   
ref|NP_001059752.1|  Os07g0510200                                       175   2e-46   
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   2e-46   
gb|EMS47617.1|  Glucan endo-1,3-beta-glucosidase 3                      174   2e-46   
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     174   2e-46   
ref|NP_001144992.1|  uncharacterized protein LOC100278152 precursor     174   2e-46   
ref|XP_002892658.1|  predicted protein                                  174   2e-46   
ref|XP_009127476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   3e-46   
emb|CBI23232.3|  unnamed protein product                                177   3e-46   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    173   3e-46   
gb|KFK41053.1|  hypothetical protein AALP_AA2G079300                    174   3e-46   
ref|XP_006855931.1|  hypothetical protein AMTR_s00037p00209440          173   3e-46   
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   3e-46   
gb|KDO55852.1|  hypothetical protein CISIN_1g010782mg                   172   4e-46   
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     173   4e-46   
emb|CDP04414.1|  unnamed protein product                                177   4e-46   
ref|XP_010244498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   4e-46   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              172   4e-46   
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   4e-46   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              172   4e-46   
ref|XP_010278647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   4e-46   
ref|XP_010278646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    174   4e-46   
ref|XP_010244497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   4e-46   
emb|CDY58676.1|  BnaCnng33550D                                          173   4e-46   
ref|XP_009397776.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   4e-46   
ref|XP_007012993.1|  O-Glycosyl hydrolases family 17 protein isof...    171   5e-46   
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      173   5e-46   
ref|XP_009357466.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   5e-46   
ref|XP_010094029.1|  Glucan endo-1,3-beta-glucosidase 1                 173   6e-46   
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   6e-46   
ref|XP_007153962.1|  hypothetical protein PHAVU_003G079900g             173   6e-46   
emb|CDP03239.1|  unnamed protein product                                172   6e-46   
ref|XP_010052862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   6e-46   
ref|XP_003630700.1|  Glucan endo-1,3-beta-glucosidase                   172   6e-46   
ref|XP_008440948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      173   8e-46   
emb|CDY16440.1|  BnaA02g12440D                                          172   8e-46   
ref|XP_010470500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   8e-46   
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     172   9e-46   
ref|XP_010511554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   9e-46   
ref|XP_003600716.1|  Glucan endo-1,3-beta-glucosidase                   172   1e-45   
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            172   1e-45   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     172   1e-45   
ref|XP_009397186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   1e-45   
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               172   1e-45   
gb|AAC17632.1|  Similar to glucan endo-1,3-beta-D-glucosidase pre...    171   1e-45   
gb|KJB65051.1|  hypothetical protein B456_010G078300                    172   1e-45   
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    171   1e-45   
ref|XP_004507681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    172   1e-45   
gb|ACU24280.1|  unknown                                                 168   1e-45   
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...    171   2e-45   
gb|KHN35732.1|  Glucan endo-1,3-beta-glucosidase 1                      172   2e-45   
ref|XP_006599426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   2e-45   
ref|XP_003529639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-45   
ref|XP_006584084.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   2e-45   
gb|KJB10513.1|  hypothetical protein B456_001G204900                    172   2e-45   
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   3e-45   
gb|KJB57758.1|  hypothetical protein B456_009G179400                    171   3e-45   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    171   3e-45   
ref|XP_004145115.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   3e-45   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     171   4e-45   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   4e-45   
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   4e-45   
ref|XP_004158003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   4e-45   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             170   5e-45   
gb|AIR93910.1|  glucanase                                               169   7e-45   
ref|XP_010923877.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   8e-45   
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   8e-45   
emb|CAN82488.1|  hypothetical protein VITISV_006804                     169   9e-45   
gb|EPS73640.1|  hypothetical protein M569_01113                         169   1e-44   
ref|NP_176799.2|  glucan endo-1,3-beta-glucosidase 2                    169   2e-44   
gb|ABI93926.1|  At1g66250                                               169   2e-44   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     168   2e-44   
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     169   2e-44   
gb|KHG04832.1|  hypothetical protein F383_29565                         169   2e-44   
ref|XP_010929487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   2e-44   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     168   2e-44   
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     168   3e-44   
ref|XP_008789820.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   3e-44   
ref|XP_010553445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   3e-44   
ref|XP_010553446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   3e-44   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     168   4e-44   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    167   5e-44   
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   166   7e-44   
dbj|BAC83070.1|  putative elicitor inducible beta-1,3-glucanase         169   7e-44   
gb|EYU27773.1|  hypothetical protein MIMGU_mgv1a006342mg                166   8e-44   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     167   9e-44   
dbj|BAC83956.1|  putative beta-1,3-glucanase                            167   1e-43   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              165   1e-43   
emb|CDY14214.1|  BnaA08g13450D                                          167   1e-43   
ref|XP_010057914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-43   
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     166   1e-43   
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   2e-43   
ref|XP_004959695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   2e-43   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              164   2e-43   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             166   2e-43   
ref|XP_006300850.1|  hypothetical protein CARUB_v10019942mg             167   2e-43   
ref|XP_010059559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    166   2e-43   
gb|ABD91577.1|  beta-1,3-glucanase                                      166   2e-43   
ref|XP_006495278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   2e-43   
gb|ABD91576.1|  beta-1,3-glucanase                                      166   2e-43   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             165   3e-43   
gb|EPS74061.1|  hypothetical protein M569_00697                         164   4e-43   
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           165   4e-43   
ref|XP_009394833.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   4e-43   
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   5e-43   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     164   5e-43   
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    164   6e-43   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                169   6e-43   
ref|XP_008777062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   6e-43   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   6e-43   
gb|ADU15553.1|  GLU                                                     164   6e-43   
ref|XP_010470501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   7e-43   
emb|CDY62033.1|  BnaC03g77660D                                          165   7e-43   
ref|XP_008777063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   1e-42   
ref|XP_008777061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   1e-42   
ref|XP_003563040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   2e-42   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     163   3e-42   
gb|KHN33020.1|  Glucan endo-1,3-beta-glucosidase 1                      159   3e-42   
gb|EPS61988.1|  hypothetical protein M569_12804                         161   4e-42   
ref|NP_001152289.1|  glucan endo-1,3-beta-glucosidase 3 precursor       162   5e-42   
ref|XP_006598340.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   7e-42   
tpg|DAA62863.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    163   8e-42   
gb|KJB62900.1|  hypothetical protein B456_009G442700                    160   1e-41   
ref|XP_007147720.1|  hypothetical protein PHAVU_006G149100g             161   1e-41   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                       161   1e-41   
ref|XP_010553447.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   1e-41   
gb|EMT32814.1|  Glucan endo-1,3-beta-glucosidase 3                      162   2e-41   
gb|AAG51762.1|AC066691_2  beta-1,3-glucanase precursor, putative;...    159   2e-41   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                   161   2e-41   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg             160   2e-41   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     160   2e-41   
emb|CDY68826.1|  BnaA01g34890D                                          159   3e-41   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          159   3e-41   
ref|XP_010929500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   4e-41   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     159   4e-41   
ref|XP_010929494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   5e-41   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    160   5e-41   
emb|CDY06818.1|  BnaC01g09170D                                          159   5e-41   
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               159   6e-41   
ref|XP_007147719.1|  hypothetical protein PHAVU_006G149100g             159   7e-41   
gb|KHG04965.1|  hypothetical protein F383_30444                         158   7e-41   
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein               159   1e-40   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             159   1e-40   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     158   2e-40   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             157   3e-40   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   5e-40   
gb|AIR93901.1|  glucanase                                               156   5e-40   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                155   6e-40   
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                   156   8e-40   
gb|KHG21190.1|  hypothetical protein F383_01641                         155   9e-40   
ref|XP_004486169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   9e-40   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   1e-39   
ref|XP_006280336.1|  hypothetical protein CARUB_v10026261mg             155   1e-39   
tpg|DAA62862.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    156   1e-39   
tpg|DAA62861.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    156   1e-39   
tpg|DAA62865.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    156   1e-39   
tpg|DAA62864.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    156   1e-39   
gb|KJB13749.1|  hypothetical protein B456_002G092600                    155   1e-39   
emb|CDY32869.1|  BnaC09g33160D                                          155   2e-39   
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                155   2e-39   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   2e-39   
ref|XP_006401304.1|  hypothetical protein EUTSA_v10013309mg             155   2e-39   



>ref|XP_009631831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631834.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631835.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631836.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
Length=499

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 177/221 (80%), Gaps = 5/221 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDAT ENA  +NNNLIRRVSNDTGPPS+ K PI  +IYE+FNED
Sbjct  264  IVVTETGWPWDGGANEPDATKENAETFNNNLIRRVSNDTGPPSQPKNPIDTFIYEMFNED  323

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SERSWGIF  NGS VY ++LG  S+G I++NS+A VFCIA+ GA ENKLQ GI+
Sbjct  324  KRPGPISERSWGIFSINGSEVYSLSLG--SSGGISDNSTA-VFCIAKKGADENKLQDGIN  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG+ANCSAIQ GQPCY PDTLQNHASYAYNDYYQR++SVGGTCDFDGTATTTT D
Sbjct  381  WACG-QGHANCSAIQSGQPCYFPDTLQNHASYAYNDYYQRMRSVGGTCDFDGTATTTTQD  439

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMARAPDI  245
            PS  +C FTGSS    G  P  AFGP +P  + S  RA  I
Sbjct  440  PSSKTCKFTGSSTPG-GLFPPAAFGPISPTSQSSTIRASVI  479



>ref|XP_009778460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778463.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778464.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778465.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
Length=496

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 179/221 (81%), Gaps = 5/221 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDA+ ENA  +NNNLIRRVSNDTGPPS+ K PI+ +IYE+FNED
Sbjct  261  IVVTETGWPWDGGANEPDASKENAETFNNNLIRRVSNDTGPPSQPKNPINTFIYEMFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SERSWGIF  NGS +Y ++L GSSAG I++NS+A VFCIA+ GA ENKLQ GI+
Sbjct  321  KRPGPISERSWGIFSTNGSEIYSLSL-GSSAG-ISDNSTA-VFCIAKKGADENKLQDGIN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG+ANCSAIQ GQPCY PDTLQNHASYAYNDYYQR++S+GGTCDFDGTATTTT D
Sbjct  378  WACG-QGHANCSAIQSGQPCYFPDTLQNHASYAYNDYYQRMRSLGGTCDFDGTATTTTQD  436

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMARAPDI  245
            PS  +C FTGSS    G  P  AFGP +P  +G   RA  I
Sbjct  437  PSSKTCKFTGSSTPG-GLFPPAAFGPISPTSQGPTIRATVI  476



>ref|XP_006354142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Solanum tuberosum]
Length=501

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 174/222 (78%), Gaps = 4/222 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G ++EPDAT ENA  +NNNLIRRVSNDTGPPS+ K+PI+ +IYE+FNED
Sbjct  264  VVVTETGWPWAGGSNEPDATKENAETFNNNLIRRVSNDTGPPSQPKIPINTFIYEMFNED  323

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SERSWG+F  NGS VY + LG S +    ++++   FC+A+PGA ENKLQ GI+
Sbjct  324  KRPGPISERSWGVFSTNGSDVYTLGLGSSDSISDNSSTA---FCVAKPGADENKLQDGIN  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ G+PCY PDT+QNHASYAYNDYYQR+ S+GGTCDFDGTAT TT D
Sbjct  381  WACG-QGRANCSAIQSGKPCYFPDTIQNHASYAYNDYYQRMHSLGGTCDFDGTATMTTQD  439

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMARAPDIG  242
            PS  +C FTGSSNS  G  P  AFGP +   + S  R+P I 
Sbjct  440  PSSRTCKFTGSSNSGGGVFPPAAFGPISATSQCSTIRSPVIA  481



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 178/218 (82%), Gaps = 8/218 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G ++EPDATVENA  + NNLIRRVSN++GPPS+  +PI+ YIYELFNED
Sbjct  262  IVVTETGWPWQGGSNEPDATVENAQTFINNLIRRVSNNSGPPSQPTIPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP SE++WG+ F NG+AVYP++L GSS  QI  NS+  VFC+A+   SE+KLQ G++
Sbjct  322  KRPGPASEKNWGVLFLNGTAVYPLSLSGSS--QITGNSTT-VFCVAKDDTSEDKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ GQPCY P+ ++NHASYAYNDYYQ++ S+GGTCDFDGTATTTT +
Sbjct  379  WACG-QGQANCSAIQSGQPCYLPNNIKNHASYAYNDYYQKMHSLGGTCDFDGTATTTTNN  437

Query  367  PSYGSCIFTGSSNSSI---GGV-PTPAFGPTAPVGKGS  266
            PSYGSCIFTGS NS+    GG+ P  AFGP +P GK +
Sbjct  438  PSYGSCIFTGSLNSTTATGGGISPPEAFGPISPFGKST  475



>ref|XP_010316236.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
 ref|XP_010316237.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
Length=501

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 177/224 (79%), Gaps = 8/224 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G ++EPDAT ENA  +NNNLIRRVSNDTGPPS+ K+PI+ +IYE+FNED
Sbjct  264  VVVTETGWPWAGGSNEPDATKENAETFNNNLIRRVSNDTGPPSQPKIPINTFIYEMFNED  323

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SERSWGIF  NGS VY + LG S +    ++S+   FC+A+PGA ENKLQ GI+
Sbjct  324  KRPGPISERSWGIFSTNGSDVYSLGLGSSDSISNNSSSA---FCVAKPGADENKLQDGIN  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ GQPCY PDT+QNHASYAYNDYYQR+ S+GGTCDFDGTAT TT D
Sbjct  381  WACG-QGRANCSAIQSGQPCYFPDTIQNHASYAYNDYYQRMHSLGGTCDFDGTATMTTQD  439

Query  367  PSYGSCIFTGSSNSSIGGV-PTPAFGP-TAPVGKGSMARAPDIG  242
            PS  +C FTGSSNS  GGV P  AFGP  AP  + S  R+P I 
Sbjct  440  PSSRTCKFTGSSNS--GGVFPPAAFGPIVAPTSQSSTIRSPVIA  481



>gb|KJB23365.1| hypothetical protein B456_004G094500 [Gossypium raimondii]
Length=492

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 179/217 (82%), Gaps = 6/217 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTETGWPW G ++EPDATVENA  + N LI+RVSN++GPPS+  +PI+ YIYELFNED
Sbjct  261  IIVTETGWPWQGGSNEPDATVENAETFINKLIQRVSNNSGPPSQPTIPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WG+ F NG+AV+P++LGG S  QI  NS+A VFC+A+  ASE+KL+ GI+
Sbjct  321  KRPGPISEKNWGLLFTNGTAVFPLSLGGPS--QITGNSTA-VFCVAKDDASEDKLRDGIN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ GQPCY P+ ++NHASYAYNDYYQ++ +VGGTCDFDGTATTTT+D
Sbjct  378  WACG-QGQANCSAIQSGQPCYLPNNIKNHASYAYNDYYQKMHTVGGTCDFDGTATTTTID  436

Query  367  PSYGSCIFTGSSNSSIG--GVPTPAFGPTAPVGKGSM  263
            PSYGSCIFTGSSNSS G   +P  A GP +P G   +
Sbjct  437  PSYGSCIFTGSSNSSTGRESLPPTALGPISPGGSTKL  473



>gb|KHG18393.1| hypothetical protein F383_22096 [Gossypium arboreum]
Length=492

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 179/217 (82%), Gaps = 6/217 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G ++EPDATVENA  + N LI+RVSN++GPPS+  +PI+ YIYELFNED
Sbjct  261  IVVTETGWPWQGGSNEPDATVENAETFINKLIQRVSNNSGPPSQPTIPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WG+ F NG+AV+P++LGG S  QI  NS+A VFC+A+  ASE+KL+ G++
Sbjct  321  KRPGPISEKNWGLLFTNGTAVFPLSLGGPS--QITGNSTA-VFCVAKDDASEDKLRDGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ GQPCY P+ ++NHASYAYNDYYQ++ +VGGTCDFDGTATTTT+D
Sbjct  378  WACG-QGQANCSAIQSGQPCYLPNNIKNHASYAYNDYYQKMHTVGGTCDFDGTATTTTID  436

Query  367  PSYGSCIFTGSSNSSIG--GVPTPAFGPTAPVGKGSM  263
            PSYGSCIFTGSSNSS G   +P  A GP +P G   +
Sbjct  437  PSYGSCIFTGSSNSSTGRESLPPTALGPISPGGSTKL  473



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 173/211 (82%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWPW G  +E DAT+ENA  YNNN+IRRV NDTGPPS+  MPI+ Y+YELFNED
Sbjct  262  VIVTESGWPWLGGGNETDATLENAETYNNNMIRRVLNDTGPPSQPDMPINTYVYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WG+FF NG++VYP+N  GS  GQI  NSS GVFC+A+  A  +KLQ G++
Sbjct  322  KRPGPISEKNWGVFFTNGTSVYPLNFSGS--GQIIGNSS-GVFCVAKDDADSDKLQNGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG+ANCSAIQPGQPCY P+ +++HASYAYNDYYQ+++SVGGTC+FDGTA TTT D
Sbjct  379  WACG-QGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSVGGTCNFDGTAMTTTKD  437

Query  367  PSYGSCIFTGSSNSSIGG--VPTPAFGPTAP  281
            PSYGSC + GSS+SS  G  +P  A GP +P
Sbjct  438  PSYGSCTYAGSSHSSTRGGFLPPVASGPVSP  468



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 173/211 (82%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWPW G  +E DAT+ENA  YNNN+IRRV NDTGPPS+  MPI+ Y+YELFNED
Sbjct  262  VIVTESGWPWLGGGNETDATLENAETYNNNMIRRVLNDTGPPSQPDMPINTYVYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WG+FF NG++VYP+N  GS  GQI  NSS GVFC+A+  A  +KLQ G++
Sbjct  322  KRPGPISEKNWGVFFTNGTSVYPLNFSGS--GQIIGNSS-GVFCVAKDDADSDKLQNGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG+ANCSAIQPGQPCY P+ +++HASYAYNDYYQ+++SVGGTC+FDGTA TTT D
Sbjct  379  WACG-QGHANCSAIQPGQPCYLPNNIKSHASYAYNDYYQKMRSVGGTCNFDGTAMTTTKD  437

Query  367  PSYGSCIFTGSSNSSIGG--VPTPAFGPTAP  281
            PSYGSC + GSS+SS  G  +P  A GP +P
Sbjct  438  PSYGSCTYAGSSHSSTRGGFLPPVASGPVSP  468



>ref|XP_010276332.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276334.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276336.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276337.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276338.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 171/223 (77%), Gaps = 4/223 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWPWFG  +EPDAT +NA  YNNNLIRRV ND GPPS+  +PI  Y+YELFNED
Sbjct  263  IIVTESGWPWFGGANEPDATADNAQTYNNNLIRRVLNDLGPPSQPTIPIRTYVYELFNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPG +SE++WG+FF NG++VYP++  G+S   + N+S  GVFC+A+P A  + LQ G++
Sbjct  323  KRPGSISEKNWGLFFTNGTSVYPLSF-GTSDRVVGNSSGVGVFCVAKPDADSSLLQSGLN  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG +G ANCSAIQ GQPCY P+ LQ+HASYAYNDY+ ++QS G TCDF  TA TTTVD
Sbjct  382  WACG-EGQANCSAIQEGQPCYEPNNLQSHASYAYNDYFHKMQSAGATCDFGRTAITTTVD  440

Query  367  PSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVGKGSMARAPDI  245
            PS+ SC+F GSS S+  G+ TP  AFGPT  +G  SM + P I
Sbjct  441  PSHSSCVFMGSSGSNTSGLFTPPSAFGPTGLMGSSSMLQVPRI  483



>ref|XP_011087532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
Length=499

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 175/224 (78%), Gaps = 5/224 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG + EPDAT ENA  YN+NLIRRVSND+GPPS+  +PI+ YIYELFNED
Sbjct  261  IVVTETGWPSFGGSKEPDATAENAETYNSNLIRRVSNDSGPPSQPTIPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSER+WG+ F NG+AVY ++L  S +   AN+S+A  FCIA+PGA E+ L+ G++
Sbjct  321  KRPGPVSERNWGVLFTNGTAVYDVSLSDSDSLG-ANSSTA--FCIARPGADESSLRDGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC+AIQ GQPCYSP+T+QNHASYAYNDYYQ+++S GGTCDF GTA+ TT D
Sbjct  378  WACGP-GQANCAAIQKGQPCYSPNTVQNHASYAYNDYYQKMRSSGGTCDFGGTASLTTAD  436

Query  367  PSYGSCIFTGSSNSSIGGV-PTPAFGPTAPVGKGSMARAPDIGR  239
            PSYGSC F GS NSS+GG+ P  A GP  P    S +     GR
Sbjct  437  PSYGSCRFIGSGNSSMGGLFPPAALGPIGPSSGSSTSIVLRFGR  480



>gb|KJB66065.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66068.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=458

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDATVENAG + N LIRRVSND+GPPS   +PI+ YIYELFNED
Sbjct  226  IVVTETGWPWQGGPNEPDATVENAGTFINYLIRRVSNDSGPPSRPNIPINTYIYELFNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+ + NG+AV+P++  GSS  QI  N++  VFC+A+  ASE KLQ G++
Sbjct  286  KRPGPVSEKNWGVLYTNGTAVFPLSFSGSS--QIMGNATT-VFCVAKDDASEGKLQDGLN  342

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCS IQ GQPCY P+  +NHASYAYNDYYQR+ +VG TCDF GTAT T+ D
Sbjct  343  WACG-QGQANCSVIQSGQPCYLPNNTKNHASYAYNDYYQRMHTVGATCDFGGTATITSND  401

Query  367  PSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGK  272
            PSY SCIFTGSSNSS   G +P  AFGP +P+G+
Sbjct  402  PSYRSCIFTGSSNSSAREGLLPPGAFGPVSPLGE  435



>gb|KJB66066.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66067.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66069.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=494

 Score =   259 bits (662),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDATVENAG + N LIRRVSND+GPPS   +PI+ YIYELFNED
Sbjct  262  IVVTETGWPWQGGPNEPDATVENAGTFINYLIRRVSNDSGPPSRPNIPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+ + NG+AV+P++  GSS  QI  N++  VFC+A+  ASE KLQ G++
Sbjct  322  KRPGPVSEKNWGVLYTNGTAVFPLSFSGSS--QIMGNATT-VFCVAKDDASEGKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCS IQ GQPCY P+  +NHASYAYNDYYQR+ +VG TCDF GTAT T+ D
Sbjct  379  WACG-QGQANCSVIQSGQPCYLPNNTKNHASYAYNDYYQRMHTVGATCDFGGTATITSND  437

Query  367  PSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGK  272
            PSY SCIFTGSSNSS   G +P  AFGP +P+G+
Sbjct  438  PSYRSCIFTGSSNSSAREGLLPPGAFGPVSPLGE  471



>gb|KHG04722.1| hypothetical protein F383_29074 [Gossypium arboreum]
Length=495

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 173/215 (80%), Gaps = 7/215 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDATVENAG + N LIRRVSND+GPPS   +P++ YIYELFNED
Sbjct  262  IVVTETGWPWQGGPNEPDATVENAGTFINYLIRRVSNDSGPPSRPNIPMNTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WG+ + NG+AV+P++L GSS  QI  N++  VFC+A+  ASE+KLQ G++
Sbjct  322  KRRGPVSEKNWGVLYTNGTAVFPLSLSGSS--QIMGNATT-VFCVAKDDASEDKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCS IQ GQPCY P+ ++NHASYAYNDYYQR+ +VG TCDFDGTAT TT D
Sbjct  379  WACG-QGQANCSVIQSGQPCYLPNNIKNHASYAYNDYYQRMHTVGATCDFDGTATITTND  437

Query  367  PSYGSCIFTGSSNSSI---GGVPTPAFGPTAPVGK  272
            PSY SCIFTGSS++S    G +P  AFGP +P+G+
Sbjct  438  PSYRSCIFTGSSSNSSAREGLLPPGAFGPVSPLGE  472



>ref|XP_010097806.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
 gb|EXB71433.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
Length=494

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 164/203 (81%), Gaps = 4/203 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE GWPW G   EPDATVENA  +NNNLIRRV N++GPPS+   PI+ YIYELFNED
Sbjct  262  IVVTEAGWPWLGGAKEPDATVENAETFNNNLIRRVLNNSGPPSQPNFPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WG+ F NGS VYP+NLG S  G+   NSSA VFC+A+  A  +KLQ+G++
Sbjct  322  KRSGPVSEKNWGVLFTNGSTVYPLNLGTS--GRATGNSSA-VFCVAKSDADPDKLQEGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPCY PD+L NHASYAYN+YYQR++SVGGTCDFDGTAT T  D
Sbjct  379  WACG-QGQANCSAIQPGQPCYLPDSLVNHASYAYNNYYQRMRSVGGTCDFDGTATQTDTD  437

Query  367  PSYGSCIFTGSSNSSIGGVPTPA  299
            PS GSC+F GSSNSS  G+ +P+
Sbjct  438  PSSGSCVFAGSSNSSGRGLVSPS  460



>ref|XP_010257592.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257595.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257598.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
Length=514

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 172/224 (77%), Gaps = 5/224 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G  +E DATVENA  YN+NL RRV ND+G PS+  +PI  YIYELFNED
Sbjct  279  VVVTETGWPWLGGANESDATVENAETYNSNLFRRVLNDSGSPSQPSLPIRTYIYELFNED  338

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WG+FF NG+ +YP++   SS    AN+S  G+FC+A+PGA  + LQ G++
Sbjct  339  KRPGPLSEKNWGLFFTNGTPIYPLSF-SSSDRLTANSSGIGLFCVAKPGADVSSLQSGLN  397

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ GQPCY P+TLQ+HASYAYNDY+ ++QS+GGTCDF GTATTT VD
Sbjct  398  WACG-QGQANCSAIQEGQPCYDPNTLQDHASYAYNDYFHKMQSIGGTCDFSGTATTTAVD  456

Query  367  PSYGSCIFTGSSNSSIGGVPTP--AFGPTAPV-GKGSMARAPDI  245
            PS+GSC+F GSS S+  G  TP  A GPT  + G  SM +  ++
Sbjct  457  PSHGSCVFAGSSGSNTTGAITPSTALGPTTSLTGVSSMLQVSEV  500



>ref|XP_010673492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 178/224 (79%), Gaps = 6/224 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G  +E DA+V+NA AY NNLIRRV N++GPPS+  MPI+ YIYELFNED
Sbjct  261  VVVTETGWPWNGGANERDASVKNAQAYTNNLIRRVLNNSGPPSQPTMPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +R GPVSE++WG+FF NGS VYP++LGGS  G ++ NS+  +FCIA+ GA+E+KL+ G++
Sbjct  321  ERRGPVSEKNWGLFFTNGSTVYPLSLGGS--GPMSGNST-DLFCIAKSGANEDKLRNGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G+ANC+AIQ G PCY PDT +NHASYAYNDYYQR+ SVGGTCDFDGTATTT  D
Sbjct  378  WACG-DGHANCTAIQEGGPCYYPDTTENHASYAYNDYYQRMSSVGGTCDFDGTATTTAAD  436

Query  367  PSYGSCIFTGSSNSSIG-GVPTPAFGPTAP-VGKGSMARAPDIG  242
            PSYGSC FTGS+NS+ G G    A+GP +P  G  S    P+IG
Sbjct  437  PSYGSCGFTGSANSTAGRGFSPTAYGPVSPFTGSKSSMLYPEIG  480



>ref|XP_007205107.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
 gb|EMJ06306.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
Length=494

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 171/212 (81%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWPWFG ++EPDA   NA  Y NNLIRRV ND+GPPS+ K+PI+ YIYELFNED
Sbjct  262  IVVTESGWPWFGGSNEPDANTGNAQTYTNNLIRRVLNDSGPPSQPKLPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPGPVS ++WG+ F NGS+VYP++L  S++ QI  NSS GVFC+A+  A  +KLQ G++
Sbjct  322  ERPGPVSVKNWGVLFTNGSSVYPLSL--STSNQITGNSS-GVFCVAKADADPDKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY P+T+ NHASYA+NDYYQ++QSVGGTCDFD TA TT+VD
Sbjct  379  WACG-QGQANCTPIQEGQRCYLPNTIANHASYAFNDYYQKMQSVGGTCDFDDTAMTTSVD  437

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PSYGSC FTGSSNSS IGG+   A  P++ VG
Sbjct  438  PSYGSCKFTGSSNSSTIGGLTPAAIAPSSAVG  469



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 170/213 (80%), Gaps = 7/213 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWPW G ++EPDA+VENA  Y NNLIRRV ND+GPPS+   PI+AYIYELFNED
Sbjct  262  VVVTESGWPWLGGSNEPDASVENAQTYTNNLIRRVLNDSGPPSKPTFPINAYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+ F NGS VYP+ LG S+       +S+G+FC+A+  A  +KL+ G++
Sbjct  322  KRPGPVSEKNWGVLFTNGSTVYPLTLGTST----PTGNSSGLFCVAKSEADPDKLEDGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG A+C+ IQ GQ CY P+TL NHASYAYNDYYQR+QSVGGTCDFDGTA TTT+D
Sbjct  378  WACG-QGQADCTPIQQGQGCYLPNTLVNHASYAYNDYYQRMQSVGGTCDFDGTAKTTTID  436

Query  367  PSYGSCIFTGSSNSS-IGGV-PTPAFGPTAPVG  275
            PSYGSC F+GSSNSS IGG+ P  A  P+  VG
Sbjct  437  PSYGSCKFSGSSNSSTIGGLTPVSAIAPSTAVG  469



>ref|XP_011048218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048220.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048221.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048222.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048223.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048224.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016027.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016028.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016029.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016030.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016033.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016034.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 169/223 (76%), Gaps = 9/223 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDAT ENA  +N+NLIRRV ND+GPPS+ ++PI+ YIYELFNED
Sbjct  258  IVVTETGWPWLGGANEPDATAENAETFNSNLIRRVLNDSGPPSQPQVPINTYIYELFNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+FF NGSAVY  +L  S++ Q+  N+S   FC+A+P A   KLQ G+D
Sbjct  318  KRPGPVSEKNWGLFFTNGSAVYTFSL--STSNQVTGNNSD--FCVAKPNADPGKLQAGLD  373

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC AIQ GQPCY P+T QNHASYAYNDYYQ+ +SVG TCDFDGTA TTTVD
Sbjct  374  WACG-QGGANCDAIQEGQPCYLPNTYQNHASYAYNDYYQKKRSVGATCDFDGTAATTTVD  432

Query  367  PSYGSCIFTGSS----NSSIGGVPTPAFGPTAPVGKGSMARAP  251
            PSYGSC FTGSS    NS+ G   T A GP  P G  +    P
Sbjct  433  PSYGSCKFTGSSTITPNSNGGFTTTVAPGPVTPQGGSATVNLP  475



>ref|XP_002297638.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
 gb|EEE82443.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
Length=493

 Score =   251 bits (642),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 169/223 (76%), Gaps = 9/223 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDAT ENA  +N+NLIRRV ND+GPPS+ K+PI+ YIYELFNED
Sbjct  258  IVVTETGWPWLGGANEPDATAENAETFNSNLIRRVLNDSGPPSQPKVPINTYIYELFNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+FF NGSAVY  +L  S++ QI  N+S   FC+A+P A   KLQ G+D
Sbjct  318  KRPGPVSEKNWGLFFTNGSAVYTFSL--STSNQITGNNSD--FCVAKPNADPGKLQAGLD  373

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC AIQ G+PCY P+T QNHASYAYNDYY++ +SVG TCDFDGTA TTTVD
Sbjct  374  WACG-QGGANCDAIQEGKPCYLPNTYQNHASYAYNDYYKKKRSVGATCDFDGTAATTTVD  432

Query  367  PSYGSCIFTGSS----NSSIGGVPTPAFGPTAPVGKGSMARAP  251
            PSYGSC FTGSS    NS+ G   T A GP  P G  +    P
Sbjct  433  PSYGSCKFTGSSTITPNSNGGFTTTVAPGPVTPQGGSATVNLP  475



>ref|XP_010044948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 ref|XP_010044949.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 gb|KCW87080.1| hypothetical protein EUGRSUZ_B03614 [Eucalyptus grandis]
Length=495

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 175/214 (82%), Gaps = 4/214 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWPWFG ++EPDAT ENA  +NNNLI+RV N +GPPS+  +PI+ YIYELFNED
Sbjct  262  VMVTETGWPWFGGSNEPDATAENAQTFNNNLIKRVLNGSGPPSQSDVPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+FF NG++VYP++LG S  G+I  NSS G+FC+A+  A  ++LQ G++
Sbjct  322  KRPGPVSEKNWGVFFTNGTSVYPLSLGTS--GRITGNSS-GIFCVAKQDADSDRLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG+ANC+AIQ GQPCYSP+T+ NHASYAYNDYYQ++Q VGGTCDF GTA TTTVD
Sbjct  379  WACG-QGHANCAAIQEGQPCYSPNTVANHASYAYNDYYQKMQGVGGTCDFQGTAMTTTVD  437

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGS  266
            PSYGSC FTGSSNSS       A  P +P+G GS
Sbjct  438  PSYGSCKFTGSSNSSSTVTTPVASAPFSPIGGGS  471



>ref|XP_008229211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008229885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008230593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
Length=494

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 171/212 (81%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWPWFG ++EPDA   NA  Y NNLI+RV ND+GPPS+ K+PI+ YIYELFNED
Sbjct  262  IVVTESGWPWFGGSNEPDANTGNAQTYTNNLIQRVLNDSGPPSQPKLPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPGPVS ++WG+ F NGS+VYP++L  S++ QI  NSS GVFC+A+  A  +KLQ G++
Sbjct  322  ERPGPVSGKNWGVLFTNGSSVYPLSL--STSNQITGNSS-GVFCVAKADADPDKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY P+T+ NHASYA+NDYYQ++QSVGGTCDFD TA TTTVD
Sbjct  379  WACG-QGQANCTPIQKGQRCYLPNTIANHASYAFNDYYQKMQSVGGTCDFDDTAMTTTVD  437

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PSYGSC FTGSSNSS IGG+   A  P++ VG
Sbjct  438  PSYGSCKFTGSSNSSTIGGLTPAAIAPSSAVG  469



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 169/212 (80%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG + EPDA   NA  Y NNLIRRV N +GPPS+ K+PI+ YIYELFNED
Sbjct  262  VVVTETGWPWFGGSKEPDANTGNAQTYTNNLIRRVLNGSGPPSQPKLPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPGPVSE++WG+F+ NGSAVYP++L  S+  QI  NSS GVFC+A+  A  +KLQ G++
Sbjct  322  QRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QITGNSS-GVFCVAKADADPDKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY PDT+ NHASYA+NDYYQ++QS GGTCDFDGTA TTTVD
Sbjct  379  WACG-QGGANCTPIQKGQRCYLPDTIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVD  437

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PSYG+C F+GSSNSS   G+   A  P++PVG
Sbjct  438  PSYGACKFSGSSNSSAFTGLTPAAIAPSSPVG  469



>ref|XP_003524953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=496

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 164/213 (77%), Gaps = 6/213 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG  +EPDAT ENA  Y NN+I+RV ND+GPPS+  + I+ YIYELFNED
Sbjct  262  IVVTETGWPSFGGANEPDATEENAELYINNMIQRVMNDSGPPSQPNIAINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE+SWGIF+ NGS VYP+N G S    +   +S+GVFC+A+ GA  +KLQ G+ 
Sbjct  322  KRNGPVSEKSWGIFYTNGSTVYPLNFGAS---DLITGNSSGVFCVAKDGADTDKLQSGLS  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPGQPCY P+ +++HASYAYNDYYQR  S GGTCDFDGTAT TT D
Sbjct  379  WACG-QGGANCAAIQPGQPCYVPNNVKSHASYAYNDYYQRKHSSGGTCDFDGTATITTKD  437

Query  367  PSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVG  275
            PS  SCIF GSSNSS GG+  P  A GP+ P G
Sbjct  438  PSSSSCIFAGSSNSSTGGLSLPPMALGPSGPFG  470



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 170/213 (80%), Gaps = 5/213 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G  +EP AT ENA  +NNNLI+RV N++GPPS+  +PI+ YIYEL+NED
Sbjct  262  VVVTETGWPWLGGGNEPAATAENAETFNNNLIKRVLNNSGPPSQPDIPINTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSER+WG+F+PNGS VY ++LGGS   +  N S   VFC+A+  A   KLQ G++
Sbjct  322  KRPGPVSERNWGMFYPNGSMVYRLSLGGSDQAESLNGSV--VFCVAKDDADPEKLQDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG +G ANCSAIQPG+PCY PD L++HAS+AYNDYYQ++++ GG+CDFDGTATTTT D
Sbjct  380  WACG-RGQANCSAIQPGRPCYLPDNLKSHASFAYNDYYQKMKNAGGSCDFDGTATTTTRD  438

Query  367  PSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVG  275
            PSYG+C FTGS+N++   G  P  AFGP +P+G
Sbjct  439  PSYGTCRFTGSANANATGGNFPPAAFGPVSPIG  471



>ref|XP_008384395.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349413.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349414.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
Length=494

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG + EPDA   NA  Y NNLIRRV ND+GPPS+ K+PI+ YIYELFNED
Sbjct  262  VVVTETGWPWFGGSKEPDANTGNAQTYTNNLIRRVLNDSGPPSQPKLPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+ + NGSAVYP++L  SS  QI  NSS GVFC A+  A  +KLQ GI+
Sbjct  322  KRPGPVSEKNWGVLYTNGSAVYPLSLSDSS--QITGNSS-GVFCTAKANADPDKLQDGIN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY PDT+ NHASYAYNDYYQ+++S GGTCDFD TA  +TVD
Sbjct  379  WACG-QGGANCTPIQRGQRCYLPDTIVNHASYAYNDYYQKMKSAGGTCDFDDTAIISTVD  437

Query  367  PSYGSCIFTGSSNSSIGGVPTPA-FGPTAPVG  275
            PSYG+C F+GSSNSS     TPA   P+  VG
Sbjct  438  PSYGACKFSGSSNSSKFTGLTPASVAPSTAVG  469



>ref|XP_003531243.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN47972.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=496

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 165/213 (77%), Gaps = 6/213 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG  +EPDAT ENA  Y NN+I+RV ND+GPPS+  + I+ YIYELFNED
Sbjct  262  IVVTETGWPSFGGANEPDATEENAELYINNMIQRVMNDSGPPSQPNIAINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGIF+ NGS VYP++ G S   QI  NSS GVFC+A+ GA  +KLQ G+ 
Sbjct  322  KRNGPVSEKNWGIFYTNGSTVYPLSFGASD--QITGNSS-GVFCVAKDGADTDKLQSGLS  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPGQPCY P+ +++HASYAYNDYYQR  S GGTCDFDGTAT TT D
Sbjct  379  WACG-QGGANCAAIQPGQPCYLPNNVKSHASYAYNDYYQRKHSSGGTCDFDGTATITTKD  437

Query  367  PSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVG  275
            PS  SCIF GSSNSS GG+  P  A GP+ P G
Sbjct  438  PSSSSCIFAGSSNSSTGGLSLPPTALGPSGPFG  470



>emb|CDP16794.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 174/223 (78%), Gaps = 5/223 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G  +E DATV NA  +NNNLIRRVSND+GPPS+  +PI+ YIYELFNED
Sbjct  265  VVVTETGWPWLGGANEQDATVGNAETFNNNLIRRVSNDSGPPSQPDIPINTYIYELFNED  324

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SER+WGIFFPNGS VYPI+L  S      + +S+GVFCIA+  A   KLQ G++
Sbjct  325  KRPGPISERNWGIFFPNGSTVYPISLSSSVN---VSTNSSGVFCIAKQDADSKKLQNGLN  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            +ACG QG ANCSA+Q GQPCY PDTLQ+HASYAYNDYYQ++ + GGTCDFDGTATTT+ D
Sbjct  382  YACG-QGQANCSALQTGQPCYFPDTLQSHASYAYNDYYQKMHTFGGTCDFDGTATTTSQD  440

Query  367  PSYGSCIFTGSSNSSIGGV-PTPAFGPTAPVGKGSMARAPDIG  242
            PSYGSC FTGSS++S  G+ P PA GP  P  +GS  +    G
Sbjct  441  PSYGSCKFTGSSSTSGSGLFPPPALGPVGPSSQGSSVQVFSFG  483



>ref|XP_009364124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=493

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 164/212 (77%), Gaps = 6/212 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG + E DA   NA  Y NNLIRRV ND+GPPS+ K+PI+ YIYELFNED
Sbjct  262  VVVTETGWPWFGGSKESDANTGNAQTYTNNLIRRVLNDSGPPSQPKLPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+ + NGSAVYP++L   S+ QI  NSS GVFC+A+  A  +KLQ GI+
Sbjct  322  KRPGPVSEKNWGVLYTNGSAVYPLSL---SSSQITGNSS-GVFCMAKANADPDKLQDGIN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY PDT+ NHASYAYNDYYQ+++S GGTCDFD TA  +TVD
Sbjct  378  WACG-QGGANCTPIQRGQRCYLPDTIVNHASYAYNDYYQKMKSAGGTCDFDDTAIISTVD  436

Query  367  PSYGSCIFTGSSNSSIGGVPTPA-FGPTAPVG  275
            PSYG+C F+GSSNSS     TPA   P+  VG
Sbjct  437  PSYGACKFSGSSNSSKFAGLTPASVAPSTAVG  468



>gb|AFK45712.1| unknown [Lotus japonicus]
Length=336

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 167/211 (79%), Gaps = 4/211 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG  +EPDAT +NA  Y+NN+IRRV ND+GPPS+  +PI+ YIYELFNED
Sbjct  104  IVVTETGWPSFGGANEPDATEKNAETYSNNMIRRVMNDSGPPSQPSIPINTYIYELFNED  163

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GP+SE++WGIF+ NGSAVYP++   S+ GQ+  NSSA +FC+A+ GA  ++LQ G+ 
Sbjct  164  KRNGPISEKNWGIFYTNGSAVYPLSF--SAFGQVTGNSSA-IFCVAKDGADADELQTGLS  220

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ GQPCY P+ L++HASYAYNDYYQ+  + GGTCDFDGTA  TT D
Sbjct  221  WACG-QGGANCAAIQQGQPCYLPNDLKSHASYAYNDYYQKKNNAGGTCDFDGTAEVTTQD  279

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  275
            PS+GSCIF+GSSN     +P  A GP++P G
Sbjct  280  PSHGSCIFSGSSNPGGVSLPPTALGPSSPFG  310



>ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30317.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=436

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 175/219 (80%), Gaps = 6/219 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDAT  NA  +NNNLIRRV ND+GPPS+  +PI  YIYELFNED
Sbjct  202  IVVTETGWPWLGGANEPDATANNAETFNNNLIRRVLNDSGPPSQPTIPISTYIYELFNED  261

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSER+WG++F NG+AVY ++L  S++ +I  NSS+ VFC+A+  A   KLQ+G++
Sbjct  262  KRPGPVSERNWGLYFTNGTAVYSLSL--SASDRITGNSSS-VFCVAKQNADSAKLQEGLN  318

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ G+PCY+P+ +QNHASYAYNDYYQ++ S GGTCDFDG+ATTTTVD
Sbjct  319  WACG-QGGANCTAIQEGRPCYAPNNIQNHASYAYNDYYQKMHSAGGTCDFDGSATTTTVD  377

Query  367  PSYGSCIFTGSSNSSIGGVPTP--AFGPTAPVGKGSMAR  257
            PSYGSCIFTGSSNSS  G   P  AFGP +P G  +  R
Sbjct  378  PSYGSCIFTGSSNSSTSGGIFPPVAFGPISPQGGSTSLR  416



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 168/212 (79%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG + EPDA   NA  Y NNLI+RV N +GPPS+ K+PI+ YIYELFNED
Sbjct  243  VVVTETGWPWFGGSKEPDANTGNAQTYTNNLIQRVLNGSGPPSQPKLPINTYIYELFNED  302

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPGPVSE++WG+F+ NGSAVYP++L  S+  QI  NSS GVFC+A+  A  +KLQ G++
Sbjct  303  QRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QITGNSS-GVFCVAKADADPDKLQDGLN  359

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY PD++ NHASYA+NDYYQ++QS GGTCDFDGTA TTTVD
Sbjct  360  WACG-QGGANCTPIQKGQRCYLPDSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVD  418

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PS+G+C F+GSSNSS   G+   A  P++ VG
Sbjct  419  PSHGACKFSGSSNSSTFTGLTPAAIAPSSAVG  450



>gb|AFU52654.1| beta-1,3-glucanase 21 [Solanum tuberosum]
Length=443

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G ++EPDAT ENA  +NNNLIRRVSNDTGPPS+ K+PI+ +IYE+FNED
Sbjct  264  VVVTETGWPWAGGSNEPDATKENAETFNNNLIRRVSNDTGPPSQPKIPINTFIYEMFNED  323

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SERSWG+F  NGS VY + LG S +    ++++   FC+A+PGA ENKLQ GI+
Sbjct  324  KRPGPISERSWGVFSTNGSDVYTLGLGSSDSISDNSSTA---FCVAKPGADENKLQDGIN  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSV  416
            WACG QG ANCSAIQ GQPCY PDT+QNHASYAYNDYYQR+ S+
Sbjct  381  WACG-QGRANCSAIQSGQPCYFPDTIQNHASYAYNDYYQRMHSL  423



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 168/212 (79%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG + EPDA   NA  Y NNLI+RV N +GPPS+ K+PI+ YIYELFNED
Sbjct  237  VVVTETGWPWFGGSKEPDANTGNAQTYTNNLIQRVLNGSGPPSQPKLPINTYIYELFNED  296

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPGPVSE++WG+F+ NGSAVYP++L  S+  QI  NSS GVFC+A+  A  +KLQ G++
Sbjct  297  QRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QITGNSS-GVFCVAKADADPDKLQDGLN  353

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY PD++ NHASYA+NDYYQ++QS GGTCDFDGTA TTTVD
Sbjct  354  WACG-QGGANCTPIQKGQRCYLPDSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVD  412

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PS+G+C F+GSSNSS   G+   A  P++ VG
Sbjct  413  PSHGACKFSGSSNSSTFTGLTPAAIAPSSAVG  444



>ref|XP_010673491.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 170/224 (76%), Gaps = 5/224 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPW G  +E DA+V+NA AY  NLI+RV N++GPPS+  MPI+ YIYELFNED
Sbjct  261  VVVTETGWPWNGGANERDASVKNAQAYTKNLIQRVLNNSGPPSQPTMPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +R GPVSE++WG+FF NGS+VYP++  GS  G ++ N + G+FCIA+ GA E+KL+ G++
Sbjct  321  ERRGPVSEKNWGLFFTNGSSVYPLSFDGS--GPMSANFT-GLFCIAKSGADEDKLRNGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WAC   G+ANC+AIQ G PCY PDT++NHASY YNDYYQR+ S GGTCDF GTATTT  D
Sbjct  378  WACSAHGHANCTAIQEGGPCYYPDTIENHASYVYNDYYQRMSSFGGTCDFKGTATTTAAD  437

Query  367  PSYGSCIFTGSSNSSIG-GVPTPAFGPTAP-VGKGSMARAPDIG  242
            PSYG C FTGS+NS+ G G    A+ P +P  G  S    P+IG
Sbjct  438  PSYGPCDFTGSANSTAGRGFSPTAYDPVSPFTGSKSSMLYPEIG  481



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 168/212 (79%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG + EPDA   NA  Y NNLI+RV N +GPPS+ K+PI+ YIYELFNED
Sbjct  262  VVVTETGWPWFGGSKEPDANTGNAQTYTNNLIQRVLNGSGPPSQPKLPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPGPVSE++WG+F+ NGSAVYP++L  S+  QI  NSS GVFC+A+  A  +KLQ G++
Sbjct  322  QRPGPVSEKNWGVFYTNGSAVYPLSLNDSN--QITGNSS-GVFCVAKADADPDKLQDGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY PD++ NHASYA+NDYYQ++QS GGTCDFDGTA TTTVD
Sbjct  379  WACG-QGGANCTPIQKGQRCYLPDSIVNHASYAFNDYYQKMQSAGGTCDFDGTAMTTTVD  437

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PS+G+C F+GSSNSS   G+   A  P++ VG
Sbjct  438  PSHGACKFSGSSNSSTFTGLTPAAIAPSSAVG  469



>ref|XP_003601614.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES71865.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 169/218 (78%), Gaps = 9/218 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTETGWP  G ++EPDA++ENA  YNNNLIRRV ND+GPPS+ KM I+ YIYELF+ED
Sbjct  262  IIVTETGWPHLGGSNEPDASLENAETYNNNLIRRVLNDSGPPSQPKMAINTYIYELFDED  321

Query  727  KRPGPVSERSWGIFF-PNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            KR GP+SER WG+F+  NGS+VYP++   SS+ ++  NSS   FC+A+ GA   K++ G+
Sbjct  322  KRTGPISERHWGLFYTTNGSSVYPLSF--SSSNKVFGNSSKS-FCVAKDGADAEKMEAGL  378

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACG QG ANC+AIQ G+PCY P+ +++HASYAYNDYYQ++ SVGGTCDFD TA  TT 
Sbjct  379  DWACG-QGRANCAAIQAGRPCYFPNDVKSHASYAYNDYYQKMNSVGGTCDFDDTAMITTE  437

Query  370  DPSYGSCIFTGSSNSSIGG---VPTPAFGPTAP-VGKG  269
            DPS+GSCI+ GSSN S GG     + AFGP +P +G G
Sbjct  438  DPSHGSCIYAGSSNLSTGGDGSFSSIAFGPVSPNIGAG  475



>ref|XP_010276339.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWPWFG  +EPDAT +NA  YNNNLIRRV ND GPPS+  +PI  Y+YELFNED
Sbjct  263  IIVTESGWPWFGGANEPDATADNAQTYNNNLIRRVLNDLGPPSQPTIPIRTYVYELFNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPG +SE++WG+FF NG++VYP++  G+S   + N+S  GVFC+A+P A  + LQ G++
Sbjct  323  KRPGSISEKNWGLFFTNGTSVYPLSF-GTSDRVVGNSSGVGVFCVAKPDADSSLLQSGLN  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG +G ANCSAIQ GQPCY P+ LQ+HASYAYNDY+ ++QS G TCDF  TA TTTVD
Sbjct  382  WACG-EGQANCSAIQEGQPCYEPNNLQSHASYAYNDYFHKMQSAGATCDFGRTAITTTVD  440

Query  367  PSYGSCIFTGS  335
            PS+ SC+F GS
Sbjct  441  PSHSSCVFMGS  451



>gb|KHN12071.1| Glucan endo-1,3-beta-glucosidase 4, partial [Glycine soja]
Length=501

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 168/217 (77%), Gaps = 8/217 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG  +EPDAT +N+  YNNNLI+RV N +GPPS+ K+ I+ Y+YELFNED
Sbjct  265  IVVTETGWPSFGGANEPDATTKNSETYNNNLIKRVINGSGPPSQPKIAINTYLYELFNED  324

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GP+SER+WG+F+ NGS+VY ++    SA  ++N +S G FC+A+  A  +KLQ G+ 
Sbjct  325  KRKGPISERNWGVFYANGSSVYSLSF---SASNMSNANSQGSFCVAKDDADTDKLQAGLS  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC AIQPG+PCYSP+ ++NHASYAYNDYYQ++ + GGTCDFDGTATTTT D
Sbjct  382  WACG-QGQANCIAIQPGRPCYSPNNVKNHASYAYNDYYQKMHNAGGTCDFDGTATTTTED  440

Query  367  PSYGSCIFTGSSNSSIGGVPTPA----FGPTAPVGKG  269
            PSYGSCI+ GS+N+  GG  + +     GP +PVG G
Sbjct  441  PSYGSCIYAGSANTRNGGRSSSSTALGLGPVSPVGAG  477



>ref|XP_011093510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093512.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093514.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
Length=502

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 157/197 (80%), Gaps = 4/197 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDAT ENA  YN NLIRRV+ND+GPPS+  +PI+ YIYELFNED
Sbjct  261  IVVTETGWPWSGGANEPDATAENAETYNKNLIRRVANDSGPPSQPAIPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GP S R+WG+ F NG+AVY I L  S++  +  NSSA VFCIA+ GA E  LQ G++
Sbjct  321  KRVGPESGRNWGVLFTNGTAVYDIKL--STSESLDANSSA-VFCIARSGADETSLQDGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC  IQ GQPCY P+TLQNHASYAYNDYYQ+++S GGTCDF GTATTTTVD
Sbjct  378  WACGP-GQANCGPIQQGQPCYIPNTLQNHASYAYNDYYQKMRSSGGTCDFGGTATTTTVD  436

Query  367  PSYGSCIFTGSSNSSIG  317
            PSYGSC FTGS NSS G
Sbjct  437  PSYGSCRFTGSLNSSTG  453



>ref|XP_006601114.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=498

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 168/217 (77%), Gaps = 8/217 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG  +EPDAT +N+  YNNNLI+RV N +GPPS+ K+ I+ Y+YELFNED
Sbjct  262  IVVTETGWPSFGGANEPDATTKNSETYNNNLIKRVINGSGPPSQPKIAINTYLYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GP+SER+WG+F+ NGS+VY ++    SA  ++N +S G FC+A+  A  +KLQ G+ 
Sbjct  322  KRKGPISERNWGVFYANGSSVYSLSF---SASNMSNANSQGSFCVAKDDADTDKLQAGLS  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC AIQPG+PCYSP+ ++NHASYAYNDYYQ++ + GGTCDFDGTATTTT D
Sbjct  379  WACG-QGQANCIAIQPGRPCYSPNNVKNHASYAYNDYYQKMHNAGGTCDFDGTATTTTED  437

Query  367  PSYGSCIFTGSSNSSIGGVPTPA----FGPTAPVGKG  269
            PSYGSCI+ GS+N+  GG  + +     GP +PVG G
Sbjct  438  PSYGSCIYAGSANTRNGGRSSSSTALGLGPVSPVGAG  474



>ref|XP_006596127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN20600.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=501

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 167/215 (78%), Gaps = 8/215 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG  +EPDA+ +NA  YNNNLI RV N +GPPS+ K+ I+ Y+YELFNED
Sbjct  265  IVVTETGWPSFGGANEPDASTKNAETYNNNLIMRVLNGSGPPSQPKIAINTYLYELFNED  324

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GP+SER+WG+F+ NGS+VY ++    SA  ++N +S G FC+A+  A  +KLQ G+ 
Sbjct  325  KRKGPISERNWGVFYANGSSVYSLSF---SAANMSNANSLGSFCVAKDDADTDKLQAGLS  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC AIQPG+PCYSP+ +++HASYAYNDY+Q++ + GGTCDFDGTAT TT D
Sbjct  382  WACG-QGQANCVAIQPGRPCYSPNNVKSHASYAYNDYFQKMHNAGGTCDFDGTATKTTED  440

Query  367  PSYGSCIFTGSSNSSIGGVPTPA----FGPTAPVG  275
            PSYGSCI+ GS+N+SIGG  + +     GP +P+G
Sbjct  441  PSYGSCIYAGSANASIGGRSSSSTALGLGPVSPIG  475



>gb|EYU27069.1| hypothetical protein MIMGU_mgv1a004989mg [Erythranthe guttata]
Length=501

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 165/224 (74%), Gaps = 6/224 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWPWFG  +EPDAT+ NA  Y NNLIRRV+N++GPPS+   PIH YIYELFNED
Sbjct  261  VVVTETGWPWFGGATEPDATLGNAETYINNLIRRVANESGPPSQRSFPIHTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR G VSERSWG+ F NGS VY ++L   S   +  N S  VFCIA+ GA E+ L+ GI+
Sbjct  321  KRGGDVSERSWGLVFANGSTVYDLSLSDGSEDDV--NGSVSVFCIARQGAEESGLRDGIN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC  +Q G+ CY PDTLQNHAS+AYNDYYQ+++  GGTCDF GTA  T+VD
Sbjct  379  WACGP-GRANCGPVQEGRACYMPDTLQNHASFAYNDYYQKMRGAGGTCDFGGTAVITSVD  437

Query  367  PSYGSCIFTGSSNSSIGG-VPTPAFGPTAPVGKGSMARAPDIGR  239
            PSYGSC FTGSSNSS  G  P+PAFGP  P    S  R  DI R
Sbjct  438  PSYGSCRFTGSSNSSTSGPFPSPAFGPVGPSSGSS--RNVDIFR  479



>ref|XP_004502208.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Cicer arietinum]
Length=478

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 165/223 (74%), Gaps = 6/223 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G ++E DA VENA  Y NNLI RV ND+GPPS+ K+PI+ YIYELF+ED
Sbjct  244  IVVTESGWPSLGGSNEQDANVENAETYVNNLILRVLNDSGPPSQPKIPINTYIYELFDED  303

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GP+SER WG+F+ NGS+VYP++  GS   +I  NSS   FC+A+ GA   K++ G+D
Sbjct  304  MRKGPISERHWGLFYSNGSSVYPLSFTGSD--KIFGNSSMS-FCVAKDGADAEKIEAGLD  360

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ G+PC+ P+ +++HASYAYNDYYQ++ S GGTCDFD TA  TT D
Sbjct  361  WACG-QGRANCAAIQAGRPCFFPNNVKSHASYAYNDYYQKMHSAGGTCDFDDTAIITTED  419

Query  367  PSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGKGSMARAPDI  245
            PSYGSCI+ GSSN S   G +P+ A GP  PVG G   +  ++
Sbjct  420  PSYGSCIYAGSSNLSTGDGSLPSMALGPVGPVGVGLKMQVSNL  462



>ref|XP_004502207.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cicer arietinum]
Length=506

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 165/223 (74%), Gaps = 6/223 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G ++E DA VENA  Y NNLI RV ND+GPPS+ K+PI+ YIYELF+ED
Sbjct  272  IVVTESGWPSLGGSNEQDANVENAETYVNNLILRVLNDSGPPSQPKIPINTYIYELFDED  331

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GP+SER WG+F+ NGS+VYP++  GS   +I  NSS   FC+A+ GA   K++ G+D
Sbjct  332  MRKGPISERHWGLFYSNGSSVYPLSFTGSD--KIFGNSSMS-FCVAKDGADAEKIEAGLD  388

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ G+PC+ P+ +++HASYAYNDYYQ++ S GGTCDFD TA  TT D
Sbjct  389  WACG-QGRANCAAIQAGRPCFFPNNVKSHASYAYNDYYQKMHSAGGTCDFDDTAIITTED  447

Query  367  PSYGSCIFTGSSNSSI--GGVPTPAFGPTAPVGKGSMARAPDI  245
            PSYGSCI+ GSSN S   G +P+ A GP  PVG G   +  ++
Sbjct  448  PSYGSCIYAGSSNLSTGDGSLPSMALGPVGPVGVGLKMQVSNL  490



>emb|CAN72077.1| hypothetical protein VITISV_020314 [Vitis vinifera]
Length=473

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 155/191 (81%), Gaps = 4/191 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWPW G  +EPDATVENA  +N+NLIRRV N++GPPS+  +PI+ YIYEL NED
Sbjct  262  VVVTESGWPWLGGANEPDATVENAETFNSNLIRRVLNNSGPPSQPDIPINTYIYELLNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WG+F  NG+AVYP  L  S++ Q   NSS  VFC+A+ GA  + L+KG++
Sbjct  322  KRSGPVSERNWGVFLTNGTAVYP--LSWSTSLQATGNSST-VFCVAKEGADSDDLEKGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG Q   NC+AIQ GQPCYSP+T QNHASYAYNDYYQ+++S GGTCDF GTATTTT D
Sbjct  379  WACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAYNDYYQKMRSGGGTCDFRGTATTTTAD  437

Query  367  PSYGSCIFTGS  335
            PSYGSCIF+GS
Sbjct  438  PSYGSCIFSGS  448



>ref|XP_004139073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
 gb|KGN66575.1| hypothetical protein Csa_1G630300 [Cucumis sativus]
Length=495

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 157/189 (83%), Gaps = 5/189 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP FG  +EPDAT++NAG Y +NLIRRVSND+GPPS+  +PI+ YIYELFNED
Sbjct  261  VVVTETGWPSFGGANEPDATIQNAGTYISNLIRRVSNDSGPPSQPTIPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WGI FPNGSAVYP++   S +G+   NSS  V+C+A+ GA E+KLQ G++
Sbjct  321  KRPGPISEKNWGILFPNGSAVYPLS---SMSGRATANSSV-VYCVAKDGADEDKLQDGLN  376

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ G+PC+ P+ + +HASYAYNDYYQ+++  GGTCDFD TA  TTVD
Sbjct  377  WACG-QGGANCAAIQQGRPCFLPNNITDHASYAYNDYYQKMRGAGGTCDFDSTAMLTTVD  435

Query  367  PSYGSCIFT  341
            PS+GSCIFT
Sbjct  436  PSHGSCIFT  444



>ref|XP_003629715.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AET04191.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 160/208 (77%), Gaps = 1/208 (0%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP FG  +EPDAT ENA  YNNN+I+RV ND+GPPS+  +PI+ YIYELFNED
Sbjct  262  VVVTETGWPSFGGANEPDATAENAETYNNNMIQRVLNDSGPPSQPNIPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGI + NGSAVYP++ GG+S     + +S G+FC+A+ GA  +KLQ G+ 
Sbjct  322  KRNGPVSEKNWGIVYTNGSAVYPLSYGGASGQITGSGNSTGIFCVAKDGADTDKLQNGLS  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY P+ +++HASYAYNDYYQ+ Q VGGTCDFDGTA  T+ D
Sbjct  382  WACG-QGGANCAPIQQGQRCYLPNNVKSHASYAYNDYYQKNQGVGGTCDFDGTAEITSKD  440

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTA  284
            PSYGSC F GSS +    +P  A GP++
Sbjct  441  PSYGSCRFPGSSGAGGVSLPPTALGPSS  468



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   236 bits (603),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 163/212 (77%), Gaps = 6/212 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V VTETGWPW G  +EP AT  NA  +N NLI+RV N +GPPS+  +P++ YIYEL+NED
Sbjct  262  VFVTETGWPWLGGGNEPAATAGNAETFNGNLIKRVMNGSGPPSQPDIPVNTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WG+F+ NGSAVYP++L GS    +  N S GVFC+A+     +KLQ G++
Sbjct  322  KRSGPVSERNWGMFYSNGSAVYPLSLSGSEPAAL--NGSGGVFCMAREETDPDKLQDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ GQPCY P+ L++HAS+AYNDYYQ+++SVGGTCDFDGTA TTT D
Sbjct  380  WACG-QGRANCAAIQQGQPCYLPNNLKSHASFAYNDYYQKMRSVGGTCDFDGTAITTTRD  438

Query  367  PSYGSCIFTGSSNSSI---GGVPTPAFGPTAP  281
            PSYG CI+TGS+N++    G  P  AFGP +P
Sbjct  439  PSYGKCIYTGSANANATGGGNFPPAAFGPVSP  470



>ref|XP_011087559.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Sesamum indicum]
Length=440

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 4/163 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG + EPDAT ENA  YN+NLIRRVSND+GPPS+  +PI+ YIYELFNED
Sbjct  261  IVVTETGWPSFGGSKEPDATAENAETYNSNLIRRVSNDSGPPSQPTIPINTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSER+WG+ F NG+AVY ++L  S +   AN+S+A  FCIA+PGA E+ L+ G++
Sbjct  321  KRPGPVSERNWGVLFTNGTAVYDVSLSDSDSLG-ANSSTA--FCIARPGADESSLRDGLN  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQS  419
            WACGP G ANC+AIQ GQPCYSP+T+QNHASYAYNDYYQ+++S
Sbjct  378  WACGP-GQANCAAIQKGQPCYSPNTVQNHASYAYNDYYQKMRS  419



>ref|XP_008450301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis melo]
Length=495

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 173/208 (83%), Gaps = 6/208 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP FG  +EPDAT++NAG Y +NLIRRVSND+GPPS+  +PI+ Y+YELFNED
Sbjct  261  VVVTETGWPSFGGANEPDATIQNAGTYVSNLIRRVSNDSGPPSQPTIPINTYLYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGP+SE++WGI FPNGSAVYP++L    +G+   NSS  V+C+A+ GA E+KLQ G++
Sbjct  321  KRPGPISEKNWGILFPNGSAVYPLSL---MSGRATANSSE-VYCVAKDGADEDKLQDGLN  376

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ G+PC+ P+ + +HASYAYNDYYQ+++  GGTCDFDGTAT TTVD
Sbjct  377  WACG-QGGANCAAIQQGRPCFLPNNITDHASYAYNDYYQKMRGAGGTCDFDGTATLTTVD  435

Query  367  PSYGSCIFTGSSNSSIGGVPT-PAFGPT  287
            PS+GSCIFTGSSNSS GG  + PA GP+
Sbjct  436  PSHGSCIFTGSSNSSGGGGFSPPALGPS  463



>gb|AFK37243.1| unknown [Medicago truncatula]
Length=498

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 160/208 (77%), Gaps = 1/208 (0%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP FG  +EPDAT ENA  YNNN+I+RV ND+GPPS+  +PI+ YIYELFNED
Sbjct  262  VVVTETGWPSFGGANEPDATAENAETYNNNMIQRVLNDSGPPSQPNIPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGI + NGSAVYP++ GG+S     + +S G+FC+A+ GA  +KLQ G+ 
Sbjct  322  KRNGPVSEKNWGIVYTNGSAVYPLSYGGASGQITGSGNSTGIFCVAKDGADTDKLQNGLS  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY P+ +++HAS+AYNDYYQ+ Q VGGTCDFDGTA  T+ D
Sbjct  382  WACG-QGGANCAPIQQGQRCYLPNNVKSHASHAYNDYYQKNQGVGGTCDFDGTAEITSKD  440

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTA  284
            PSYGSC F GSS +    +P  A GP++
Sbjct  441  PSYGSCRFPGSSGAGGVSLPPTALGPSS  468



>ref|XP_004504325.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cicer arietinum]
Length=496

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 158/212 (75%), Gaps = 4/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPWFG  +EPDAT ENA  YNNN+I+RV N +GPPS+  +P++ YIYELFNED
Sbjct  262  IVVTETGWPWFGGANEPDATAENAETYNNNMIQRVLNGSGPPSQPNLPVNTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GP+SE++WGI + NGS VYP++ G S    I  NSSA VFC+A+ GA  +KLQ G+ 
Sbjct  322  NRNGPISEKNWGIVYTNGSTVYPLSYGASVP--ITGNSSASVFCVAKDGADTDKLQAGLS  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ GQ CY P+ +++HASYAYNDYYQ+    GGTCDFDGTA  T  D
Sbjct  380  WACG-QGGANCAPIQSGQRCYLPNNVKSHASYAYNDYYQKNHGAGGTCDFDGTAEVTAKD  438

Query  367  PSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
            PSYGSC FTGSS +  +   PT A GPT+P G
Sbjct  439  PSYGSCKFTGSSGADGLSLPPTTAQGPTSPSG  470



>ref|XP_011025159.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025160.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025161.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025162.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 165/215 (77%), Gaps = 9/215 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDAT +NA  +NNN+I+RV ND+GPPS+ K PI+ YIYE+FNED
Sbjct  258  IVVTETGWPWLGGANEPDATADNAETFNNNMIQRVQNDSGPPSQPKFPINTYIYEMFNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WG+FF NGS+VY  +L  S++ +I  NSS   FC+A+P A   KLQ G++
Sbjct  318  KRPGPVSEKNWGLFFTNGSSVYTFSL--STSNRITGNSSD--FCVAKPNADPGKLQVGLN  373

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQ GQPCY P+T QNHASYAYNDYYQ++   G TCDFDGTATTTT +
Sbjct  374  WACG-QGGANCSAIQEGQPCYLPNTYQNHASYAYNDYYQKMHLAGATCDFDGTATTTTAN  432

Query  367  PSYGSCIFTGSSNSSIGG----VPTPAFGPTAPVG  275
            PSYGSC FTGSS ++        P+ A GP +P G
Sbjct  433  PSYGSCKFTGSSTTTPSSTGGFTPSVAPGPVSPQG  467



>ref|XP_010651370.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Vitis 
vinifera]
Length=431

 Score =   232 bits (592),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 170/224 (76%), Gaps = 6/224 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWPW G  +EPDATVENA  +N+NLIRRV N++GPPS+  +PI+ YIYEL NED
Sbjct  199  VVVTESGWPWLGGANEPDATVENAETFNSNLIRRVLNNSGPPSQPDIPINTYIYELLNED  258

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WG+F  NG+AVYP  L  S++ Q   NSS  VFC+A+ GA  + L+KG++
Sbjct  259  KRSGPVSERNWGVFLTNGTAVYP--LSWSTSLQATGNSST-VFCVAKEGADSDDLEKGLN  315

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG Q   NC+AIQ GQPCYSP+T QNHASYAYNDYYQ+++S GGTCDF GTATTTT D
Sbjct  316  WACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAYNDYYQKMRSGGGTCDFRGTATTTTAD  374

Query  367  PSYGSCIF--TGSSNSSIGGVPTPAFGPTAPVGKGSMARAPDIG  242
            PSYGSCIF  + +S+SS G  P+ AF P +   +    + P +G
Sbjct  375  PSYGSCIFSGSSNSSSSGGTSPSSAFAPESLSSRSPTLQVPRLG  418



>ref|XP_010651369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Vitis 
vinifera]
Length=494

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWPW G  +EPDATVENA  +N+NLIRRV N++GPPS+  +PI+ YIYEL NED
Sbjct  262  VVVTESGWPWLGGANEPDATVENAETFNSNLIRRVLNNSGPPSQPDIPINTYIYELLNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WG+F  NG+AVYP  L  S++ Q   NSS  VFC+A+ GA  + L+KG++
Sbjct  322  KRSGPVSERNWGVFLTNGTAVYP--LSWSTSLQATGNSST-VFCVAKEGADSDDLEKGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG Q   NC+AIQ GQPCYSP+T QNHASYAYNDYYQ+++S GGTCDF GTATTTT D
Sbjct  379  WACG-QSQVNCTAIQEGQPCYSPNTYQNHASYAYNDYYQKMRSGGGTCDFRGTATTTTAD  437

Query  367  PSYGSCIF  344
            PSYGSCIF
Sbjct  438  PSYGSCIF  445



>gb|KDP42112.1| hypothetical protein JCGZ_01900 [Jatropha curcas]
Length=496

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWPW G  +EPDATV+NA  +NNNLIRRV ND+GPPS+  +PI+ YIYELFNED
Sbjct  262  IVVTETGWPWLGGANEPDATVDNAENFNNNLIRRVLNDSGPPSQPTIPINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KRPGPVSE++WGIFF NG++VY   L  S++ ++  NSSA VFC+A+  A   KL++G++
Sbjct  322  KRPGPVSEKNWGIFFTNGTSVYTFRL--STSNRLTGNSSA-VFCVAKQNADPAKLKEGLN  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+ IQ G PC++PDT QNHASYAYNDYYQ+++  GGTCDFDGTATTTT+D
Sbjct  379  WACG-QGGANCTPIQQGHPCFAPDTYQNHASYAYNDYYQKMRGAGGTCDFDGTATTTTID  437

Query  367  PSYGSC-IFTGSSNSSIGGVPTP-AFGPTAPVGKGS  266
            PSYGSC     S++S+ GG+ +P AFGP +P G+ +
Sbjct  438  PSYGSCTFTGSSNSSTSGGIFSPVAFGPISPQGESA  473



>ref|XP_007161273.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
 gb|ESW33267.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
Length=503

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP FG+ +EPDAT +NA  YNNN+I RV N +GPPS+ K+ ++ Y+YELFNED
Sbjct  265  IVVTETGWPSFGAINEPDATEKNAETYNNNIILRVLNGSGPPSQPKIALNTYLYELFNED  324

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GP+SE++WG+F+ NGS+VYP++    SA  + N +S G FC+A+  +  +KLQ G+ 
Sbjct  325  KRKGPISEKNWGVFYANGSSVYPLSF---SASNLRNGNSLGSFCVAKDDSDTDKLQAGLS  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC AIQPG+PCY P+ +++HASYAYNDYYQ++ + GGTCDFDGTATTTT D
Sbjct  382  WACG-QGQANCVAIQPGRPCYYPNNVKSHASYAYNDYYQKMHNAGGTCDFDGTATTTTED  440

Query  367  PSYGSCIFTGSSNSSIGGVPTPAF----GPTAPVGKGS  266
            PSYGSCI+ GS+NSSIGG  + +     GP +PVG G+
Sbjct  441  PSYGSCIYAGSANSSIGGRSSSSSAVGPGPVSPVGVGA  478



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 164/213 (77%), Gaps = 5/213 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G   E  ATV NA  +N NLI+RV N++GPPS+  +PI+ YIYEL+NED
Sbjct  262  VVVTETGWPSSGGGDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WGI FPNG++VYP++L G S     N+SS  +FC+A+  A ++KL  G++
Sbjct  322  KRSGPVSERNWGILFPNGTSVYPLSLSGGSNSAALNDSS--MFCVAKADADDDKLIDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPGQPCY P+ +++HAS+A+NDYYQ+++S GGTCDFDGTA TTT D
Sbjct  380  WACG-QGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRD  438

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVG  275
            PSY +C +TGS  +NS+ G  P  A GP +P+G
Sbjct  439  PSYRTCAYTGSLNANSTGGNFPPNALGPVSPLG  471



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 162/213 (76%), Gaps = 5/213 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  AT+ NA  +N NLI+RV ND+GPPS+  MPI+ YIYEL++ED
Sbjct  262  VVVTETGWPSAGGSDEASATLANAETFNTNLIKRVLNDSGPPSQPDMPINTYIYELYSED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGI FPNG++VYP++L G S     N SS  +FC+A+  A ++KL  G++
Sbjct  322  KRTGPVSEKNWGILFPNGTSVYPLSLSGGSNSASVNGSS--MFCVAKADADDDKLVDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPG PCY P+ +++HAS+AYNDY+Q+++S GGTCDF GTA TTT D
Sbjct  380  WACG-QGQANCAAIQPGHPCYLPNNVKSHASFAYNDYFQKMKSAGGTCDFSGTAITTTRD  438

Query  367  PSYGSCIFTG--SSNSSIGGVPTPAFGPTAPVG  275
            PSY +C +TG  S+N++ G  P  A GP +P+G
Sbjct  439  PSYKTCAYTGSLSANATGGDFPPSALGPASPLG  471



>ref|XP_007159412.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 ref|XP_007159413.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31406.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31407.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
Length=492

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTETGWP FG  +EPDAT ENA  Y NN+I+RV ND+GPPS+  + I+ YIYELFNED
Sbjct  262  IIVTETGWPSFGGANEPDATEENAELYINNMIQRVMNDSGPPSQPNIAINTYIYELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGIF+ NGS V+P++ G S   QI  NSS GVFC+A+ GA  +KLQ G+ 
Sbjct  322  KRNGPVSEKNWGIFYTNGSTVFPLSFGASD--QITGNSS-GVFCVAKDGADTDKLQAGLS  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQ GQPCY P+ +++HASYAYNDYYQ+  + GGTCDFDGTAT T+ D
Sbjct  379  WACG-QGGANCAAIQQGQPCYLPNNVKSHASYAYNDYYQKKHNGGGTCDFDGTATITSKD  437

Query  367  PSYGSCIFT-GSSNSSIGGVPTPAFGPTAP  281
            PS  SCIFT  S++S    +P  A GP++P
Sbjct  438  PSSSSCIFTGSSNSSGGLSIPPTALGPSSP  467



>ref|XP_010934539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934546.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934552.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
Length=492

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT TGWPW G ++EPDATV+NA AYN+NLIR V N +G PS    P++ YI+ELFNED
Sbjct  262  VIVTATGWPWLGGSNEPDATVDNALAYNSNLIRHVLNGSGTPSRPNAPVNTYIHELFNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE+SWG+FFPNG+ VY +     S     +    GVFCIA   A  N+L+KG+D
Sbjct  322  LRPGPISEKSWGVFFPNGTTVYSLRFEHLSDPNADSAGLVGVFCIANSSADVNELKKGLD  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G+ANCSAIQPGQPCY  D L   ASYAYNDYY R Q+ GGTC+F+ TA  TT D
Sbjct  382  WACG-AGSANCSAIQPGQPCYESDNLVVVASYAYNDYYHRTQANGGTCNFNNTAMITTTD  440

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  281
            PS+GSCIF GS  SN++ G V   AF P +P
Sbjct  441  PSHGSCIFAGSSGSNNTSGDV---AFAPVSP  468



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 168/219 (77%), Gaps = 5/219 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  ATV NA  +N NLI+RV N++GPPS+  +PI+ YIYEL+NED
Sbjct  226  VVVTETGWPSSGGSDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WGI FPNG++VYP++L G S+    N SS  +FC+A+  A ++KL  G++
Sbjct  286  KRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAALNGSS--MFCVAKADADDDKLVDGLN  343

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPGQPCY P+ +++HAS+A+NDYYQ+++S GGTCDFDGTA TTT D
Sbjct  344  WACG-QGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRD  402

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVGKGSMAR  257
            PSY +C +TGS  +N++ G  P  A GP +P+G  + AR
Sbjct  403  PSYRTCAYTGSLNANATNGNFPPDALGPASPLGGNANAR  441



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 162/213 (76%), Gaps = 5/213 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  AT+ NA  +N NL++RV N++GPPS+  +PI+ YIYEL++ED
Sbjct  262  VVVTETGWPSAGGSGEAAATLANAETFNTNLVKRVLNNSGPPSQPGIPINTYIYELYSED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGI FPNG++VYP++L G +     N SS  +FC+A+  A ++KL  G++
Sbjct  322  KRAGPVSEKNWGILFPNGTSVYPLSLSGGANSASPNGSS--LFCVAKADAEDDKLVDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPG PCY PD +++HAS+AYNDYYQ+++S GGTCDF GTA TTT D
Sbjct  380  WACG-QGQANCAAIQPGHPCYLPDNIKSHASFAYNDYYQKMKSAGGTCDFSGTAITTTRD  438

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVG  275
            PSY +C +TGS  +N++ G  P  A GP +P+G
Sbjct  439  PSYKTCAYTGSLTANATGGNFPPTALGPVSPLG  471



>ref|NP_187965.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974302.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974303.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 sp|Q94CD8.1|E134_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 4; AltName: Full=(1->3)-beta-glucan 
endohydrolase 4; Short=(1->3)-beta-glucanase 
4; AltName: Full=Beta-1,3-endoglucanase 4; Short=Beta-1,3-glucanase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59446.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 gb|AAL34291.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 dbj|BAH19959.1| AT3G13560 [Arabidopsis thaliana]
 gb|AEE75372.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75373.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75374.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
Length=505

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 168/219 (77%), Gaps = 5/219 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  ATV NA  +N NLI+RV N++GPPS+  +PI+ YIYEL+NED
Sbjct  262  VVVTETGWPSSGGSDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WGI FPNG++VYP++L G S+    N SS  +FC+A+  A ++KL  G++
Sbjct  322  KRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAALNGSS--MFCVAKADADDDKLVDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPGQPCY P+ +++HAS+A+NDYYQ+++S GGTCDFDGTA TTT D
Sbjct  380  WACG-QGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRD  438

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAPVGKGSMAR  257
            PSY +C +TGS  +N++ G  P  A GP +P+G  + AR
Sbjct  439  PSYRTCAYTGSLNANATNGNFPPDALGPASPLGGNANAR  477



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 158/214 (74%), Gaps = 12/214 (6%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G   E DA + NA  +N+NLI+RV N++GPPS   +PI+ YIYEL+NED
Sbjct  259  VVVTETGWPSSGGAGEADANLANAETFNSNLIKRVLNNSGPPSRPDIPINTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINL--GGSSAGQIANNSSAGVFCIAQPGASENKLQKG  554
            K  GPVSER+WGI FPNG++VYP+ L  G  SAG       + +FC+A+  A E++L+ G
Sbjct  319  KLSGPVSERNWGILFPNGTSVYPLGLTDGSESAG-------STLFCVAKADAEEDELEGG  371

Query  553  IDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatttt  374
            ++WACG QG ANC+ IQPGQ C+ P+ +++HAS+AYNDYYQ+ +S GGTCDF GTA TTT
Sbjct  372  LNWACG-QGGANCALIQPGQACFFPNDIKSHASFAYNDYYQKKKSTGGTCDFSGTAITTT  430

Query  373  vDPSYGSCIFTGS--SNSSIGGVPTPAFGPTAPV  278
             DPSY +C +TGS  +N++ G  PT A GP +P+
Sbjct  431  RDPSYKTCAYTGSPNANATGGNFPTTALGPVSPL  464



>ref|XP_010500722.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010500729.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 162/213 (76%), Gaps = 5/213 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  AT+ NA  +N NLI+RV N++GPPS+  MPI+ YIYEL++ED
Sbjct  262  VVVTETGWPSAGGSDEASATLANAETFNTNLIKRVLNNSGPPSQPDMPINTYIYELYSED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSE++WGI FPNG++VYP++L GSS     N SS  +FC+A+    ++KL  G++
Sbjct  322  KRSGPVSEKNWGILFPNGTSVYPLSLSGSSNSASLNGSS--MFCVAKADVDDDKLVDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANC+AIQPG PCY P+ +++HAS+A+NDYYQ+++S GGTCDF GTA TTT D
Sbjct  380  WACG-QGQANCAAIQPGHPCYLPNNVKSHASFAFNDYYQKMKSAGGTCDFSGTAITTTRD  438

Query  367  PSYGSCIFTG--SSNSSIGGVPTPAFGPTAPVG  275
            PSY +C +TG  S+N++ G  P  A GP +P+G
Sbjct  439  PSYKTCAYTGSLSANATGGDFPPSALGPVSPLG  471



>ref|XP_008789143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Phoenix 
dactylifera]
Length=486

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 148/217 (68%), Gaps = 2/217 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT TGWPW G   E DATV+NA AYN NLIR V N +G PS   +P++ YI+ELFNED
Sbjct  256  VIVTATGWPWLGGAKEHDATVDNALAYNGNLIRHVLNGSGTPSRPTLPVNTYIHELFNED  315

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+FFPNG+ VY +     S     ++   G+FC+A   A  N++++G+D
Sbjct  316  LRPGPISEKNWGVFFPNGTTVYSLTFEHLSDPSADSSGLVGLFCVANSSADLNEVKEGLD  375

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G+ANCSAIQPGQPCY  D L + ASYAYNDYY R Q+ GGTC+F+ TA  TT D
Sbjct  376  WACG-AGSANCSAIQPGQPCYESDNLVDVASYAYNDYYHRTQANGGTCNFNNTAMITTTD  434

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMAR  257
            PS+GSCIF   S+ S       AF P +P    +M +
Sbjct  435  PSHGSCIF-AGSSGSNSTGGGTAFAPVSPSSGATMLQ  470



>ref|XP_008789151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Phoenix 
dactylifera]
Length=460

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 138/190 (73%), Gaps = 1/190 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT TGWPW G   E DATV+NA AYN NLIR V N +G PS   +P++ YI+ELFNED
Sbjct  256  VIVTATGWPWLGGAKEHDATVDNALAYNGNLIRHVLNGSGTPSRPTLPVNTYIHELFNED  315

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+FFPNG+ VY +     S     ++   G+FC+A   A  N++++G+D
Sbjct  316  LRPGPISEKNWGVFFPNGTTVYSLTFEHLSDPSADSSGLVGLFCVANSSADLNEVKEGLD  375

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G+ANCSAIQPGQPCY  D L + ASYAYNDYY R Q+ GGTC+F+ TA  TT D
Sbjct  376  WACGA-GSANCSAIQPGQPCYESDNLVDVASYAYNDYYHRTQANGGTCNFNNTAMITTTD  434

Query  367  PSYGSCIFTG  338
            PS+GSCIF G
Sbjct  435  PSHGSCIFAG  444



>ref|XP_009388453.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 143/211 (68%), Gaps = 1/211 (0%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWP  G  +E DATV+NA  YN+NL+ RV N++G PS+    +  YIYELFNED
Sbjct  230  VIVTASGWPSQGGANESDATVDNALIYNSNLVHRVLNNSGTPSQPTTAVSTYIYELFNED  289

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WGIFF N +AVY ++ G  +  +       GVFC+A P A  N L+KG+D
Sbjct  290  LRPGPVSEKNWGIFFSNETAVYSLSFGNQAVSKPDPTGLVGVFCVANPSADSNALKKGLD  349

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC+AI PG+PCY    L   ASYAYNDYY R+++ GGTC F  TA  ++ +
Sbjct  350  WACGP-GEANCTAILPGEPCYDASNLVALASYAYNDYYHRMKASGGTCSFGNTAMISSTN  408

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  275
            PS+GSCIF GSS  S     + AFGP+   G
Sbjct  409  PSHGSCIFAGSSGPSNSTDSSSAFGPSISYG  439



>ref|XP_009388452.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=494

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 143/211 (68%), Gaps = 1/211 (0%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWP  G  +E DATV+NA  YN+NL+ RV N++G PS+    +  YIYELFNED
Sbjct  261  VIVTASGWPSQGGANESDATVDNALIYNSNLVHRVLNNSGTPSQPTTAVSTYIYELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WGIFF N +AVY ++ G  +  +       GVFC+A P A  N L+KG+D
Sbjct  321  LRPGPVSEKNWGIFFSNETAVYSLSFGNQAVSKPDPTGLVGVFCVANPSADSNALKKGLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC+AI PG+PCY    L   ASYAYNDYY R+++ GGTC F  TA  ++ +
Sbjct  381  WACGP-GEANCTAILPGEPCYDASNLVALASYAYNDYYHRMKASGGTCSFGNTAMISSTN  439

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  275
            PS+GSCIF GSS  S     + AFGP+   G
Sbjct  440  PSHGSCIFAGSSGPSNSTDSSSAFGPSISYG  470



>ref|XP_009146477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
 ref|XP_009146478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
Length=502

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 161/214 (75%), Gaps = 4/214 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  ATV NA  +N+NLI+RV N++GPPS+  +PI+ YIYEL+NED
Sbjct  263  VVVTETGWPSSGGSDETAATVGNAETFNSNLIKRVLNNSGPPSKPDIPINTYIYELYNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAG--VFCIAQPGASENKLQKG  554
            KR GP SE++WG+F+PNG++VYP+ L GS  G   + +  G  +FC+A+  A ++KL+ G
Sbjct  323  KRSGPESEKNWGMFYPNGTSVYPLGLSGSGGGGGGSEALNGTTLFCVAKVDADDDKLEDG  382

Query  553  IDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatttt  374
            ++WACG QG ANC  IQPGQ CY P+ +++HAS+AYNDYYQ+++ VGGTCDFDGTA TT 
Sbjct  383  LNWACG-QGRANCGPIQPGQACYLPNDIKSHASFAYNDYYQKMKGVGGTCDFDGTAITTP  441

Query  373  vDPSYGSCIFTGSSNSS-IGGVPTPAFGPTAPVG  275
             DPSY +C +TGS N++  GG   PA GP + VG
Sbjct  442  RDPSYRTCAYTGSPNANGTGGNFPPALGPASQVG  475



>gb|KGN54064.1| hypothetical protein Csa_4G280410 [Cucumis sativus]
Length=526

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 149/213 (70%), Gaps = 10/213 (5%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVT +GWPW    SEP AT +NA  Y NNLI RV N +GPPSE   P++ YIYELF+ED
Sbjct  285  IVVTASGWPWSDGASEPSATKKNAEIYVNNLITRVLNGSGPPSEPTKPVNTYIYELFSED  344

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            ++P P+S+++WG+    GSA+Y +    SS       SS+ V+C+A+ GA   KLQ G++
Sbjct  345  QKPEPMSQKTWGVLSTKGSAIYRL----SSLSSRVTGSSSFVYCVAKVGADPGKLQNGLN  400

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPC+ PD + NHASYAYNDYYQ++Q  GG+C+FDGTAT T  +
Sbjct  401  WACG-QGGANCSAIQPGQPCFLPDNILNHASYAYNDYYQKMQLNGGSCNFDGTATLTDTN  459

Query  367  PSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  284
            PS GSCI+TGS N S G       P+   GP++
Sbjct  460  PSRGSCIYTGSVNPSGGNGASPPTPSLTLGPSS  492



>ref|XP_008449819.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Cucumis 
melo]
Length=498

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 153/213 (72%), Gaps = 10/213 (5%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWPW     EP AT +NA  Y NNLI RV N +GPPSE   P++ YIYELF+ED
Sbjct  258  IVVTESGWPWSDGADEPYATKQNAEIYVNNLISRVLNGSGPPSEPTKPVNTYIYELFSED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            ++P P+S+++WG+    GSA+Y ++   S + ++A +SS  V+C+A+ GA   KLQ G++
Sbjct  318  QKPEPMSQKNWGVLSTKGSAIYRLS---SLSSRVAGSSSV-VYCVAKDGADPGKLQNGLN  373

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPC+ PD + NHASYAYNDYYQ++Q  GGTC+FDGTAT T  +
Sbjct  374  WACG-QGGANCSAIQPGQPCFLPDNIVNHASYAYNDYYQKMQLNGGTCNFDGTATLTNTN  432

Query  367  PSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  284
            PS GSC++TGS N S G       P+   GP++
Sbjct  433  PSRGSCVYTGSVNPSGGNGASPPTPSLTLGPSS  465



>ref|XP_008449817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Cucumis 
melo]
Length=522

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 152/213 (71%), Gaps = 10/213 (5%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWPW     EP AT +NA  Y NNLI RV N +GPPSE   P++ YIYELF+ED
Sbjct  282  IVVTESGWPWSDGADEPYATKQNAEIYVNNLISRVLNGSGPPSEPTKPVNTYIYELFSED  341

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            ++P P+S+++WG+    GSA+Y +    S + ++A +SS  V+C+A+ GA   KLQ G++
Sbjct  342  QKPEPMSQKNWGVLSTKGSAIYRL---SSLSSRVAGSSSV-VYCVAKDGADPGKLQNGLN  397

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPC+ PD + NHASYAYNDYYQ++Q  GGTC+FDGTAT T  +
Sbjct  398  WACG-QGGANCSAIQPGQPCFLPDNIVNHASYAYNDYYQKMQLNGGTCNFDGTATLTNTN  456

Query  367  PSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  284
            PS GSC++TGS N S G       P+   GP++
Sbjct  457  PSRGSCVYTGSVNPSGGNGASPPTPSLTLGPSS  489



>dbj|BAH57260.1| AT3G13560 [Arabidopsis thaliana]
Length=452

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G + E  ATV NA  +N NLI+RV N++GPPS+  +PI+ YIYEL+NED
Sbjct  262  VVVTETGWPSSGGSDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR GPVSER+WGI FPNG++VYP++L G S+    N SS  +FC+A+  A ++KL  G++
Sbjct  322  KRSGPVSERNWGILFPNGTSVYPLSLSGGSSSAALNGSS--MFCVAKADADDDKLVDGLN  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQS  419
            WACG QG ANC+AIQPGQPCY P+ +++HAS+A+NDYYQ+++S
Sbjct  380  WACG-QGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKS  421



>ref|XP_008449814.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
Length=525

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 153/213 (72%), Gaps = 10/213 (5%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWPW     EP AT +NA  Y NNLI RV N +GPPSE   P++ YIYELF+ED
Sbjct  285  IVVTESGWPWSDGADEPYATKQNAEIYVNNLISRVLNGSGPPSEPTKPVNTYIYELFSED  344

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            ++P P+S+++WG+    GSA+Y ++   S + ++A +SS  V+C+A+ GA   KLQ G++
Sbjct  345  QKPEPMSQKNWGVLSTKGSAIYRLS---SLSSRVAGSSSV-VYCVAKDGADPGKLQNGLN  400

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPC+ PD + NHASYAYNDYYQ++Q  GGTC+FDGTAT T  +
Sbjct  401  WACG-QGGANCSAIQPGQPCFLPDNIVNHASYAYNDYYQKMQLNGGTCNFDGTATLTNTN  459

Query  367  PSYGSCIFTGSSNSSIGG-----VPTPAFGPTA  284
            PS GSC++TGS N S G       P+   GP++
Sbjct  460  PSRGSCVYTGSVNPSGGNGASPPTPSLTLGPSS  492



>ref|XP_009413316.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 131/188 (70%), Gaps = 1/188 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V V  +GWP  G  SEP+A ++NA AYN+NLIR V N +G PS+    + AY++ELFNED
Sbjct  261  VTVMASGWPSLGGASEPEANIDNALAYNSNLIRHVLNGSGTPSQPTTSVSAYVHELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WGIF  NG+AVY +  G  +     +    GVFC+A   A  N L+KG+D
Sbjct  321  VRPGPVSEKNWGIFASNGTAVYSLKFGHLAESSAESTGLVGVFCVANSSADSNALKKGLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANC+AIQ GQPCY  D L   ASYAYNDYY R Q+ GG+C+F  TA  TT D
Sbjct  381  WACGP-GSANCTAIQQGQPCYEADNLVAIASYAYNDYYHRTQASGGSCNFGNTAMITTTD  439

Query  367  PSYGSCIF  344
            PS+GSCIF
Sbjct  440  PSHGSCIF  447



>ref|XP_010236492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brachypodium distachyon]
Length=501

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 140/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G+ +EP A V+NA AYN NLIR V N +G PS+ K  +  Y++ELF+ED
Sbjct  270  VMVTASGWPWRGARNEPAADVDNALAYNTNLIRHVLNSSGTPSQPKNQVSTYLFELFSED  329

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +R GPVSE++WGI F N SAVY +     +A    + +  G+FC+A   AS + L++ +D
Sbjct  330  RRTGPVSEQNWGIMFTNASAVYSLAFEDVAANNTDSPALRGMFCVANSSASHSALKQSLD  389

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPGQPCY  D +   ASYA+NDYY R Q+ GGTC+F+GTAT ++ D
Sbjct  390  WACGP-GSANCSAIQPGQPCYKSDDIVAVASYAFNDYYHRTQTSGGTCNFNGTATISSTD  448

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  449  PSHGSCIFLGST  460



>ref|XP_004173668.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like, partial [Cucumis 
sativus]
Length=392

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVV E+GWP  G  SEPDAT++NA  YN+NLIR V N+TG P    +P+  YIYEL+NED
Sbjct  151  VVVMESGWPSKGDASEPDATLDNANTYNSNLIRHVLNNTGTPKHPGVPVSTYIYELYNED  210

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             RPG VSE++WG+F+P G  VY ++L  SSAG + AN+++   FC+A+ GA    LQ G+
Sbjct  211  LRPGLVSEKNWGLFYPTGMPVYTLHL--SSAGAVLANDTTNQTFCVAKDGADRKLLQAGL  268

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G A  TT 
Sbjct  269  DWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSSGTCDFKGVAIITTT  327

Query  370  DPSYGSCIFTGSSNSSIGGVPTPAFGPTA  284
            +PS+ SCIF GS+ S+   V + +  P++
Sbjct  328  NPSHSSCIFPGSTGSNGSLVNSTSLAPSS  356



>ref|XP_004162024.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4-like [Cucumis sativus]
Length=623

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 139/190 (73%), Gaps = 5/190 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVT +GWPW    SEP AT ENA  Y NNLI RV N +GPPSE   P++ YIYELF+ED
Sbjct  373  IVVTASGWPWSDGASEPSATXENAEIYVNNLITRVLNGSGPPSEPTKPVNTYIYELFSED  432

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            ++P P+S+++WG+    GSA+Y +    SS       SS+ V+C+A+ GA   KLQ G++
Sbjct  433  QKPEPMSQKTWGVLSTKGSAIYRL----SSLSSRVTGSSSFVYCVAKVGADPGKLQNGLN  488

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPC+ PD + NHASYAYNDYYQ++Q  GG+C+FDGTAT T  +
Sbjct  489  WACG-QGGANCSAIQPGQPCFLPDNILNHASYAYNDYYQKMQLNGGSCNFDGTATLTDTN  547

Query  367  PSYGSCIFTG  338
            PS GSCI+TG
Sbjct  548  PSRGSCIYTG  557



>ref|XP_004142250.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis sativus]
Length=535

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 139/190 (73%), Gaps = 5/190 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVT +GWPW    SEP AT +NA  Y NNLI RV N +GPPSE   P++ YIYELF+ED
Sbjct  285  IVVTASGWPWSDGASEPSATKKNAEIYVNNLITRVLNGSGPPSEPTKPVNTYIYELFSED  344

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            ++P P+S+++WG+    GSA+Y +    SS       SS+ V+C+A+ GA   KLQ G++
Sbjct  345  QKPEPMSQKTWGVLSTKGSAIYRL----SSLSSRVTGSSSFVYCVAKVGADPGKLQNGLN  400

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCSAIQPGQPC+ PD + NHASYAYNDYYQ++Q  GG+C+FDGTAT T  +
Sbjct  401  WACG-QGGANCSAIQPGQPCFLPDNILNHASYAYNDYYQKMQLNGGSCNFDGTATLTDTN  459

Query  367  PSYGSCIFTG  338
            PS GSCI+TG
Sbjct  460  PSRGSCIYTG  469



>ref|XP_008452394.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Cucumis 
melo]
Length=467

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 141/202 (70%), Gaps = 7/202 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVV E+GWP  G  SEPDAT++NA  YN+NLIR V N+TG P    +P+  YIYELFNED
Sbjct  226  VVVMESGWPSKGDASEPDATLDNANTYNSNLIRHVLNNTGTPKHPGVPVSTYIYELFNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             RPG VSE++WG+F+P G  VY ++L  SSAG + AN+++   FC+A+ GA    LQ G+
Sbjct  286  LRPGLVSEKNWGLFYPTGVPVYTLHL--SSAGAVLANDTTNQTFCVAKDGADRKLLQAGL  343

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G A  TT 
Sbjct  344  DWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSPGTCDFKGVAIITTT  402

Query  370  DPSYGSCIF---TGSSNSSIGG  314
            +PS+ SCIF   TGS+ SS+ G
Sbjct  403  NPSHSSCIFPGSTGSNGSSVNG  424



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 141/202 (70%), Gaps = 7/202 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVV E+GWP  G  SEPDAT++NA  YN+NLIR V N+TG P    +P+  YIYELFNED
Sbjct  259  VVVMESGWPSKGDASEPDATLDNANTYNSNLIRHVLNNTGTPKHPGVPVSTYIYELFNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             RPG VSE++WG+F+P G  VY ++L  SSAG + AN+++   FC+A+ GA    LQ G+
Sbjct  319  LRPGLVSEKNWGLFYPTGVPVYTLHL--SSAGAVLANDTTNQTFCVAKDGADRKLLQAGL  376

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G A  TT 
Sbjct  377  DWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSPGTCDFKGVAIITTT  435

Query  370  DPSYGSCIF---TGSSNSSIGG  314
            +PS+ SCIF   TGS+ SS+ G
Sbjct  436  NPSHSSCIFPGSTGSNGSSVNG  457



>ref|XP_009406533.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 132/190 (69%), Gaps = 1/190 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G  +E DA+++NA  YN+NLI  V N +G PS+  + +  Y+ ELFNED
Sbjct  289  VIVTESGWPSLGGANESDASIDNALTYNSNLIHHVLNGSGTPSQPTISVSTYVLELFNED  348

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WGI+ PNG+A+Y +  G  +     +    GVFC+A      N L+KG+D
Sbjct  349  LRPGPVSEKNWGIYVPNGTALYSLTFGRIAESNADSTGLVGVFCVANSSVDSNALKKGLD  408

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANC+AIQPGQ CY  D L    SYA+NDYY R Q+ GGTC+F  TA  TT D
Sbjct  409  WACGP-GSANCTAIQPGQACYEADNLVALTSYAFNDYYHRTQATGGTCNFGNTAMITTTD  467

Query  367  PSYGSCIFTG  338
            PS+GSCIF+G
Sbjct  468  PSHGSCIFSG  477



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cucumis sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVV E+GWP  G  SEPDAT++NA  YN+NLIR V N+TG P    +P+  YIYEL+NED
Sbjct  259  VVVMESGWPSKGDASEPDATLDNANTYNSNLIRHVLNNTGTPKHPGVPVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             RPG VSE++WG+F+P G  VY ++L  SSAG + AN+++   FC+A+ GA    LQ G+
Sbjct  319  LRPGLVSEKNWGLFYPTGMPVYTLHL--SSAGAVLANDTTNQTFCVAKDGADRKLLQAGL  376

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G A  TT 
Sbjct  377  DWACGP-GRVDCSPLLQGQPCYQPDNVIAHATYAFNAYYQKMGKSSGTCDFKGVAIITTT  435

Query  370  DPSYGSCIFTGSSNSSIGGVPTPAFGPTA  284
            +PS+ SCIF GS+ S+   V + +  P++
Sbjct  436  NPSHSSCIFPGSTGSNGSLVNSTSLAPSS  464



>ref|NP_001149308.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
 gb|ACG34964.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
Length=494

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 145/211 (69%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  SE  ATV+NA AYN NLI  V N++G PS+       YI+ELFNED
Sbjct  261  VLVTASGWPWRGGPSEKAATVDNALAYNTNLIHHVLNNSGTPSQPNNQSSTYIFELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + +Y ++    +     + +  GVFC+A   AS + L+  +D
Sbjct  321  NRSGPVSEQNWGIMFPNATTIYSLSFEDVATAIPESPALRGVFCVANSSASHSALKHSLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSA+QPGQPCY+ D +   ASYA+NDYY R QS GGTC+F+GTA  T+ D
Sbjct  381  WACGP-GSANCSAVQPGQPCYASDDIAAVASYAFNDYYHRTQSSGGTCNFNGTAMITSTD  439

Query  367  PSYGSCIFTGSS--NSSIGGVPTPAFGPTAP  281
            PS+GSCIF+GS+  N S GG    A GP +P
Sbjct  440  PSHGSCIFSGSTGANGSNGGT---ASGPVSP  467



>ref|XP_002527772.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF34582.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=533

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 137/192 (71%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G ++EPDAT+ENA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSAEPDATIENANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP SE++WG+F+ NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  LRPGPASEKNWGLFYANGVPVYILHLTGAGT-VLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD +  H++YA+N Y+QR+    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSAMLQGQPCYEPDNVVAHSTYAFNAYFQRMAKSPGTCDFKGVATITTTD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  437  PSHGSCIFPGSA  448



>gb|ACF87545.1| unknown [Zea mays]
Length=432

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 145/211 (69%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  SE  ATV+NA AYN NLI  V N++G PS+       YI+ELFNED
Sbjct  199  VLVTASGWPWRGGPSEKAATVDNALAYNTNLIHHVLNNSGTPSQPNNQPSTYIFELFNED  258

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + +Y ++    +     + +  GVFC+A   AS + L+  +D
Sbjct  259  NRSGPVSEQNWGIMFPNATTIYSLSFEDVATAIPESPALRGVFCVANSSASHSALKHSLD  318

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSA+QPGQPCY+ D +   ASYA+NDYY R QS GGTC+F+GTA  T+ D
Sbjct  319  WACGP-GSANCSAVQPGQPCYASDDIVAVASYAFNDYYHRTQSSGGTCNFNGTAMITSTD  377

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  281
            PS+GSCIF+GS  +N S GG    A GP +P
Sbjct  378  PSHGSCIFSGSAGANGSNGGT---ASGPVSP  405



>ref|XP_008361481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=504

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 141/210 (67%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  +IYEL+NED
Sbjct  267  IIVTESGWPSKGDSNEPDATLENANTYNSNLIRHVLNKTGTPKHPGLAVSTFIYELYNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG+ +Y + L GS A  +AN+++   FC  + GA    LQ  +D
Sbjct  327  TKPGPVSEKNWGLFDANGTPIYILRLTGSGA-VLANDTTNQTFCTMKDGADPKMLQAALD  385

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD +  HA+YA++ YY ++     +CDF+G AT TT D
Sbjct  386  WACGP-GKVDCSALLQGQPCYEPDDVAAHATYAFDTYYHQMGMTSASCDFNGVATITTTD  444

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS+GSCIF GS   N S+  +  P+   T+
Sbjct  445  PSHGSCIFPGSLGKNGSMANITAPSLNSTS  474



>tpg|DAA63295.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA63296.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=494

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 145/211 (69%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  SE  ATV+NA AYN NLI  V N++G PS+       YI+ELFNED
Sbjct  261  VLVTASGWPWRGGPSEKAATVDNALAYNTNLIHHVLNNSGTPSQPNNQPSTYIFELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + +Y ++    +     + +  GVFC+A   AS + L+  +D
Sbjct  321  NRSGPVSEQNWGIMFPNATTIYSLSFEDVATAIPESPALRGVFCVANSSASHSALKHSLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSA+QPGQPCY+ D +   ASYA+NDYY R QS GGTC+F+GTA  T+ D
Sbjct  381  WACGP-GSANCSAVQPGQPCYASDDIVAVASYAFNDYYHRTQSSGGTCNFNGTAMITSTD  439

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  281
            PS+GSCIF+GS  +N S GG    A GP +P
Sbjct  440  PSHGSCIFSGSAGANGSNGGT---ASGPVSP  467



>ref|XP_009351539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Pyrus x bretschneideri]
Length=498

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ G+ +  LQ G+D
Sbjct  319  LRPGSVSEKNWGLFNADGVPVYTLHLTGAGT-VLANDTTNQTFCVAKEGSDKKMLQAGLD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA+N Y+QR+    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPDNVLTHATYAFNAYFQRMAKAPGTCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  437  PSHGSCIFPGS  447



>ref|XP_010108988.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
 gb|EXC20628.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
Length=497

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 143/221 (65%), Gaps = 5/221 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDAT+ENA  YN+NLIRRV N TG P    + +  +IYEL+NED
Sbjct  259  VVVTETGWPSKGDSNEPDATLENANTYNSNLIRRVLNKTGTPKRPGLAVSTFIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            K+PGPVSE++WG+F  NG  +Y ++L   S   +AN+++   +C A  GA +  LQ  +D
Sbjct  319  KKPGPVSEKNWGLFDVNGVPIYIMHL-TDSGNVLANDTTNQTYCAAMEGADKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD + +HA++A++ YY ++      CDF+G AT TT D
Sbjct  378  WACGP-GRVDCSPLLQGQPCYEPDNVASHATFAFDAYYHKMGKAADACDFNGVATITTTD  436

Query  367  PSYGSCIF---TGSSNSSIGGVPTPAFGPTAPVGKGSMARA  254
            PS+GSC+F    G + S++  V  P    T+     S  R+
Sbjct  437  PSHGSCVFLESLGKNGSTLANVTAPTLNSTSLDSSASDFRS  477



>ref|XP_010100650.1| Glucan endo-1,3-beta-glucosidase 3 [Morus notabilis]
 gb|EXC44994.1| Glucan endo-1,3-beta-glucosidase 3 [Morus notabilis]
Length=467

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDAT+ENA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  226  IVVTESGWPSKGDSSEPDATLENANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  286  LRPGSVSEKNWGLFDANGEPVYILHLTGAGT-VLANDTTNQTFCVAKDGADRKMLQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  345  WACGP-GKVDCSPLLQGQPCYQPDNVVAHSTYAFNAYFQKMTKSPGTCDFKGVATITTTD  403

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  404  PSHGSCIFPGSA  415



>ref|XP_007225735.1| hypothetical protein PRUPE_ppa005356mg [Prunus persica]
 gb|EMJ26934.1| hypothetical protein PRUPE_ppa005356mg [Prunus persica]
Length=465

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  226  IVVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA +  LQ  +D
Sbjct  286  LRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VLANDTTNQTFCVAKEGADQKMLQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA N Y+QR+    GTCDF G AT TT D
Sbjct  345  WACGP-GKVDCSPLLQGQPCYEPDNVLTHATYAVNAYFQRMAKSPGTCDFKGVATVTTTD  403

Query  367  PSYGSCIFTGS  335
            PS+G+CIF GS
Sbjct  404  PSHGTCIFPGS  414



>ref|NP_001131285.1| putative O-Glycosyl hydrolase superfamily protein isoform 1 precursor 
[Zea mays]
 gb|ACF79625.1| unknown [Zea mays]
 gb|ACL53366.1| unknown [Zea mays]
 tpg|DAA41198.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA41199.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=492

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 147/217 (68%), Gaps = 5/217 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  SE  ATV+NA AYN NLI  V N++G PS+       YI+ELFNED
Sbjct  261  VLVTASGWPWRGGPSEKAATVDNALAYNTNLIHHVLNNSGTPSQPNNQSSTYIFELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + +Y ++    +     + +  GVFC+A P A  + L+  +D
Sbjct  321  NRSGPVSEQNWGIMFPNATTIYSLSFEDVATTIPESPALRGVFCVANPSAPHSALKHSLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPG+PCY+ D +   ASYA+NDYY R QS GGTC+F+GTA  T+ D
Sbjct  381  WACGP-GSANCSAIQPGKPCYASDDIVAVASYAFNDYYHRTQSSGGTCNFNGTAMITSTD  439

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMAR  257
            PS+GSC+F GS+ ++ GG    A GP +P    S ++
Sbjct  440  PSHGSCVFAGSTGAN-GGT---ASGPVSPDSFASKSK  472



>ref|XP_008221445.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Prunus mume]
Length=513

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  274  IVVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  333

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA +  LQ  +D
Sbjct  334  LRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VLANDTTNQTFCVAKEGADQKMLQAALD  392

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA N Y+QR+    GTCDF G AT TT D
Sbjct  393  WACGP-GKVDCSPLLQGQPCYEPDNVLTHATYAVNAYFQRMAKSPGTCDFKGVATVTTTD  451

Query  367  PSYGSCIFTGS  335
            PS+G+CIF GS
Sbjct  452  PSHGTCIFPGS  462



>gb|KDP38099.1| hypothetical protein JCGZ_04742 [Jatropha curcas]
Length=498

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDATVENA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSSEPDATVENANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  IRPGPVSEKNWGLFDSNGVPVYILHLTGAGT-VLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPC  PD +  H++YA+N Y+QR+    GTCDF G AT TT D
Sbjct  378  WACGP-GRVDCSILLQGQPCNEPDNVVAHSTYAFNAYFQRMAKSPGTCDFKGVATITTTD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  437  PSHGSCIFPGSA  448



>gb|EMS53703.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=477

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 1/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  +EP A V+NA AYN NLIR V N++G PS+       Y++ELFNED
Sbjct  261  VIVTASGWPWRGGRNEPAADVDNALAYNTNLIRHVLNNSGTPSQPNNQASTYLFELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +R GPVSE++WGI F N SAVY +     +     + +  G+FC+A   A+ + L++ +D
Sbjct  321  RRAGPVSEQNWGIMFTNASAVYSLTFEDVATNNTDSPALRGMFCVANSSAAHSALKQSLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            W CGP G+ANCSAIQPGQ CY  D +   ASYA+NDYY R Q+ GGTC+F+GTAT ++ D
Sbjct  381  WVCGP-GSANCSAIQPGQQCYKADDIVAVASYAFNDYYHRTQASGGTCNFNGTATISSTD  439

Query  367  PSYGSCIFTGSS  332
            PS+GSC+F GS+
Sbjct  440  PSHGSCVFAGST  451



>ref|XP_008460530.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Cucumis 
melo]
Length=463

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VV+ETGWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + I  YIYEL+NED
Sbjct  226  IVVSETGWPSKGGSNEPDATLENANTYNSNLIRHVLNKTGTPKHPGIAISTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SER+WG+F  NG  VY + L GS    +AN+++   +C A+ G     LQ  +D
Sbjct  286  LKPGPISERNWGLFDANGKPVYILRLTGSGL-VLANDTTNQTYCAAKEGVDPRMLQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD +  HA+YA+N YY ++    G+CDF+G A  TT +
Sbjct  345  WACGP-GRVDCSALLQGQPCYEPDNVMAHATYAFNTYYLQMGKASGSCDFNGVAAVTTTN  403

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC F+GS   N ++  +  P+   T
Sbjct  404  PSHGSCSFSGSVGRNGTMANITAPSMNST  432



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 140/210 (67%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  +IYEL+NED
Sbjct  267  IIVTESGWPSKGDSNEPDATLENANTYNSNLIRHVLNKTGTPKHPGLAVSTFIYELYNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG+ +Y + L GS A  ++N+++   FCI + GA    LQ  +D
Sbjct  327  MKPGPISEKNWGLFDANGTPIYILRLTGSGA-VLSNDTTNQTFCITKDGADPKMLQAALD  385

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+PCY PD +  HA+YA++ YY ++      CDF+G A  TT D
Sbjct  386  WACGP-GKVDCSALLQGEPCYEPDNVIAHATYAFDTYYHKMGKTPAACDFNGVAAITTTD  444

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS+GSCIF GS   N ++  +  P+   T+
Sbjct  445  PSHGSCIFPGSLGKNGTLVNITAPSLNSTS  474



>ref|XP_002312452.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89819.2| glucan endo-1 family protein [Populus trichocarpa]
Length=465

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT+ENA  YN+NLIR V N+TG P   K+ +  YIYEL+NED
Sbjct  226  IFVTESGWPSKGDSSEPDATLENANTYNSNLIRHVLNNTGTPKHPKIAVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG +SE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  286  LRPGAISEKNWGLFDANGMPVYTLHLTGAGT-VLANDTTNQTFCVAKEGADPKMLQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  345  WACGP-GKVDCSYLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGVATITTTD  403

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  404  PSHGSCIFPGSA  415



>ref|XP_011070588.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=499

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR + N+TG P    + +  YIYEL+NED
Sbjct  260  ITVTESGWPSKGDSSEPDATMDNANTYNSNLIRHILNNTGTPKHPGIAVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+F  NG  VY ++L GS    +AN+++   +C+A+ GA +  LQ  +D
Sbjct  320  LRPGPISEKNWGLFDANGVPVYILHLTGSGT-VLANDTTNQTYCVAREGADKKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PDT+  HASYA++ YY R+    GTC+F+G AT TT D
Sbjct  379  WACGP-GKVDCSPLLQGQPCYEPDTVVAHASYAFDAYYHRMVMGDGTCNFNGVATITTTD  437

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  438  PSHGSCIFPGS  448



>ref|XP_008460531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Cucumis 
melo]
Length=481

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VV+ETGWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + I  YIYEL+NED
Sbjct  244  IVVSETGWPSKGGSNEPDATLENANTYNSNLIRHVLNKTGTPKHPGIAISTYIYELYNED  303

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SER+WG+F  NG  VY + L GS    +AN+++   +C A+ G     LQ  +D
Sbjct  304  LKPGPISERNWGLFDANGKPVYILRLTGSGL-VLANDTTNQTYCAAKEGVDPRMLQAALD  362

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD +  HA+YA+N YY ++    G+CDF+G A  TT +
Sbjct  363  WACGP-GRVDCSALLQGQPCYEPDNVMAHATYAFNTYYLQMGKASGSCDFNGVAAVTTTN  421

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC F+GS   N ++  +  P+   T
Sbjct  422  PSHGSCSFSGSVGRNGTMANITAPSMNST  450



>ref|XP_002460914.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
 gb|EER97435.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
Length=494

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 142/209 (68%), Gaps = 2/209 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  SE  ATV+NA AYN NLI  V N++G PS+       YI+ELFNED
Sbjct  261  VLVTASGWPWRGGPSEKAATVDNALAYNTNLIHHVLNNSGTPSQPNNQSSTYIFELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + +Y ++    +     + +  GVFC+A   A  + L+  +D
Sbjct  321  NRSGPVSEQNWGIMFPNATTIYSLSFEDVATTIPESPALRGVFCVANSSAPHSALKHSLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPGQPCY+ D +   +SYA+NDYY R QS GGTC+F+GTA  T+ D
Sbjct  381  WACGP-GSANCSAIQPGQPCYASDDIVAVSSYAFNDYYHRTQSSGGTCNFNGTAMITSTD  439

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPTAP  281
            PS+GSCIF GS+ +S G     A GP +P
Sbjct  440  PSHGSCIFAGSTGAS-GSKGGTASGPASP  467



>ref|XP_010267790.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nelumbo nucifera]
Length=495

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  +EPDAT++NA +YN+NLIR V N+TG P    +P+  YIYEL+NED
Sbjct  258  IVVTESGWPSKGDNNEPDATLDNANSYNSNLIRHVLNNTGTPKHSGVPVSTYIYELYNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
              PGP+SE++WG+F  NG  VY ++L GS    +AN+++   +CIA+  A    +Q  +D
Sbjct  318  LSPGPLSEKNWGLFDANGIPVYILHLTGSGM-VLANDTTNQTYCIARDSADPKMVQAALD  376

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PDT+  HA+YA+N YY +++   GTC F+G AT TT D
Sbjct  377  WACGP-GKVDCSPLLQGQPCYEPDTVNAHATYAFNAYYHQMEMASGTCYFNGVATITTTD  435

Query  367  PSYGSCIFTGS--SNSSIGG  314
            PS+GSCIF GS   N +I G
Sbjct  436  PSHGSCIFLGSGGKNGTING  455



>ref|XP_011001568.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Populus euphratica]
Length=503

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 143/210 (68%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G T+EPDAT++NA  YN+NLIR V N TG P+   + +  YIYEL+NED
Sbjct  267  VMVTESGWPSKGDTNEPDATLDNANTYNSNLIRHVLNKTGTPNHPGIAVSTYIYELYNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG  +Y ++L G+    +AN+++   +C A+ GA    LQ  +D
Sbjct  327  LKPGPVSEKNWGLFNANGEPIYILHLTGAGL-VLANDTTNQTYCTAKEGADPKMLQAALD  385

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  NCSAI  G+PCY PD +  HA+YA+N YY R+    GTCDF+G A  TT +
Sbjct  386  WACGP-GKVNCSAILQGEPCYEPDNVIAHATYAFNSYYSRMGKAPGTCDFNGVAAITTTN  444

Query  367  PSYGSCIFTGSSN--SSIGGVPTPAFGPTA  284
            PS+G+C+F GS+   + IG +  P+   T+
Sbjct  445  PSHGTCLFPGSTGKINGIGNITAPSMNSTS  474



>ref|XP_007045239.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY01071.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=498

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP  G +SEPDAT+ENA  YN+NLIR V N+TG P   ++ +  YIYEL+NED
Sbjct  259  IVVTETGWPSKGDSSEPDATLENANTYNSNLIRHVLNNTGTPKHPRIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  LRPGSVSEKNWGLFDANGIPVYILHLTGAGT-VLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS +  G PCY PD + +H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  378  WACGP-GKVECSPLLQGHPCYEPDNVVSHSTYAFNAYFQQMAKSPGTCDFKGVATITTTD  436

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  437  PSHGSCIFPGS  447



>ref|XP_006378440.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56237.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=481

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  242  IFVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIVVSTYIYELYNED  301

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  302  SRPGPVSEKNWGLFDANGMPVYTLHLTGAGT-LLANDTTNQTFCVAKEGADPKMLQAALD  360

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  361  WACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGVATITTSD  419

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  420  PSHGSCIFPGSA  431



>ref|XP_004288596.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 140/210 (67%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  +IYEL+NED
Sbjct  268  VVVTESGWPSKGDSNEPDATLENANTYNSNLIRHVLNKTGTPKRPGLAVSTFIYELYNED  327

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG+ +Y + L GS A  +AN+++   FC A+ G     LQ  +D
Sbjct  328  TKPGPVSEKNWGLFDANGTPIYILRLTGSGA-VLANDTTNQTFCTAKDGTDTKMLQAALD  386

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD + +HA+YA++ YY ++     +CDF+G A  TT D
Sbjct  387  WACGP-GKVDCSPLLQGEPCYEPDNVISHATYAFDTYYHQMGKTSASCDFNGVAAITTTD  445

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS+GSC+F GS   N ++  +  P+   T+
Sbjct  446  PSHGSCVFPGSLGKNGTLVNITAPSLNSTS  475



>ref|XP_002314794.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|EEF00965.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=498

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IFVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIVVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  SRPGPVSEKNWGLFDANGMPVYTLHLTGAGT-LLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGVATITTSD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  437  PSHGSCIFPGSA  448



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 135/191 (71%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VV E+GWP  G +SE DAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  260  LVVLESGWPSKGDSSESDATIDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA +  LQ  +D
Sbjct  320  LRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VLANDTTNQTFCVAKDGADKKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD + +H++YA+N YYQ++    GTCDF G AT TT D
Sbjct  379  WACGP-GKVDCSALLQGQPCYEPDNVISHSTYAFNAYYQQMAKAPGTCDFKGVATITTTD  437

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  438  PSHGSCIFPGS  448



>ref|XP_002876767.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53026.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 141/210 (67%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+F+ NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  319  TRPGPISEKNWGLFYTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGN-NTTALAPSA  465



>ref|NP_565269.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
 sp|Q9ZU91.2|E133_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 3; AltName: Full=(1->3)-beta-glucan 
endohydrolase 3; Short=(1->3)-beta-glucanase 
3; AltName: Full=Beta-1,3-endoglucanase 3; Short=Beta-1,3-glucanase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12708.2| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM62724.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC05475.1| glucan endo-1,3-beta-glucosidase 3 [Arabidopsis thaliana]
Length=501

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 140/210 (67%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F+ NG+ VY + L G+ A  +AN+++   FCIA+       LQ  +D
Sbjct  319  TRPGPVSEKNWGLFYTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDRKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGN-NTSALAPSA  465



>gb|KHN00662.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=483

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 140/207 (68%), Gaps = 2/207 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N++G P +  + +  YIYEL+NED
Sbjct  246  ILVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNED  305

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE +WG+F+ NG+ VY ++L  S     AN+++   FC+A+  A    LQ  +D
Sbjct  306  LRSGPVSENNWGLFYANGAPVYTLHLTNSGT-VFANDTTNQTFCVAKSNADTKMLQAALD  364

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY P+++ +HA+YA N YYQ++    GTCDF G A+ TT +
Sbjct  365  WACGP-GKVDCSPLLQGQPCYEPNSVASHATYAINAYYQQMAKSAGTCDFKGVASVTTTN  423

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPT  287
            PS+GSCIF GS   ++  V   A  P+
Sbjct  424  PSHGSCIFPGSGGKNVTSVNGTALAPS  450



>ref|XP_006858991.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
 gb|ERN20458.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
Length=506

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 143/194 (74%), Gaps = 8/194 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +++TE+GWP  G +SE DAT  NA  YN NLI  V    G P   +  +  ++YE+F+ED
Sbjct  262  IILTESGWPHGGDSSELDATPGNAIIYNTNLINHVRGGGGTPGRPESEVSVFVYEMFDED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSS-----AGVFCIAQPGASENKL  563
             RPGP+SE+S G+ +PN +A+YP+ LG  S G +A N S     +G++C+A PGA    L
Sbjct  322  LRPGPMSEKSLGVIYPNLTAIYPLQLG--SGGALAANPSSALGVSGLYCVATPGADALAL  379

Query  562  QKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtat  383
            + G+DWACGP G ANC+A+Q GQPCY+P+TL+NHASYAYNDYYQR  S GGTC+F+GTAT
Sbjct  380  KTGLDWACGP-GLANCTALQEGQPCYNPNTLENHASYAYNDYYQRSSSSGGTCNFNGTAT  438

Query  382  tttvDPSYGSCIFT  341
            TT++DPSYG+C+FT
Sbjct  439  TTSIDPSYGTCVFT  452



>ref|XP_006395869.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33155.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=483

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 139/210 (66%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G   E DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  242  IVVTESGWPSKGDAKEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  301

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  302  TRPGPVSEKNWGLFHTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  360

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  361  WACGP-GKVDCSALMQGEACYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTD  419

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  420  PSRGTCVFPGSAKSNQTLGN-NTTALAPSA  448



>ref|XP_007032975.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03901.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
Length=498

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 137/210 (65%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + I  YIYEL+NED
Sbjct  260  VIVTETGWPSKGDSNEPDATIENANTYNSNLIRHVLNKTGTPKRPGIAISTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  VY + L GS +  +AN+++   +C  + GA    LQ  +D
Sbjct  320  MKPGPISEKNWGLFDANGDPVYILRLTGSGS-LLANDTTNQTYCTVKEGADPKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD +  HA+YA++ YY R+      CDF+G A  TT D
Sbjct  379  WACGP-GKVDCSPLLQGKPCYEPDNVIAHATYAFDTYYHRMGKTSDACDFNGVADITTTD  437

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS+GSCIF GS   N ++  +  P+   T+
Sbjct  438  PSHGSCIFPGSLGRNGTMVNITAPSMNSTS  467



>ref|XP_010502143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=501

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 141/210 (67%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DATVENA  YN+NLI+ V N TG P      + AYIYEL+NED
Sbjct  259  IVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTAYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  319  SRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSALMQGESCYEPDDVVAHSTYAFNSYYQKMGKALGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGN-NTMALAPSA  465



>ref|XP_003518194.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=496

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 140/207 (68%), Gaps = 2/207 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N++G P +  + +  YIYEL+NED
Sbjct  259  ILVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE +WG+F+ NG+ VY ++L  S     AN+++   FC+A+  A    LQ  +D
Sbjct  319  LRSGPVSENNWGLFYANGAPVYTLHLTNSGT-VFANDTTNQTFCVAKSNADTKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY P+++ +HA+YA N YYQ++    GTCDF G A+ TT +
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPNSVASHATYAINAYYQQMAKSAGTCDFKGVASVTTTN  436

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPT  287
            PS+GSCIF GS   ++  V   A  P+
Sbjct  437  PSHGSCIFPGSGGKNVTSVNGTALAPS  463



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VV E+GWP  G +SE DAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  239  LVVLESGWPSKGDSSESDATIDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  298

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA +  LQ  +D
Sbjct  299  LRPGSVSEKNWGLFNANGVPVYTLHLTGAGT-VLANDTTNQTFCVAKDGADKKMLQAALD  357

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD + +H+ YA+N YYQ++    GTCDF G AT TT D
Sbjct  358  WACGP-GKVDCSALLQGQPCYEPDNVISHSMYAFNAYYQQMAKAPGTCDFKGVATITTTD  416

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  417  PSHGSCIFPGS  427



>ref|XP_006372566.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP50363.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=481

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G T+EPDAT++NA  YN+NLIR V N TG P+   + +  YIYEL+NED
Sbjct  245  VMVTESGWPSKGDTNEPDATLDNANTYNSNLIRHVLNKTGTPNHPGIAVSTYIYELYNED  304

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG  +Y ++L G+    +AN+++   +C A+ GA    LQ  +D
Sbjct  305  LKPGPVSEKNWGLFNANGEPIYILHLTGAGL-VLANDTTNQTYCTAKEGADPKMLQAALD  363

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  NCSAI  G+PCY PD +  HA+YA+N YY R+    GTCDF+G A  TT +
Sbjct  364  WACGP-GKVNCSAILQGEPCYEPDNVIAHATYAFNSYYSRMGKAPGTCDFNGVAAITTTN  422

Query  367  PSYGSCIFTGSSN--SSIGGVPTPAFGPTA  284
            PS+G+C+F GS+   +  G +  P+   T+
Sbjct  423  PSHGTCLFPGSTGKINGFGNITAPSMNSTS  452



>emb|CDP01635.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 132/193 (68%), Gaps = 2/193 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EPDAT+ENA  YN+NLIR V N TG P    + + AYIYEL+NED
Sbjct  259  VLVTESGWPSKGDSHEPDATIENANTYNSNLIRHVLNKTGTPKHPGIAVSAYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+F  NG  +Y + L GS +  +AN+++   +C A+  A    LQ  +D
Sbjct  319  TRPGPLSEKNWGLFDGNGVPIYILRLTGSGS-VLANDTTNQTYCAAKDSADSKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PDT+  HA+YA++ YYQ+       CDF+G A  TT +
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPDTVSAHATYAFDAYYQKNGKAPLACDFNGVAAITTTN  436

Query  367  PSYGSCIFTGSSN  329
            PS+GSC+F GSS+
Sbjct  437  PSHGSCLFLGSSD  449



>ref|XP_006395867.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33153.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=516

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 139/210 (66%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G   E DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  275  IVVTESGWPSKGDAKEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  334

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  335  TRPGPVSEKNWGLFHTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  393

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  394  WACGP-GKVDCSALMQGEACYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTD  452

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  453  PSRGTCVFPGSAKSNQTLGN-NTTALAPSA  481



>ref|XP_007141916.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
 gb|ESW13910.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
Length=498

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDATV+NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  259  VVVTESGWPSKGGSNEPDATVDNANTYNSNLIKHVFNKTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG+ VY + L  S A  +AN++S   FCIA+ GA    LQ  +D
Sbjct  319  TKPGPISEKNWGLFDSNGAPVYILRLTESGA-LLANDTSNQTFCIAKDGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS +  GQPCY PD +  HA+YA++ YY ++      CDF+G AT +T D
Sbjct  378  WACGP-GKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNGVATISTSD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC+F GS   N ++G    P+   T
Sbjct  437  PSHGSCLFPGSLGKNGTLGNFTAPSMNST  465



>ref|XP_011023912.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Populus 
euphratica]
Length=498

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT+ENA  YN+NLIR V N+TG P   K+ +  YIYEL+NED
Sbjct  259  IFVTESGWPSKGDSSEPDATLENANTYNSNLIRHVLNNTGTPKHPKIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG +SE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  LRPGALSEKNWGLFDADGMPVYTLHLTGAGT-VLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSYLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGVATITTTD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GS+
Sbjct  437  PSHGSCIFPGSA  448



>ref|XP_003519328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN41067.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDATV+NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  260  VVVTESGWPSKGGSNEPDATVDNANTYNSNLIKHVFNKTGTPKHPGIAVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG+ +Y ++L  S A  +AN++S   FCIA+ GA    LQ  +D
Sbjct  320  MKPGPLSEKNWGLFDANGTPIYILHLTESGA-VLANDTSNNTFCIAKDGADPKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS +  GQPCY PD +  HA+YA++ YY ++      CDF+G AT +T D
Sbjct  379  WACGP-GKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNGVATISTSD  437

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC+F GS   N ++G    P+   T
Sbjct  438  PSHGSCLFPGSVGKNGTLGNFTAPSMNST  466



>gb|AAK85402.2| beta-1,3-glucanase [Camellia sinensis]
Length=495

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G +SEPDA ++NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  258  VMVTESGWPSKGDSSEPDANLDNANTYNSNLIKHVLNKTGTPKHPGISVSTYIYELYNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  +Y ++L GS +  +AN+++   +C A+ GA    LQ  +D
Sbjct  318  MKPGPLSEKNWGLFDANGVPIYILHLTGSGS-VLANDTANQTYCTAKDGADAKMLQAALD  376

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  NCSA+  GQPCY PDT+  HA+YA++ YYQ++    GTCDF+G AT TT +
Sbjct  377  WACGP-GKVNCSALLQGQPCYEPDTVAAHATYAFDTYYQQMGKASGTCDFNGVATITTTN  435

Query  367  PSYGSCIFTGS  335
            P++GSC+F GS
Sbjct  436  PTHGSCVFPGS  446



>ref|XP_010513892.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Camelina 
sativa]
Length=497

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 140/210 (67%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  319  SRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSALMQGESCYEPDDVVAHSTYAFNSYYQKMGKALGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGN-NTMALAPSA  465



>ref|XP_006575486.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=505

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDATV+NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  267  VVVTESGWPSKGGSNEPDATVDNANTYNSNLIKHVFNKTGTPKHPGIAVSTYIYELYNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG+ +Y ++L  S A  +AN++S   FCIA+ GA    LQ  +D
Sbjct  327  MKPGPLSEKNWGLFDANGTPIYILHLTESGA-VLANDTSNNTFCIAKDGADPKMLQAALD  385

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS +  GQPCY PD +  HA+YA++ YY ++      CDF+G AT +T D
Sbjct  386  WACGP-GKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNGVATISTSD  444

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC+F GS   N ++G    P+   T
Sbjct  445  PSHGSCLFPGSVGKNGTLGNFTAPSMNST  473



>ref|XP_011021801.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Populus euphratica]
Length=465

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P   ++ +  YIYEL+NED
Sbjct  226  IFVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPRIVVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  286  LRPGPVSEKNWGLFDASGMPVYTLHLTGAGT-LLANDTTNQTFCVAKEGADPKMLQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  345  WACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGAATITTSD  403

Query  367  PSYGSCIFTGSS  332
            PS+ SCIF GS+
Sbjct  404  PSHDSCIFPGSA  415



>gb|EMT28432.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=695

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 135/191 (71%), Gaps = 1/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  +EP A V+NA AYN NLIR V N++G PS+    +  Y++ELFNED
Sbjct  261  VIVTASGWPWRGGRNEPAADVDNALAYNTNLIRHVLNNSGTPSQPDNQVSTYLFELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +R GPVSE++WGI F N SAVY +     +     + +  G+FC+A   A+ + L++ +D
Sbjct  321  RRAGPVSEQNWGIMFTNASAVYSLTFEDVATNNTDSPALRGMFCVANSSATHSALKQSLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            W CGP G+ANCSAIQPGQ CY  D +   ASYA+NDYY R Q+ GGTC+F+GTAT ++ D
Sbjct  381  WVCGP-GSANCSAIQPGQQCYKADDIVAVASYAFNDYYHRTQASGGTCNFNGTATISSTD  439

Query  367  PSYGSCIFTGS  335
            PS+GSC+F GS
Sbjct  440  PSHGSCVFAGS  450



>ref|XP_004297451.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 134/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G ++EPDAT++NA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  265  IVVTESGWPSKGDSAEPDATLDNANTYNSNLIKHVLNNTGTPKHPGIAVSTYIYELYNED  324

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  325  LRPGSVSEKNWGLFDANGLPVYTLHLTGAGT-VLANDTTNQTFCVAKDGADRKMLQAALD  383

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G AT TT D
Sbjct  384  WACGP-GKVDCSPMLQGQPCYEPDNVVTHATYAFNAYYQKMAKSPGTCDFKGVATITTTD  442

Query  367  PSYGSCIFTGSS  332
            PS+GSCI  GS+
Sbjct  443  PSHGSCIVPGSA  454



>ref|XP_010914932.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Elaeis guineensis]
Length=527

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 135/215 (63%), Gaps = 5/215 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  GS  E  AT +NA  YN NLIR V NDTG P++    I  YI+ LFNE+
Sbjct  289  VMVTESGWPNKGSAKETAATTDNAQTYNTNLIRHVINDTGTPAKPGEEIDVYIFSLFNEN  348

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIAN----NSSAGVFCIAQPGASENKLQ  560
            ++PG  SER+WG+F+P+ +++Y ++L G     +       SS G +C+A   ASE  LQ
Sbjct  349  RKPGLESERNWGLFYPDRTSIYSLDLTGRGNVDVITGGNMTSSNGTWCVASTNASELDLQ  408

Query  559  KGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatt  380
              +DWACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    C F GT   
Sbjct  409  NALDWACGP-GNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACSFGGTGVR  467

Query  379  ttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVG  275
            TT DPSY +CI+  S   S G   T A  P+   G
Sbjct  468  TTKDPSYDNCIYATSRKLSRGNSTTSAVVPSRAQG  502



>ref|XP_010424935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Camelina sativa]
Length=501

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 140/210 (67%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  319  SRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSALMQGESCYEPDDVVAHSTYAFNSYYQKMGKALGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGN-NTMALAPSA  465



>ref|XP_002531922.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30466.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=508

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 143/211 (68%), Gaps = 5/211 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDAT++NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  270  VVVTESGWPSKGDSNEPDATIDNANTYNSNLIKHVLNKTGTPKHPGIAVSTYIYELYNED  329

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG  VY ++L GS    +AN+++   FC A+ GA    LQ  +D
Sbjct  330  TKPGPVSEKNWGLFNANGEPVYILHLTGSGL-VLANDTTNQTFCTAKEGADPKMLQAALD  388

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  HA+YA++ YY ++    GTCDF+G A+ TT +
Sbjct  389  WACGP-GKVDCSALLQGESCYEPDNVIAHATYAFDSYYHQMGKAPGTCDFNGVASITTTN  447

Query  367  PSYGSCIFTGSS---NSSIGGVPTPAFGPTA  284
            PS+G+CIF+GSS   N S+  +  P+   T+
Sbjct  448  PSHGTCIFSGSSGKINGSLVNITAPSMNSTS  478



>ref|XP_006293165.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
 gb|EOA26063.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
Length=500

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 140/210 (67%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  319  SRPGPVSEKNWGLFNTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGN-NTTALAPSA  465



>ref|XP_011021800.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Populus euphratica]
Length=498

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P   ++ +  YIYEL+NED
Sbjct  259  IFVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPRIVVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  LRPGPVSEKNWGLFDASGMPVYTLHLTGAGT-LLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGAATITTSD  436

Query  367  PSYGSCIFTGSS  332
            PS+ SCIF GS+
Sbjct  437  PSHDSCIFPGSA  448



>ref|XP_006430586.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
 gb|ESR43826.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
Length=497

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  259  VMVTESGWPSKGDSNEPDATLENANTYNSNLIRHVLNQTGTPKHPGIGVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  VY ++L GS +  +AN+++   +C A+ GA    LQ  +D
Sbjct  319  NKPGPLSEKNWGLFDANGDPVYILHLTGSGS-VLANDTTNQTYCTARDGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA++ YY +++     C+F+G A  TT D
Sbjct  378  WACGP-GKVDCSGLLQGQPCYEPDNVIAHATYAFDTYYHQMRKDPAACNFNGVAAITTSD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSCIF GS   N ++  +  P+   T
Sbjct  437  PSHGSCIFPGSLGKNGTMANITAPSLNST  465



>ref|XP_007151812.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
 gb|ESW23806.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
Length=495

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 143/202 (71%), Gaps = 7/202 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDAT++NA  YN+NLIR V N++G P +  + I +YIYEL+NED
Sbjct  258  ILVTESGWPSKGDSSEPDATIDNASTYNSNLIRHVLNNSGTPKQPGIAISSYIYELYNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GPVSE +WG+F+ NG+ VY ++L  ++AG + AN+++   FC+A+  A    LQ  +
Sbjct  318  LRTGPVSENNWGLFYANGAPVYTLHL--TNAGTVFANDTTNQTFCVAKSNADTKLLQAAL  375

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS++  GQPCY P+ +  HA+YA N YYQ++    GTCDF G A+ TT 
Sbjct  376  DWACGP-GKVDCSSLLQGQPCYDPNNVAAHATYAINAYYQQMAKSAGTCDFKGVASVTTT  434

Query  370  DPSYGSCIFTGS---SNSSIGG  314
            +PS+GSCIF GS   + SSI G
Sbjct  435  NPSHGSCIFPGSYGKNGSSING  456



>ref|XP_009390355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 132/192 (69%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGS-TSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            VVV E+GWP  G  T+EPDAT +NA  YN+NLIR V N+TG P    +P+  YIYEL++E
Sbjct  260  VVVLESGWPHKGDPTTEPDATADNAATYNSNLIRHVLNNTGTPKHPGVPVPTYIYELYDE  319

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN+++   FC+A+ GA    LQ G+
Sbjct  320  DLRPGATSEKFWGLFDVNGVPAYTLHLTGSGT-LLANDTTNQTFCVAREGADTKMLQAGL  378

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CSA+  G+PCY PDT+++HASYA+N+YY  +    GTC F G A  TT 
Sbjct  379  DWACGP-GKVDCSALMQGKPCYDPDTVESHASYAFNEYYHGMGMASGTCYFSGVAAITTT  437

Query  370  DPSYGSCIFTGS  335
            DPS+ SC+F+GS
Sbjct  438  DPSHESCLFSGS  449



>ref|XP_006482110.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Citrus sinensis]
 gb|KDO50803.1| hypothetical protein CISIN_1g010931mg [Citrus sinensis]
Length=497

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  259  VMVTESGWPSKGDSNEPDATLENANTYNSNLIRHVLNQTGTPKHPGIGVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  VY ++L GS +  +AN+++   +C A+ GA    LQ  +D
Sbjct  319  NKPGPLSEKNWGLFDANGDPVYILHLTGSGS-VLANDTTNQTYCTARDGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA++ YY +++     C+F+G A  TT D
Sbjct  378  WACGP-GKVDCSGLLQGQPCYQPDNVIAHATYAFDTYYHQMRKDPAACNFNGVAAITTSD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSCIF GS   N ++  +  P+   T
Sbjct  437  PSHGSCIFPGSLGKNGTMANITAPSLNST  465



>ref|XP_011021799.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Populus euphratica]
Length=499

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P   ++ +  YIYEL+NED
Sbjct  260  IFVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPRIVVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  320  LRPGPVSEKNWGLFDASGMPVYTLHLTGAGT-LLANDTTNQTFCVAKEGADPKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++    GTCDF G AT TT D
Sbjct  379  WACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAFNAYFQKMAKSPGTCDFKGAATITTSD  437

Query  367  PSYGSCIFTGSS  332
            PS+ SCIF GS+
Sbjct  438  PSHDSCIFPGSA  449



>gb|KHG17836.1| hypothetical protein F383_07126 [Gossypium arboreum]
Length=519

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 137/210 (65%), Gaps = 4/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  248  VIVTETGWPSKGDSNEPDATMENANTYNSNLIRHVMNKTGTPKRPGIAVSTYIYELYNED  307

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  +Y + L   S   +AN+++   +C A+ GA    LQ  +D
Sbjct  308  LKPGPISEKNWGLFDANGDPIYILRL-TDSGSLLANDTTNQTYCTAKEGADPKMLQAALD  366

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS++  G+PCY PD +  HA+YA++ YY R+      CDF+G A  TT D
Sbjct  367  WACGP-GKVDCSSLLQGKPCYEPDNVIAHATYAFDTYYHRMGKTSDACDFNGVADITTTD  425

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS+GSCIF GS   N ++  +  P+   T+
Sbjct  426  PSHGSCIFPGSLGRNGTMVNITAPSMNSTS  455



>gb|EYU41109.1| hypothetical protein MIMGU_mgv1a005128mg [Erythranthe guttata]
Length=496

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 135/191 (71%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT +NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IQVTESGWPSKGDSSEPDATSDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG  VY ++L GS    +AN+++   +C+A+ GA    LQ  +D
Sbjct  319  LRPGPVSEKNWGLFDSNGVPVYTLHLTGSGT-VLANDTTNQTYCVAREGADRKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS++  GQ CY PDT+ +HASYA++ YY+R+    GTCDF+G AT TT D
Sbjct  378  WACGP-GKVDCSSLLQGQACYEPDTVVSHASYAFDAYYRRMGMADGTCDFNGVATITTTD  436

Query  367  PSYGSCIFTGS  335
             S+GSCIF GS
Sbjct  437  QSHGSCIFPGS  447



>dbj|BAJ89950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 132/192 (69%), Gaps = 1/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW  + +EP A V+NA AYN NLIR V N++G PS+    +  Y++ELFNED
Sbjct  267  VMVTASGWPWHSARNEPAADVDNALAYNTNLIRHVLNNSGTPSQPNNQVSTYLFELFNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R G VS  SWGI F N SAVY +     +     + +  G+FC+A   A  + L++ +D
Sbjct  327  LRSGSVSGESWGIMFSNASAVYSLAFEDVATTSTDSPALHGMFCVANSSAPHSALKQSLD  386

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPGQPCY PD +   ASYA+NDYY R Q+ GGTC+F+ TAT ++ D
Sbjct  387  WACGP-GSANCSAIQPGQPCYKPDDIVAVASYAFNDYYHRTQASGGTCNFNSTATISSTD  445

Query  367  PSYGSCIFTGSS  332
            PS+GSC F GS+
Sbjct  446  PSHGSCKFAGST  457



>ref|XP_004140301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 ref|XP_004155734.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cucumis sativus]
 gb|KGN51058.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=503

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VV+ETGWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + I  YIYEL+NED
Sbjct  266  IVVSETGWPSKGGSNEPDATLENANTYNSNLIRHVLNKTGTPKHPGIAISTYIYELYNED  325

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  VY + L GS    +AN+++   +C A+ G     LQ  +D
Sbjct  326  LKPGPISEKNWGLFDANGKPVYILRLTGSGL-VLANDTTNQTYCAAKEGVDPRMLQAALD  384

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  GQPCY PD +  HA+YA+N YY ++    G+CDF+G A  TT +
Sbjct  385  WACGP-GRVDCSALLQGQPCYEPDNVMAHATYAFNTYYLQMGKGSGSCDFNGVAAVTTTN  443

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC F+GS   N ++  +  P+   T
Sbjct  444  PSHGSCSFSGSVGRNGTMANITAPSMNST  472



>gb|KJB15378.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=465

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 138/192 (72%), Gaps = 4/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDATV+NA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  226  IVVTESGWPSKGDSSEPDATVDNANTYNSNLIKHVINNTGTPKHPGITVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             RP P+SE++WG+F  NG+ VY ++L  ++AG + AN+++   FC+A+ GA    LQ  +
Sbjct  286  LRPSPLSEKNWGLFDANGTPVYILHL--TAAGTVFANDTTNQTFCVAKDGADPKMLQAAL  343

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD + +H++YA+N Y+Q++    GTCDF G AT +T 
Sbjct  344  DWACGP-GKVDCSPLLQGQPCYEPDNVVSHSTYAFNAYFQQMGKSTGTCDFKGVATISTT  402

Query  370  DPSYGSCIFTGS  335
            DPS+GSCIF GS
Sbjct  403  DPSHGSCIFPGS  414



>ref|XP_009406531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=524

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 111/163 (68%), Gaps = 1/163 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G  +E DA+++NA  YN+NLI  V N +G PS+  + +  Y+ ELFNED
Sbjct  289  VIVTESGWPSLGGANESDASIDNALTYNSNLIHHVLNGSGTPSQPTISVSTYVLELFNED  348

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WGI+ PNG+A+Y +  G  +     +    GVFC+A      N L+KG+D
Sbjct  349  LRPGPVSEKNWGIYVPNGTALYSLTFGRIAESNADSTGLVGVFCVANSSVDSNALKKGLD  408

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQS  419
            WACGP G+ANC+AIQPGQ CY  D L    SYA+NDYY R Q+
Sbjct  409  WACGP-GSANCTAIQPGQACYEADNLVALTSYAFNDYYHRTQA  450



>ref|XP_009406534.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406535.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=496

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 111/163 (68%), Gaps = 1/163 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G  +E DA+++NA  YN+NLI  V N +G PS+  + +  Y+ ELFNED
Sbjct  261  VIVTESGWPSLGGANESDASIDNALTYNSNLIHHVLNGSGTPSQPTISVSTYVLELFNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WGI+ PNG+A+Y +  G  +     +    GVFC+A      N L+KG+D
Sbjct  321  LRPGPVSEKNWGIYVPNGTALYSLTFGRIAESNADSTGLVGVFCVANSSVDSNALKKGLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQS  419
            WACGP G+ANC+AIQPGQ CY  D L    SYA+NDYY R Q+
Sbjct  381  WACGP-GSANCTAIQPGQACYEADNLVALTSYAFNDYYHRTQA  422



>ref|XP_002305879.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE86390.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=491

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 141/211 (67%), Gaps = 5/211 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G ++EPDAT++NA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  253  VMVTETGWPSKGDSNEPDATLDNANTYNSNLIRHVLNKTGTPKHPGIAVSTYIYELYNED  312

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG  VY ++L GS    +AN+++   +C A+ GA    LQ  +D
Sbjct  313  LKPGPVSEKNWGLFNANGEPVYILHLTGSGL-VLANDTTNQTYCTAKQGADPKMLQAALD  371

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+PCY PD +  HA+YA+N YY ++    GTCDF+G A  TT +
Sbjct  372  WACGP-GKVDCSAMLQGEPCYQPDNVIAHATYAFNSYYNQMGKAPGTCDFNGVAAITTTN  430

Query  367  PSYGSCIF---TGSSNSSIGGVPTPAFGPTA  284
            PS+G+C+F   TG  N ++  +  P+   T+
Sbjct  431  PSHGTCVFPGSTGRMNGTMVNITAPSMNSTS  461



>ref|XP_003538392.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Glycine max]
Length=498

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 143/224 (64%), Gaps = 4/224 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDATVENA  YN+NLI+ V N TG P    + +  +IYEL+NED
Sbjct  259  VVVTETGWPSKGDSNEPDATVENANTYNSNLIKHVLNITGTPKHPGIGVSTFIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG  VY ++L   S G +AN+++   +C+A+ GA    LQ GID
Sbjct  319  AKAGPLSEKNWGLFDANGKPVYVLHL-TESGGVLANDTTNQTYCVAKDGADPKMLQAGID  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA++ YY ++     +CDF+  AT +T +
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPDNVVAHANYAFDTYYHQMGKSTQSCDFNDMATISTTN  436

Query  367  PSYGSCIFTGSS--NSSIGGVPTPAFGPTAPVGKGSMARAPDIG  242
            PS+GSC+F GS   N S   V   +   T  V   S   + ++G
Sbjct  437  PSHGSCVFPGSLGINGSFPNVTLSSLNSTNSVSSASNLHSGELG  480



>gb|KJB30775.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=465

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 132/192 (69%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDA V+NA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSSEPDAIVDNANTYNSNLIKHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG  SE++WG+F  NG  VY ++L G+     AN+++   FCIA+ GA    LQ  +D
Sbjct  319  LRPGSDSEKNWGLFDANGIPVYTLHLTGADT-VFANDTTNKTFCIAKRGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G PCY PD + +H++YA+N YYQR+    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSPLLLGHPCYEPDNVASHSTYAFNAYYQRMAKSPGTCDFKGVATITTSD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GSS
Sbjct  437  PSHGSCIFPGSS  448



>ref|XP_006599425.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Glycine max]
Length=446

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 140/207 (68%), Gaps = 2/207 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N++G P +  + +  YIYEL+NED
Sbjct  209  ILVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNED  268

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GPVSE +WG+F+ +G+ VY ++L  S     AN+++   FC+A+  A    LQ  +D
Sbjct  269  LKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VFANDTTNQTFCVAKSNADSKMLQAALD  327

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQ CY P+++ +HA+YA N YYQ++    GTCDF G A+ TT +
Sbjct  328  WACGP-GKVDCSPLLQGQSCYEPNSVASHATYAINSYYQQMAKSAGTCDFKGVASITTTN  386

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPT  287
            PS+GSCIF+GS   ++  V   A  P+
Sbjct  387  PSHGSCIFSGSGGKNVTSVNGTALAPS  413



>gb|KHN17951.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 143/224 (64%), Gaps = 4/224 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDATVENA  YN+NLI+ V N TG P    + +  +IYEL+NED
Sbjct  259  VVVTETGWPSKGDSNEPDATVENANTYNSNLIKHVLNITGTPKHPGIGVSTFIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG  VY ++L   S G +AN+++   +C+A+ GA    LQ GID
Sbjct  319  AKAGPLSEKNWGLFDANGKPVYVLHL-TESGGVLANDTTNQTYCVAKDGADPKMLQAGID  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA++ YY ++     +CDF+  AT +T +
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPDNVVAHANYAFDTYYHQMGKSTQSCDFNDMATISTTN  436

Query  367  PSYGSCIFTGSS--NSSIGGVPTPAFGPTAPVGKGSMARAPDIG  242
            PS+GSC+F GS   N S   V   +   T  V   S   + ++G
Sbjct  437  PSHGSCVFPGSLGINGSFPNVTLSSLNSTNSVSSASNLHSGELG  480



>gb|KJB15376.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=498

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 138/192 (72%), Gaps = 4/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDATV+NA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSSEPDATVDNANTYNSNLIKHVINNTGTPKHPGITVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             RP P+SE++WG+F  NG+ VY ++L  ++AG + AN+++   FC+A+ GA    LQ  +
Sbjct  319  LRPSPLSEKNWGLFDANGTPVYILHL--TAAGTVFANDTTNQTFCVAKDGADPKMLQAAL  376

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD + +H++YA+N Y+Q++    GTCDF G AT +T 
Sbjct  377  DWACGP-GKVDCSPLLQGQPCYEPDNVVSHSTYAFNAYFQQMGKSTGTCDFKGVATISTT  435

Query  370  DPSYGSCIFTGS  335
            DPS+GSCIF GS
Sbjct  436  DPSHGSCIFPGS  447



>ref|XP_010066584.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Eucalyptus 
grandis]
 gb|KCW64517.1| hypothetical protein EUGRSUZ_G02118 [Eucalyptus grandis]
Length=499

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 133/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SE DAT+ENA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  260  IVVTESGWPSKGDSSEADATLENANTYNSNLIKHVLNNTGTPKHPGVAVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            +RPG VSE++WG+F  NG  +Y ++L G+    +AN+++   FC+ + GA +  LQ  +D
Sbjct  320  QRPGSVSEKNWGLFDANGVPIYILHLTGAGT-VLANDTTNQTFCVGKDGADKKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQ CY PD +  HA+YA+N YYQ++    GTCDF G AT TT +
Sbjct  379  WACGP-GKVDCSLLLQGQACYEPDNVVAHATYAFNAYYQKMGKALGTCDFKGVATVTTTN  437

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  438  PSHGSCIFPGS  448



>ref|XP_006599427.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X4 
[Glycine max]
Length=424

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 138/205 (67%), Gaps = 2/205 (1%)
 Frame = -1

Query  901  VTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNEDKR  722
            VTE+GWP  G +SEPDATV+NA  YN+NLIR V N++G P +  + +  YIYEL+NED +
Sbjct  189  VTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNEDLK  248

Query  721  PGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGIDWA  542
             GPVSE +WG+F+ +G+ VY ++L  S     AN+++   FC+A+  A    LQ  +DWA
Sbjct  249  SGPVSENNWGLFYASGAQVYTLHLTNSGT-VFANDTTNQTFCVAKSNADSKMLQAALDWA  307

Query  541  CGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvDPS  362
            CGP G  +CS +  GQ CY P+++ +HA+YA N YYQ++    GTCDF G A+ TT +PS
Sbjct  308  CGP-GKVDCSPLLQGQSCYEPNSVASHATYAINSYYQQMAKSAGTCDFKGVASITTTNPS  366

Query  361  YGSCIFTGSSNSSIGGVPTPAFGPT  287
            +GSCIF+GS   ++  V   A  P+
Sbjct  367  HGSCIFSGSGGKNVTSVNGTALAPS  391



>gb|KHN32747.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=463

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 140/207 (68%), Gaps = 2/207 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N++G P +  + +  YIYEL+NED
Sbjct  226  ILVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GPVSE +WG+F+ +G+ VY ++L  S     AN+++   FC+A+  A    LQ  +D
Sbjct  286  LKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VFANDTTNQTFCVAKSNADSKMLQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQ CY P+++ +HA+YA N YYQ++    GTCDF G A+ TT +
Sbjct  345  WACGP-GKVDCSPLLQGQSCYEPNSVASHATYAINSYYQQMAKSAGTCDFKGVASITTTN  403

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPT  287
            PS+GSCIF+GS   ++  V   A  P+
Sbjct  404  PSHGSCIFSGSGGKNVTSVNGTALAPS  430



>gb|KJB30776.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=497

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 132/192 (69%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDA V+NA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSSEPDAIVDNANTYNSNLIKHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG  SE++WG+F  NG  VY ++L G+     AN+++   FCIA+ GA    LQ  +D
Sbjct  319  LRPGSDSEKNWGLFDANGIPVYTLHLTGADT-VFANDTTNKTFCIAKRGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G PCY PD + +H++YA+N YYQR+    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSPLLLGHPCYEPDNVASHSTYAFNAYYQRMAKSPGTCDFKGVATITTSD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSCIF GSS
Sbjct  437  PSHGSCIFPGSS  448



>ref|XP_006580439.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=494

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N+TG P    + +  +IYEL+NED
Sbjct  258  IMVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNTGTPKHPGIAVSTFIYELYNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WG+F+ NG  VY ++L G+     AN+++   FC+ +  A    LQ  +D
Sbjct  318  LRSGPVSEKNWGLFYANGEPVYTLHLTGAGI-LFANDTTNQTFCVTKSNADPKMLQAALD  376

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N YYQ++    G+CDF G AT TT D
Sbjct  377  WACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYAFNAYYQKMDKSPGSCDFKGVATVTTTD  435

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  436  PSHGSCIFPGS  446



>ref|XP_007160409.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32403.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=498

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 134/192 (70%), Gaps = 4/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  261  IMVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GP SE++WG+F+ NG  VY ++L G  AG I AN+++   FC+A+  A    LQ  +
Sbjct  321  LRSGPFSEKNWGLFYANGEPVYTLHLTG--AGNIFANDTTNQTFCVAKSNADPKMLQAAL  378

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQ CY PD + +H++YA+N YYQ++    G+CDF G A+ TT 
Sbjct  379  DWACGP-GKVDCSPLLQGQTCYEPDNVVSHSTYAFNAYYQKMDKSPGSCDFKGVASITTT  437

Query  370  DPSYGSCIFTGS  335
            DPS+GSCIF GS
Sbjct  438  DPSHGSCIFPGS  449



>ref|XP_010271297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Nelumbo nucifera]
Length=495

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  +EPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDKNEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG +SE++WG+F  NG  +Y ++L  S    +AN+++   +C+A+ GA E  LQ  +D
Sbjct  319  MRPGSLSEKNWGLFDANGVPIYILHLTDSGM-VLANDTTNQTYCVARDGADEKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PDT+  HA+YA+N YY ++    GTC F+G A+ TT D
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPDTVNAHATYAFNTYYHQMGMASGTCYFNGVASVTTSD  436

Query  367  PSYGSCIFTGS  335
            PS+GSC F GS
Sbjct  437  PSHGSCKFHGS  447



>ref|XP_003548935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=496

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 140/207 (68%), Gaps = 2/207 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDATV+NA  YN+NLIR V N++G P +  + +  YIYEL+NED
Sbjct  259  ILVTESGWPSKGDSSEPDATVDNANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GPVSE +WG+F+ +G+ VY ++L  S     AN+++   FC+A+  A    LQ  +D
Sbjct  319  LKSGPVSENNWGLFYASGAQVYTLHLTNSGT-VFANDTTNQTFCVAKSNADSKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQ CY P+++ +HA+YA N YYQ++    GTCDF G A+ TT +
Sbjct  378  WACGP-GKVDCSPLLQGQSCYEPNSVASHATYAINSYYQQMAKSAGTCDFKGVASITTTN  436

Query  367  PSYGSCIFTGSSNSSIGGVPTPAFGPT  287
            PS+GSCIF+GS   ++  V   A  P+
Sbjct  437  PSHGSCIFSGSGGKNVTSVNGTALAPS  463



>ref|XP_006584863.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Glycine max]
Length=462

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 142/223 (64%), Gaps = 4/223 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SE DATV+NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  226  IMVTESGWPSKGDSSESDATVDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GPVSE++WG+F+ NG  VY ++L G  AG I AN+++   FC+ +  A    LQ  +
Sbjct  286  LRSGPVSEKNWGLFYANGEPVYTLHLTG--AGIIFANDTTNQTFCVTKSNADPKMLQAAL  343

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  H++YA+N YYQ++    G+CDF G AT TT 
Sbjct  344  DWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYAFNAYYQKMDKSPGSCDFKGVATVTTT  402

Query  370  DPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMARAPDIG  242
            DPS+GSCIF GS           +  P+     G +++  D G
Sbjct  403  DPSHGSCIFPGSHGRKGTRTNGTSLAPSNSTSSGCLSQYHDNG  445



>ref|XP_003544983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN39465.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDATV+NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  260  VVVTESGWPSKGGSNEPDATVDNANTYNSNLIKHVFNKTGTPKHPGIDVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG+ +Y ++L  S A  +AN++S   FCIA+ GA    LQ  +D
Sbjct  320  MKSGPLSEKNWGLFDANGTPIYILHLTESGA-VLANDTSNNTFCIAKDGADPKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS +  GQPCY PD +  HA+YA++ YY ++      CDF+G AT +T D
Sbjct  379  WACGP-GKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNGVATISTSD  437

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSC+F GS   N ++G    P+   T
Sbjct  438  PSHGSCLFPGSVGKNGTLGNFTAPSMNST  466



>ref|XP_010924450.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Elaeis guineensis]
Length=496

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 132/212 (62%), Gaps = 5/212 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  GS  E  AT +NA  YN NLIR V NDTG P++    I  YI+ LFNE+
Sbjct  259  VMVTESGWPNKGSAKETAATPDNAQTYNTNLIRHVINDTGTPAKPGEEIDVYIFSLFNEN  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIAN----NSSAGVFCIAQPGASENKLQ  560
            ++PG  SER+WG+F+P+ +++Y ++L G     +       SS G +C+A   ASE  LQ
Sbjct  319  RKPGLESERNWGLFYPDQTSIYSLDLTGRGNVDVITGANITSSNGTWCVASSNASELDLQ  378

Query  559  KGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatt  380
              +DWACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    C F GT   
Sbjct  379  NALDWACGP-GNVDCSAIQPSQPCYQPDTLLSHASYAFNSYYQQNGATDVACSFGGTGVK  437

Query  379  ttvDPSYGSCIFTGSSNSSIGGVPTPAFGPTA  284
             T DPSY  C++  S   S G    PA   +A
Sbjct  438  ITKDPSYDKCVYATSGKLSSGNSTAPAVSSSA  469



>ref|NP_001060087.2| Os07g0577300 [Oryza sativa Japonica Group]
 dbj|BAH01358.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22001.2| Os07g0577300 [Oryza sativa Japonica Group]
Length=498

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 138/211 (65%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWP  G  +E  A V+NA AYN NLIR V N++G P +    +  +I+ELFNED
Sbjct  267  VMVTASGWPSHGGQNEKAANVDNALAYNTNLIRHVLNNSGTPGQPNNQVSTFIFELFNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + VY +     +     +    G FC+A   A  + L++ +D
Sbjct  327  LRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNTDSPVLRGTFCVANSSAPHSALKQSLD  386

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPGQPCY  D +   ASYA+NDYY R ++ GGTC+F+ TA  T+ D
Sbjct  387  WACGP-GSANCSAIQPGQPCYKSDDIVAVASYAFNDYYHRTRASGGTCNFNSTAMVTSTD  445

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  281
            PS+GSCIF GS  SN S GG    A GP +P
Sbjct  446  PSHGSCIFAGSTGSNGSNGGA---ASGPVSP  473



>ref|XP_006584862.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Glycine max]
Length=477

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 142/223 (64%), Gaps = 4/223 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SE DATV+NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  241  IMVTESGWPSKGDSSESDATVDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  300

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GPVSE++WG+F+ NG  VY ++L G  AG I AN+++   FC+ +  A    LQ  +
Sbjct  301  LRSGPVSEKNWGLFYANGEPVYTLHLTG--AGIIFANDTTNQTFCVTKSNADPKMLQAAL  358

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  H++YA+N YYQ++    G+CDF G AT TT 
Sbjct  359  DWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYAFNAYYQKMDKSPGSCDFKGVATVTTT  417

Query  370  DPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMARAPDIG  242
            DPS+GSCIF GS           +  P+     G +++  D G
Sbjct  418  DPSHGSCIFPGSHGRKGTRTNGTSLAPSNSTSSGCLSQYHDNG  460



>gb|EEE67465.1| hypothetical protein OsJ_24859 [Oryza sativa Japonica Group]
Length=555

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 138/211 (65%), Gaps = 6/211 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWP  G  +E  A V+NA AYN NLIR V N++G P +    +  +I+ELFNED
Sbjct  324  VMVTASGWPSHGGQNEKAANVDNALAYNTNLIRHVLNNSGTPGQPNNQVSTFIFELFNED  383

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + VY +     +     +    G FC+A   A  + L++ +D
Sbjct  384  LRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNTDSPVLRGTFCVANSSAPHSALKQSLD  443

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPGQPCY  D +   ASYA+NDYY R ++ GGTC+F+ TA  T+ D
Sbjct  444  WACGP-GSANCSAIQPGQPCYKSDDIVAVASYAFNDYYHRTRASGGTCNFNSTAMVTSTD  502

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTAP  281
            PS+GSCIF GS  SN S GG    A GP +P
Sbjct  503  PSHGSCIFAGSTGSNGSNGGA---ASGPVSP  530



>ref|XP_003532507.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=499

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SE DATV+NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  263  IMVTESGWPSKGDSSESDATVDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GPVSE++WG+F+ NG  VY ++L G  AG I AN+++   FC+ +  A    LQ  +
Sbjct  323  LRSGPVSEKNWGLFYANGEPVYTLHLTG--AGIIFANDTTNQTFCVTKSNADPKMLQAAL  380

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  H++YA+N YYQ++    G+CDF G AT TT 
Sbjct  381  DWACGP-GKVDCSPLLQGQPCYEPDNVVAHSTYAFNAYYQKMDKSPGSCDFKGVATVTTT  439

Query  370  DPSYGSCIFTGS  335
            DPS+GSCIF GS
Sbjct  440  DPSHGSCIFPGS  451



>ref|XP_003552878.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
Length=498

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 133/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDATVENA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  259  VVVTETGWPSKGDSNEPDATVENANTYNSNLIKHVLNITGTPKHPGIGVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG  VY ++L   S G +AN+++   +C+A+ GA    LQ GID
Sbjct  319  AKAGPLSEKNWGLFDANGKPVYVLHL-TESGGVLANDTTNQTYCVAKDGADPKMLQAGID  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA++ YY ++     +CDF+G AT +T +
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPDNVVAHANYAFDTYYHQMGKSPQSCDFNGMATISTTN  436

Query  367  PSYGSCIFTGS  335
            PS+GSC+F GS
Sbjct  437  PSHGSCVFPGS  447



>gb|KHN07542.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=488

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 133/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDATVENA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  249  VVVTETGWPSKGDSNEPDATVENANTYNSNLIKHVLNITGTPKHPGIGVSTYIYELYNED  308

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG  VY ++L   S G +AN+++   +C+A+ GA    LQ GID
Sbjct  309  AKAGPLSEKNWGLFDANGKPVYVLHL-TESGGVLANDTTNQTYCVAKDGADPKMLQAGID  367

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  HA+YA++ YY ++     +CDF+G AT +T +
Sbjct  368  WACGP-GKVDCSPLLQGQPCYEPDNVVAHANYAFDTYYHQMGKSPQSCDFNGMATISTTN  426

Query  367  PSYGSCIFTGS  335
            PS+GSC+F GS
Sbjct  427  PSHGSCVFPGS  437



>ref|XP_008366987.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Malus domestica]
Length=498

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G ++EPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGGSAEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG VSE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ GA +  LQ  +D
Sbjct  319  LRPGSVSEKNWGLFNADGVPVYTLHLTGAGT-VLANDTTNQTFCVAREGADKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY P+ +  HA+YA+N Y+Q +    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSPLLQGQPCYEPNNVLTHATYAFNAYFQLMAKSPGTCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS  335
            PS+G+CIF GS
Sbjct  437  PSHGTCIFPGS  447



>emb|CDY48807.1| BnaC02g34070D [Brassica napus]
Length=497

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 138/210 (66%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G   E DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDGQEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVATYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+F  NG+ VY + L G+ A  +AN+++   FC+A+    +  LQ  +D
Sbjct  319  TRPGPLSEKNWGLFHTNGTPVYTLRLAGAGA-ILANDTTNQTFCVAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+ CY PD +  H+SYA+N YYQ++    G+CDF G AT TT D
Sbjct  378  WACGP-GKVDCSDLMQGEACYEPDDVVAHSSYAFNAYYQKMGKASGSCDFKGVATVTTTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNRTLGH-NTTALAPSA  465



>ref|XP_010546762.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Tarenaya hassleriana]
Length=517

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 131/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EP AT++NA  YN+NLI+ V + TG P   +M    YIYELFNED
Sbjct  281  VLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNED  340

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N + VY +++ GS    +AN+++   +CIA  G     LQ  +D
Sbjct  341  LRAPPVSEANWGLFYGNSTPVYLLHVSGSGTF-LANDTTNQTYCIAMDGVDSKTLQAALD  399

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++NHASYA++ YYQ+ +   G+CDF G A  TT D
Sbjct  400  WACGP-GRANCSEIQPGESCYQPNNVKNHASYAFDSYYQKERKAPGSCDFKGVAMITTTD  458

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  459  PSHGSCIFLGS  469



>ref|XP_010681924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=438

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 4/205 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G +SEPDAT+ENA  YN+NLIRRV N+TG P    + +  YIYEL+NED
Sbjct  199  VVVTESGWPSKGDSSEPDATIENANTYNSNLIRRVLNNTGTPKHPGIAVSTYIYELYNED  258

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R G +SE++WG+F  NG  +Y ++L GS     AN+++   +C+A+  A    LQ  +D
Sbjct  259  LRSGLISEKNWGLFDANGVPIYILHLTGSGT-VFANDTTNQTYCVAKDSADPKMLQAALD  317

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD + +HA+YA++ YY R+    GTC F+G AT TT D
Sbjct  318  WACGP-GKVDCSPLLQGEPCYEPDNVVSHANYAFDTYYHRMAMAPGTCYFNGVATITTSD  376

Query  367  PSYGSCIFTGS--SNSSIGGVPTPA  299
            PS+GSC+F GS   N + G   T A
Sbjct  377  PSHGSCVFPGSGGRNETFGNSTTLA  401



>ref|XP_009382992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 130/192 (68%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGS-TSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            VVV E+GWP  G  T+EPDAT +NA  YN+NLIR V N TG P    + +  YIYEL++E
Sbjct  341  VVVMESGWPHKGDPTTEPDATTDNANTYNSNLIRHVINSTGTPKHPGVSVPTYIYELYDE  400

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN++S+  FC+A+ GA E  LQ GI
Sbjct  401  DLRPGVTSEKFWGLFDANGVPAYTLHLTGSGM-LLANDTSSQTFCVAKEGADEKLLQAGI  459

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  G+PCY PDT++ HASYA+N+YY  +    GTC F G A  TT 
Sbjct  460  DWACGP-GKVDCSLLTQGKPCYDPDTVEAHASYAFNEYYHGMGMAVGTCHFSGVAAITTT  518

Query  370  DPSYGSCIFTGS  335
            DPS+ SC+F+GS
Sbjct  519  DPSHDSCLFSGS  530



>emb|CDP00829.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 134/191 (70%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +++TE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  268  IIITESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIALSTYIYELYNED  327

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG +SE++WG+F  NG  VY ++L GS    +AN+++   +C+A+ GA +  LQ  +D
Sbjct  328  LRPGSISEKNWGLFNANGVPVYILHLTGSGT-VLANDTTNQTYCVAKEGADKKLLQAALD  386

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +C+ +  G PCY PDT+  HASYA++ YY ++    GTCDF+G AT TT D
Sbjct  387  WACGP-GKVDCNPLMQGNPCYDPDTVVAHASYAFDAYYHKMGMTDGTCDFNGVATVTTSD  445

Query  367  PSYGSCIFTGS  335
            PS+ SCIF GS
Sbjct  446  PSHNSCIFPGS  456



>ref|XP_011007238.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Populus euphratica]
 ref|XP_011007239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Populus euphratica]
Length=505

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 140/211 (66%), Gaps = 5/211 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G ++EPDAT++NA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  267  VMVTESGWPSKGDSNEPDATLDNANTYNSNLIRHVLNKTGTPKHPGIAVSTYIYELYNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG  VY ++L GS    +AN+++   +C A+ GA    LQ  +D
Sbjct  327  LKPGPVSEKNWGLFNANGEPVYILHLTGSGL-VLANDTTNQTYCTAKQGADPKMLQAALD  385

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+PCY PD +  HA+YA+N YY ++    GTCDF+G A  TT +
Sbjct  386  WACGP-GKVDCSAMLQGEPCYQPDNVIAHATYAFNSYYNQMGKAPGTCDFNGVAAITTTN  444

Query  367  PSYGSCIF---TGSSNSSIGGVPTPAFGPTA  284
            PS+G+C+F   TG  N +   +  P+   T+
Sbjct  445  PSHGTCVFPGSTGRMNGTTVNITAPSMNSTS  475



>ref|XP_009129217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brassica rapa]
 emb|CDY09427.1| BnaA02g25830D [Brassica napus]
Length=497

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 138/210 (66%), Gaps = 5/210 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G   E DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDGPEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVATYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+F  NG+ VY + L G+ A  +AN+++   FC+A+    +  LQ  +D
Sbjct  319  TRPGPLSEKNWGLFHTNGTPVYTLRLAGAGA-ILANDTTNQTFCVAKEKVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+ CY PD +  H+SYA+N YYQ++    G+CDF G AT T+ D
Sbjct  378  WACGP-GKVDCSELMQGEACYEPDDVAAHSSYAFNAYYQKMGKASGSCDFKGVATVTSTD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPTA  284
            PS G+C+F GS  SN ++G   T A  P+A
Sbjct  437  PSRGTCVFPGSAKSNQTLGH-NTTALAPSA  465



>ref|XP_010681923.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 4/205 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G +SEPDAT+ENA  YN+NLIRRV N+TG P    + +  YIYEL+NED
Sbjct  264  VVVTESGWPSKGDSSEPDATIENANTYNSNLIRRVLNNTGTPKHPGIAVSTYIYELYNED  323

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R G +SE++WG+F  NG  +Y ++L GS     AN+++   +C+A+  A    LQ  +D
Sbjct  324  LRSGLISEKNWGLFDANGVPIYILHLTGSGT-VFANDTTNQTYCVAKDSADPKMLQAALD  382

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD + +HA+YA++ YY R+    GTC F+G AT TT D
Sbjct  383  WACGP-GKVDCSPLLQGEPCYEPDNVVSHANYAFDTYYHRMAMAPGTCYFNGVATITTSD  441

Query  367  PSYGSCIFTGS--SNSSIGGVPTPA  299
            PS+GSC+F GS   N + G   T A
Sbjct  442  PSHGSCVFPGSGGRNETFGNSTTLA  466



>gb|AAO42272.1| unknown protein [Arabidopsis thaliana]
Length=332

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EP AT++NA  YN+NLI+ V + TG P   +M    YIYELFNED
Sbjct  101  VLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNED  160

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE SWG+F+ N + VY +++ GS    +AN+++   +CIA  G     LQ  +D
Sbjct  161  LRAPPVSEASWGLFYGNSTPVYLLHVSGSGTF-LANDTTNQTYCIAMDGVDAKTLQAALD  219

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G +NCS IQPG+ CY P+ ++ HAS+A+N YYQ+     G+CDF G A  TT D
Sbjct  220  WACGP-GRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTD  278

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  279  PSHGSCIFPGS  289



>gb|KDP25782.1| hypothetical protein JCGZ_22504 [Jatropha curcas]
Length=500

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 140/211 (66%), Gaps = 5/211 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G ++EPDAT++NA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  262  VMVTETGWPSKGDSNEPDATIDNANTYNSNLIRHVLNKTGTPKHPGIAVSTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGPVSE++WG+F  NG  VY ++L GS +  +AN+++   +C A+ GA    LQ  +D
Sbjct  322  TKPGPVSEKNWGLFNVNGEPVYILHLAGSGS-VLANDTTNQTYCTAKEGADPKMLQAALD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+ CY PD +  HA+YA+N YY ++    GTCDF+G A  TT +
Sbjct  381  WACGP-GKVDCSPLLQGESCYEPDNVIAHATYAFNTYYHQMGKAPGTCDFNGVAAVTTTN  439

Query  367  PSYGSCIF---TGSSNSSIGGVPTPAFGPTA  284
            PS+G+CIF   +G  N ++  +  P+   T+
Sbjct  440  PSHGTCIFPESSGKINGTLVNITAPSMNSTS  470



>ref|XP_010527795.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Tarenaya hassleriana]
Length=499

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 133/192 (69%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G  SE DAT +NA  YN+NLI  V N+TG P    + +  Y+YEL+NED
Sbjct  259  IVVTESGWPSKGGPSERDATTDNANTYNSNLIGHVLNNTGTPKHPGIAVSTYLYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F+ NG+ VY + L G+    +AN+++   FC+A+    +  LQ  +D
Sbjct  319  SRPGPVSEQNWGLFYSNGTPVYELRLAGAGT-VLANDTTNQTFCVAKESVDKKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD++  H+SYA+N YYQ++    G+CDF G AT T+ D
Sbjct  378  WACGP-GKVDCSPLLQGEPCYVPDSVVAHSSYAFNAYYQKMAKSPGSCDFKGVATVTSTD  436

Query  367  PSYGSCIFTGSS  332
            PS+GSC+F GSS
Sbjct  437  PSHGSCVFPGSS  448



>ref|XP_008802448.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Phoenix dactylifera]
Length=500

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 133/192 (69%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSE-PDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            VVV E+GWP  G  SE PDAT +NA  YN+NLI  V+N TG P    +P+  YIYEL++E
Sbjct  261  VVVLESGWPHKGDPSEEPDATADNADTYNSNLIHHVTNSTGTPKHPGIPVPTYIYELYDE  320

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D+RPG +SER+WG+F  NG  VY ++L GS    +AN+++   +CIA  GA    LQ  +
Sbjct  321  DQRPGVLSERNWGLFDANGMPVYTLHLTGSGV-LLANDTTNQTYCIATEGADAKLLQAAL  379

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +C+ +  G+PCY PDT++ HA+YA+N+YY  +    GTC+F+G AT TT 
Sbjct  380  DWACGP-GKVDCNVLMQGRPCYDPDTVEAHATYAFNEYYHGMGMASGTCNFNGVATITTT  438

Query  370  DPSYGSCIFTGS  335
            DPS+G CIF+GS
Sbjct  439  DPSHGDCIFSGS  450



>ref|XP_008775304.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Phoenix dactylifera]
Length=497

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSE-PDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            VVV E+GWP  G  SE PDAT +NA  YN+NLIR V N TG P    +P+  Y+YEL++E
Sbjct  258  VVVLESGWPHKGDPSEEPDATADNADTYNSNLIRHVLNSTGTPKHPGVPVPTYVYELYDE  317

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D+RPG +SER+WG+F  NG  VY ++L GS    +AN+++   +CIA+ GA    LQ  +
Sbjct  318  DQRPGALSERNWGLFDANGLPVYTLHLTGSGV-LLANDTTNQTYCIARDGADAKMLQAAL  376

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PDT++ HA+YA++ YY+ +    GTC F+G AT TT 
Sbjct  377  DWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAFSAYYRGMGMASGTCYFNGVATVTTT  435

Query  370  DPSYGSCIFTGS  335
            DPS+G+CIF GS
Sbjct  436  DPSHGACIFPGS  447



>ref|XP_004490817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Cicer arietinum]
Length=498

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 135/204 (66%), Gaps = 4/204 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDAT++NA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  260  VVVTESGWPSKGGSNEPDATIDNANNYNSNLIKHVFNKTGTPKHPGTAVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PG +SE++WG+F  NG  +Y ++L GS A  +AN++S   FC+A+ GA    +Q  +D
Sbjct  320  TKPGVLSEKNWGLFDANGVPIYILHLTGSGA-VLANDTSNQTFCVAKDGADPKMIQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   C  +  GQPCY PD +  HA+YA++ YY ++ +   +CDF G AT TT D
Sbjct  379  WACGP-GKVECDLLLQGQPCYEPDNVIAHANYAFDSYYHKMGNTPDSCDFKGVATITTSD  437

Query  367  PSYGSCIFTGS--SNSSIGGVPTP  302
            PS+GSCIF GS   NS+ G    P
Sbjct  438  PSHGSCIFPGSLGKNSTFGNFTAP  461



>ref|XP_006658732.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Oryza brachyantha]
Length=457

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWPW G  +E  A V+NA AYN NLIR V N++G PS+    +  YI+ELFNED
Sbjct  271  VMVTASGWPWNGGQNEKAANVDNALAYNTNLIRHVLNNSGTPSQPNNQVSTYIFELFNED  330

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + VY I     +   I + +  G FC+A   A  + L++ +D
Sbjct  331  LRSGPVSEKNWGIMFPNATTVYSITFEDMATANIDSPALRGTFCVANSSAPHSALKQSLD  390

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQS  419
            WACGP G+ANCSAIQPG+PCY  D +   ASYA+NDYY R Q+
Sbjct  391  WACGP-GSANCSAIQPGKPCYKSDDIVAVASYAFNDYYHRTQA  432



>ref|XP_004503372.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=501

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 140/218 (64%), Gaps = 4/218 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SE DAT++NA  YN+NLIR V N+TG P    + +  +IYEL+NED
Sbjct  263  IVVTESGWPSKGDSSESDATIDNANTYNSNLIRHVLNNTGTPKHPGIAVSTFIYELYNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R G VSE++WG+F+ +G  VY ++L G  AG I AN+++   FC+ +  A    LQ  +
Sbjct  323  LRSGEVSEKNWGLFYADGEPVYTLHLAG--AGVIFANDTTNQTFCVTKSNADTKMLQAAL  380

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G A  TT 
Sbjct  381  DWACGP-GKVDCSPLLQGQPCYEPDNVVAHAAYAFNAYYQKMAKSPGTCDFKGVAVITTT  439

Query  370  DPSYGSCIFTGSSNSSIGGVPTPAFGPTAPVGKGSMAR  257
            DPS+GSC+F GS   +   +   +  P+     G +++
Sbjct  440  DPSHGSCVFPGSHGKNRTRINGTSLAPSNSTSSGCLSQ  477



>gb|KHG06295.1| hypothetical protein F383_32557 [Gossypium arboreum]
Length=497

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 131/192 (68%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SEPDA V+NA  YN+NLI+ V N+TG P    + +  YIYEL+NED
Sbjct  259  IVVTESGWPSKGDSSEPDAIVDNANTYNSNLIKHVLNNTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG  SE++WG+F  NG  VY ++L G+     AN+++   FCIA+ GA    LQ  +D
Sbjct  319  LRPGSDSEKNWGLFDANGIPVYTLHLTGADT-VFANDTTNKTFCIAKRGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G PCY P+ + +H++YA+N YYQR+    GTCDF G AT TT D
Sbjct  378  WACGP-GKVDCSPLLMGHPCYEPNNVASHSTYAFNAYYQRMAKSPGTCDFKGVATITTSD  436

Query  367  PSYGSCIFTGSS  332
            PS+G CIF GSS
Sbjct  437  PSHGLCIFPGSS  448



>ref|XP_006596503.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=448

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 130/190 (68%), Gaps = 2/190 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDATV+NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  260  VVVTESGWPSKGGSNEPDATVDNANTYNSNLIKHVFNKTGTPKHPGIDVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG+ +Y ++L  S A  +AN++S   FCIA+ GA    LQ  +D
Sbjct  320  MKSGPLSEKNWGLFDANGTPIYILHLTESGA-VLANDTSNNTFCIAKDGADPKMLQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS +  GQPCY PD +  HA+YA++ YY ++      CDF+G AT +T D
Sbjct  379  WACGP-GKVECSPLLQGQPCYEPDNVIAHANYAFDTYYHKMGKTPDACDFNGVATISTSD  437

Query  367  PSYGSCIFTG  338
            PS+GSC+F G
Sbjct  438  PSHGSCLFPG  447



>ref|XP_010052861.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76987.1| hypothetical protein EUGRSUZ_D01339 [Eucalyptus grandis]
Length=527

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 131/195 (67%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+V+E+GWP  G + EP ATV+NA  YN+NLI+ V + TG P   ++    YIYELFNED
Sbjct  279  VLVSESGWPSKGDSKEPYATVDNADTYNSNLIKHVLDRTGTPLHPELTSSVYIYELFNED  338

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  P+SE +WG+F+ N +AVY +++ G S G +AN+++   +CIA        LQ  +D
Sbjct  339  LRSPPMSEANWGLFYGNSTAVYLLHVSG-SGGFLANDTTNQTYCIAMDNVDSRTLQTALD  397

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG QG ANCS IQPG+ CY P  ++NHASYA++ YYQ+     G+CDF G A  TT D
Sbjct  398  WACG-QGQANCSEIQPGEDCYQPSNVKNHASYAFDSYYQKEGKAAGSCDFKGVAMITTTD  456

Query  367  PSYGSCIFTGSSNSS  323
            PS+GSCIF GS   S
Sbjct  457  PSHGSCIFPGSKKVS  471



>gb|EPS65983.1| hypothetical protein M569_08793, partial [Genlisea aurea]
Length=459

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 135/207 (65%), Gaps = 8/207 (4%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G +SEP+AT ENA  YN+NLIR V N TG P      +  ++YEL+NED
Sbjct  239  VVVTESGWPSKGDSSEPEATPENADTYNSNLIRHVLNGTGTPKHPGAAVSTFVYELYNED  298

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP SER+WG+F  +G  VY + L   S   +AN+++   +C+A+  A    LQ  +D
Sbjct  299  LKPGPESERNWGLFQADGKPVYALQL-TQSGDLLANDTTRDTYCVAREDADRKMLQAALD  357

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS++  GQPCY PD + +H+SYA+N YY  +    G+C+F+G A  TT D
Sbjct  358  WACGP-GKVDCSSLVQGQPCYEPDDVASHSSYAFNAYYHSMGMADGSCNFNGVAAITTTD  416

Query  367  PSYGSCIFT------GSSNSSIGGVPT  305
            PS+GSC FT      GS+NSSI   P+
Sbjct  417  PSHGSCNFTGSGGFKGSNNSSIAAAPS  443



>ref|XP_010267108.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 130/199 (65%), Gaps = 5/199 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTETGWP  GS  E  AT +NA  YN+NLIR V NDTG P +    +  YI+ LFNE+
Sbjct  263  IMVTETGWPSKGSPKETAATPDNAQTYNSNLIRHVINDTGTPGKPGEELDVYIFSLFNEN  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIAN---NSSAGVFCIAQPGASENKLQK  557
            ++PG  SER+WG+F+P+ ++VY ++  G  A  I      SS G +CIA   ASE  LQ 
Sbjct  323  RKPGLESERNWGLFYPDQTSVYSLDFSGRGAVDITQANITSSNGTWCIASSTASELDLQN  382

Query  556  GIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattt  377
             +DWACGP GN +CSAIQP Q CY PDTL +HASYA+N YYQ+  +    C F GT   T
Sbjct  383  ALDWACGP-GNVDCSAIQPSQACYQPDTLLSHASYAFNSYYQQTGATDVACSFGGTGVKT  441

Query  376  tvDPSYGSCIF-TGSSNSS  323
              +PSY +C++ T  SN+S
Sbjct  442  NKNPSYDNCLYMTFGSNTS  460



>gb|KEH40581.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=498

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDAT +NA  YN+NLIR V N+TG P + K+ +  YIYEL+NED
Sbjct  260  ILVTESGWPSKGGSSEPDATPDNANTYNSNLIRHVLNNTGTPKQPKVTVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GP SE +WG+F+ NG+ VY ++L G  AG + AN+++   FC+A+  A    +Q  +
Sbjct  320  LRSGPASESNWGLFYANGAPVYTLHLTG--AGTVFANDTTNQTFCVAKSNADSKMIQAAL  377

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPC  PD +  HA+YA+N YYQ++    G+CDF G A+ TT 
Sbjct  378  DWACGP-GKVDCSPLLHGQPCSEPDNVVAHATYAFNAYYQKMDKSPGSCDFKGVASVTTT  436

Query  370  DPSYGSCIFTGS  335
            +PS+GSC F GS
Sbjct  437  NPSHGSCRFAGS  448



>gb|AES70967.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=491

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 2/203 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EP AT+ NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  260  VVVTETGWPSKGDSNEPGATLANANTYNSNLIKHVLNKTGTPKLPGIGVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            K+PG +SE++WG+F  NG  VY + L GS A  +AN++    +C+A+ GA    LQ GID
Sbjct  320  KQPGALSEKNWGLFDSNGVPVYVLQLTGSGA-VLANDTKGETYCVAKDGADPKMLQAGID  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD +  HA+YA++ YY ++     +C+F+  AT +T D
Sbjct  379  WACGP-GKVDCSPLLQGKPCYDPDNVVAHANYAFDAYYHKMGKSTESCNFNDMATISTSD  437

Query  367  PSYGSCIFTGSSNSSIGGVPTPA  299
            PS+GSCIF GS   S    P P+
Sbjct  438  PSHGSCIFPGSLGFSNAPAPAPS  460



>ref|XP_004295275.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=534

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP    + EP ATV+NA  YN+NLI+ V + +G P   +     YIYELFNED
Sbjct  289  VLVTESGWPSKADSKEPYATVDNADTYNSNLIKHVFDRSGTPLHPETTSSVYIYELFNED  348

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N SAVY +++ GS    +AN+++   FCIA  G     LQ  +D
Sbjct  349  LRSPPVSEANWGLFYGNSSAVYLLHVSGSGTF-LANDTTNQTFCIAMDGVDAKSLQAALD  407

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC+ IQPG+ CYSP+ ++NHASYA++ YYQ+     G+CDF G AT TT D
Sbjct  408  WACGP-GRANCTEIQPGENCYSPNNVKNHASYAFDSYYQKQGKAAGSCDFKGVATITTTD  466

Query  367  PSYGSCIFTGSSNSS  323
            PS GSCIF GS  +S
Sbjct  467  PSKGSCIFPGSKQAS  481



>ref|XP_011459999.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=535

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP    + EP ATV+NA  YN+NLI+ V + +G P   +     YIYELFNED
Sbjct  290  VLVTESGWPSKADSKEPYATVDNADTYNSNLIKHVFDRSGTPLHPETTSSVYIYELFNED  349

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N SAVY +++ GS    +AN+++   FCIA  G     LQ  +D
Sbjct  350  LRSPPVSEANWGLFYGNSSAVYLLHVSGSGTF-LANDTTNQTFCIAMDGVDAKSLQAALD  408

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANC+ IQPG+ CYSP+ ++NHASYA++ YYQ+     G+CDF G AT TT D
Sbjct  409  WACGP-GRANCTEIQPGENCYSPNNVKNHASYAFDSYYQKQGKAAGSCDFKGVATITTTD  467

Query  367  PSYGSCIFTGSSNSS  323
            PS GSCIF GS  +S
Sbjct  468  PSKGSCIFPGSKQAS  482



>gb|KEH28239.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=609

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 137/204 (67%), Gaps = 4/204 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G+ +EPDAT++NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  226  VVVTESGWPSKGAANEPDATIDNANNYNSNLIKHVFNKTGTPKHPGIAVSTYIYELYNED  285

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG  +Y ++L GS A  +AN++S   FCIA+ GA    +Q  +D
Sbjct  286  TKSGPLSEKNWGLFDANGVPIYILHLAGSGA-VLANDTSNQTFCIAKDGADPKMIQAALD  344

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS++  GQPCY PD +  HA+YA++ YY ++     +CDF G AT TT D
Sbjct  345  WACGP-GKVECSSLLQGQPCYEPDNVIAHANYAFDSYYNKMGRTPDSCDFKGVATITTSD  403

Query  367  PSYGSCIFTGS--SNSSIGGVPTP  302
            PS+GSC++ GS   N++ G    P
Sbjct  404  PSHGSCVYPGSLGKNNTFGNFTAP  427



>ref|XP_007026106.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY28728.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=523

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 131/195 (67%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EP AT++NA  YN+NLI+ V + +G P   ++    YIYELFNED
Sbjct  282  VLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVLDHSGTPLHPEITSSVYIYELFNED  341

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N + VY +++ GS    +AN+++   +CI   G     LQ  +D
Sbjct  342  LRSPPVSEANWGLFYSNSTPVYLLHVSGSGTF-LANDTTNQTYCITMDGVDSKTLQAALD  400

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++NHASYA++ YYQ+   V G+CDF G A  TT D
Sbjct  401  WACGP-GRANCSEIQPGEDCYQPNNVKNHASYAFDSYYQKEGRVSGSCDFKGVAMITTTD  459

Query  367  PSYGSCIFTGSSNSS  323
            PS+GSC+F GS   S
Sbjct  460  PSHGSCVFPGSKKVS  474



>ref|XP_003616282.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99240.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=642

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 137/204 (67%), Gaps = 4/204 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G+ +EPDAT++NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  259  VVVTESGWPSKGAANEPDATIDNANNYNSNLIKHVFNKTGTPKHPGIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG  +Y ++L GS A  +AN++S   FCIA+ GA    +Q  +D
Sbjct  319  TKSGPLSEKNWGLFDANGVPIYILHLAGSGA-VLANDTSNQTFCIAKDGADPKMIQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   CS++  GQPCY PD +  HA+YA++ YY ++     +CDF G AT TT D
Sbjct  378  WACGP-GKVECSSLLQGQPCYEPDNVIAHANYAFDSYYNKMGRTPDSCDFKGVATITTSD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTP  302
            PS+GSC++ GS   N++ G    P
Sbjct  437  PSHGSCVYPGSLGKNNTFGNFTAP  460



>gb|KJB10512.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=599

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 134/209 (64%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  361  VIVTETGWPSKGDSNEPDATMENANTYNSNLIRHVMNKTGTPKRPGIAVSTYIYELYNED  420

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP SE++WG+F  NG  +Y + L   S   +AN+++   +C A+ GA    LQ  +D
Sbjct  421  LKPGPSSEKNWGLFDANGDPIYILRL-TDSGSLLANDTTNQTYCTAKEGADPKMLQAALD  479

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD +  HA+YA++ YY R+      CDF+G A  TT D
Sbjct  480  WACGP-GKVDCSPLLQGKPCYEPDNVIAHATYAFDTYYHRMGKTSDACDFNGVADITTTD  538

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+GSCIF GS   N ++  +  P+   T
Sbjct  539  PSHGSCIFPGSLGRNGTMVNITAPSMNST  567



>ref|XP_004503127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cicer arietinum]
Length=498

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTETGWP  GS++EPDAT +NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  259  LVVTETGWPSKGSSNEPDATPDNANTYNSNLIKHVLNRTGTPKHPGISVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PG +SE++WG+F  NG  VY + L GS A  +AN++S   FCIA+ GA    LQ GID
Sbjct  319  TKPGILSEKNWGLFESNGIPVYVLQLTGSGA-VLANDTSNETFCIAKDGADPKMLQAGID  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+ CY PD +  HA+YA++ YY  +     +CDF+  A  +T D
Sbjct  378  WACGP-GKVDCSPLLQGETCYEPDNVVAHANYAFDTYYHMMGKSTESCDFNEMAIISTSD  436

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAF  296
            PS+GSCIF G    N +   V  P+ 
Sbjct  437  PSHGSCIFAGRLGRNGTFSNVTAPSL  462



>ref|XP_006417308.1| hypothetical protein EUTSA_v10006713mg [Eutrema salsugineum]
 gb|ESQ35661.1| hypothetical protein EUTSA_v10006713mg [Eutrema salsugineum]
Length=949

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 130/193 (67%), Gaps = 2/193 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWPW G + EP AT++NA  YN+NLI+ V + TG P   +M    YIYELFNED
Sbjct  285  VLVTESGWPWKGDSKEPHATIDNADTYNSNLIKHVFDRTGTPLHPEMTPSVYIYELFNED  344

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR  PVSE SWG+F  N + VY +++ GS    +AN+++   +CIA        LQ  +D
Sbjct  345  KRAPPVSEASWGLFSGNSTPVYLLHVSGSGTF-LANDTTNQTYCIAMDSVDAKTLQAALD  403

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++ HAS+A+N+YYQ+     G+CDF G A  TT D
Sbjct  404  WACGP-GRANCSEIQPGESCYQPNNVKGHASFAFNNYYQKEGRASGSCDFKGVAMITTTD  462

Query  367  PSYGSCIFTGSSN  329
            PS+GSCIF GS  
Sbjct  463  PSHGSCIFPGSKK  475



>ref|NP_001150141.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
 gb|ACG38014.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
Length=501

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 3/197 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGS-TSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V+VTETGWP  G  +SEPDAT +NA  YN+NLIR V N TG P   ++ +  YIYEL++E
Sbjct  262  VMVTETGWPHKGDPSSEPDATSDNADTYNSNLIRHVMNSTGTPKHPRVAVPTYIYELYDE  321

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN+++   +C+AQ GA    LQ  +
Sbjct  322  DTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGV-LLANDTTNQTYCVAQEGADPKMLQAAL  380

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PDT++ HA+YA+N YY  +    GT  F G A  TT 
Sbjct  381  DWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAFNAYYHGMGMGSGTFYFSGVAVVTTT  439

Query  370  DPSYGSCIFTGSSNSSI  320
            DPS+GSC++ G + +S+
Sbjct  440  DPSHGSCVYGGKNGTSL  456



>ref|XP_003558472.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brachypodium distachyon]
Length=498

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 133/198 (67%), Gaps = 5/198 (3%)
 Frame = -1

Query  907  VVVTETGWPWFG-STSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V+VTETGWP  G ++SEPDA  +NA  YN+NLIR V N TG P    + +  YIYEL++E
Sbjct  261  VMVTETGWPHKGDASSEPDANADNADTYNSNLIRHVMNVTGTPKHPGVAVPTYIYELYDE  320

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQ-IANNSSAGVFCIAQPGASENKLQKG  554
            D RPG  SE+ WG+F  NGS  Y ++L GS  GQ +AN+++   FC+A+ GA E  LQ  
Sbjct  321  DTRPGTTSEKYWGLFDMNGSPAYALHLTGS--GQLLANDTTNNTFCVARDGADEKMLQAA  378

Query  553  IDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatttt  374
            +DWACGP G  +CS +  G  CY PDT+Q+HA+YA+N YY  +    G+C F G A  TT
Sbjct  379  LDWACGP-GKVDCSVLTQGHACYEPDTVQDHATYAFNAYYHGIGMGSGSCYFSGVAVVTT  437

Query  373  vDPSYGSCIFTGSSNSSI  320
             DPS+GSC++ G + S++
Sbjct  438  TDPSHGSCVYGGKNGSAL  455



>ref|XP_011097437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Sesamum indicum]
Length=496

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 134/193 (69%), Gaps = 2/193 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G ++EPDA+++NA  YN+NLIR V + TG P    + +  YIYEL+NED
Sbjct  261  VLVTESGWPSKGDSNEPDASLDNANTYNSNLIRHVLSKTGTPKHPGIAVSTYIYELYNED  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  VY ++L GS +  +AN+++   +C A+ G+    LQ  +D
Sbjct  321  MKPGPLSEKNWGLFDSNGVPVYILHLTGSGS-VLANDTANQTYCTAKDGSDSRMLQAALD  379

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQ CY PDT+  HA+YA+N YY ++     +CDF G AT TT +
Sbjct  380  WACGP-GKVDCSPLLQGQACYEPDTVFAHATYAFNTYYHQMGKTPESCDFKGVATITTTN  438

Query  367  PSYGSCIFTGSSN  329
            PS+GSCIF GSS+
Sbjct  439  PSHGSCIFPGSSD  451



>ref|XP_006644680.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Oryza brachyantha]
Length=493

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 138/217 (64%), Gaps = 11/217 (5%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTETGWP  G+  E  AT +NA  YN NLIR V ND+G P++    I  YI+ LFNE+
Sbjct  257  IMVTETGWPNKGAVKETGATSDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNEN  316

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGS------SAGQIANNSSAGVFCIAQPGASENK  566
            ++PG  SER+WG+FFP+ S++Y ++  G       + G I N  + G +C+A   ASE  
Sbjct  317  RKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDIMTGGNITN--ANGTWCVASANASETD  374

Query  565  LQKGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgta  386
            LQ G++WACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    CDF GT 
Sbjct  375  LQNGLNWACGP-GNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANDVACDFGGTG  433

Query  385  ttttvDPSYGSCIFT--GSSNSSIGGVPTPAFGPTAP  281
              TT DPSY +C++   GS  S+      P    ++P
Sbjct  434  MRTTKDPSYDTCVYMAAGSKMSTTNSSALPVLNGSSP  470



>ref|XP_008806478.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
1-like [Phoenix dactylifera]
Length=524

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 134/192 (70%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGS-TSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V++TETGWP  GS   EP AT +NA  YN+NLI+ V + +G P   ++   AYIYELFNE
Sbjct  278  VLITETGWPSNGSRKDEPFATKDNADTYNSNLIKHVLDRSGTPLHPEVTSSAYIYELFNE  337

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPGPVSE +WG+F+ NG+ VY +++ G S G +AN+++   +C+A  GA    LQ  +
Sbjct  338  DLRPGPVSEGNWGLFYGNGTPVYVLHVSG-SGGFLANDTTNRTYCVAAEGAEGKALQAAL  396

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G ANCS IQPG+ CY P+ +++HASYA++ YYQ+   + G+C F G A  TT 
Sbjct  397  DWACGP-GRANCSEIQPGESCYDPNNVRSHASYAFDSYYQKEGKLAGSCYFQGVAMVTTT  455

Query  370  DPSYGSCIFTGS  335
            DPS+G CIF GS
Sbjct  456  DPSHGDCIFPGS  467



>gb|AIR93909.1| glucanase [Cicer arietinum]
Length=454

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G +SE DAT++NA  YN+NLIR V N+TG P    + +  +IYEL+NED
Sbjct  263  IVVTESGWPSKGDSSESDATIDNANTYNSNLIRHVLNNTGTPKHPGIAVSTFIYELYNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R G VSE++WG+F+ +G  VY ++L G  AG I AN+++   FC+ +  A    LQ  +
Sbjct  323  LRSGEVSEKNWGLFYADGEPVYTLHLAG--AGVIFANDTTNQTFCVTKSNADTKMLQAAL  380

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PD +  HA+YA+N YYQ++    GTCDF G A  TT 
Sbjct  381  DWACGP-GKVDCSPLLQGQPCYEPDNVVAHAAYAFNAYYQKMAKSPGTCDFKGVAVITTT  439

Query  370  DPSYGSCIFTG  338
            DPS+GSC+F G
Sbjct  440  DPSHGSCVFPG  450



>ref|XP_006828511.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
 gb|ERM95927.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
Length=526

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 140/205 (68%), Gaps = 4/205 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VV E+GWP  G ++EPDAT++NA  YN+NL++ V N+TG P    +P+  YIYEL+NED
Sbjct  288  IVVLESGWPSGGDSNEPDATIDNADQYNSNLVKHVLNNTGTPKHPGVPVSTYIYELYNED  347

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGP+SE++WG+F  +GS VY ++L  S    +AN+++   +C+A  GA +  LQ  +D
Sbjct  348  ARPGPMSEKNWGLFNADGSPVYTLHLTDSGV-VLANDTTNQTYCVAISGADKKLLQAALD  406

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +C+ +  GQPCY PD +++HASYA++ YY ++    GTCDF G AT TT D
Sbjct  407  WACGP-GKVDCTPLLQGQPCYDPDNVESHASYAFDTYYHKMGMAVGTCDFKGVATVTTTD  465

Query  367  PSYGSCIFTGS--SNSSIGGVPTPA  299
            PS+ SC F GS   N + G + + A
Sbjct  466  PSHDSCSFPGSGGKNGTFGNITSLA  490



>emb|CDY31214.1| BnaC08g15090D [Brassica napus]
Length=522

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G   EP AT++NA  Y +NLI+ V + TG P   ++    YIYELFNED
Sbjct  287  VLVTETGWPSQGDKMEPHATIDNADTYTSNLIKHVFDRTGTPLRPEVTPSVYIYELFNED  346

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR  PVSE SWG+F+ N + VY +++ GS A  +AN+++   +C+A  G     LQ  +D
Sbjct  347  KRAKPVSEASWGLFYGNTTPVYLLHVSGSGAF-LANDTTNKTYCVAMDGVDVKTLQAALD  405

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++ HAS+A+N YYQ+     G+CDF G A  TT D
Sbjct  406  WACGP-GRANCSEIQPGESCYQPNNVKGHASFAFNSYYQQEGRASGSCDFKGVAMITTTD  464

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  465  PSHGSCIFPGS  475



>ref|XP_006378439.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56236.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=424

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT++NA  YN+NLIR V N+TG P    + +  YIYEL+NED
Sbjct  242  IFVTESGWPSKGDSSEPDATLDNANTYNSNLIRHVLNNTGTPKHPGIVVSTYIYELYNED  301

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  302  SRPGPVSEKNWGLFDANGMPVYTLHLTGAGT-LLANDTTNQTFCVAKEGADPKMLQAALD  360

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRV  425
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++
Sbjct  361  WACGP-GKVDCSFLLQGQPCYEPDNVVAHSTYAFNAYFQKM  400



>gb|KFK43454.1| hypothetical protein AALP_AA1G127200 [Arabis alpina]
Length=511

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 128/191 (67%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G T EP AT++NA  YN+NLI+ + + TG P   +M    YIYELFNED
Sbjct  278  VLVTESGWPSKGDTKEPYATIDNADTYNSNLIKHIFDRTGTPLHPEMTSSVYIYELFNED  337

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE SWG+F+ N + VY +++ GS    +AN+++   +CI   G     LQ  +D
Sbjct  338  LRAPPVSEASWGLFYGNSTPVYLLHVSGSGTF-LANDTTNQTYCIVMDGVDAKTLQAALD  396

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++ HAS+A+N YYQ+     G+CDF G A  TT D
Sbjct  397  WACGP-GRANCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTD  455

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  456  PSHGSCIFPGS  466



>ref|XP_009359235.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Pyrus x bretschneideri]
Length=540

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+V+E+GWP  G + EP AT++NA  YN+NLI+ V + +G P   ++  + YIYELFNED
Sbjct  292  VLVSESGWPSKGDSKEPYATIDNADTYNSNLIKHVLDRSGTPLHPEITSNVYIYELFNED  351

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N SAVY +++ GS +  +AN+++   +CIA  G     LQ  +D
Sbjct  352  LRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-LANDTTNQTYCIAMDGMDGKSLQAALD  410

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CYSP+ +++HASYA++ YYQ+     G+CDF G AT TT D
Sbjct  411  WACGP-GRANCSEIQPGEDCYSPNNVKSHASYAFDSYYQKQGRAAGSCDFQGVATITTTD  469

Query  367  PSYGSCIFTGSSNSS  323
            PS+GSCIF GS   S
Sbjct  470  PSHGSCIFPGSKKVS  484



>ref|XP_010249473.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Nelumbo nucifera]
Length=495

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 131/199 (66%), Gaps = 5/199 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTETGWP  GS  E  AT +NA  YN+NLIR V NDTG P++    +  YI+ LFNE+
Sbjct  261  IMVTETGWPSKGSPKETAATPDNAQTYNSNLIRHVVNDTGTPAKPGEELDVYIFSLFNEN  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIAN---NSSAGVFCIAQPGASENKLQK  557
            ++PG  SER+WG+F+P+ ++VY ++L G  A  I      SS G +CIA   ASE  LQ 
Sbjct  321  RKPGLESERNWGLFYPDQTSVYSVDLTGRGAVDITEANITSSNGTWCIASSTASELDLQN  380

Query  556  GIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattt  377
             +DW CGP GN +CSAIQP Q CY PDTL +HAS+A+N YYQ+  +    C F GT   T
Sbjct  381  ALDWTCGP-GNVDCSAIQPSQACYQPDTLVSHASFAFNSYYQQNGATDVACSFGGTGVKT  439

Query  376  tvDPSYGSCIF-TGSSNSS  323
              +PSY +C++ T  SN+S
Sbjct  440  NKNPSYDNCLYMTFGSNTS  458



>ref|XP_010062264.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Eucalyptus grandis]
 gb|KCW69376.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=499

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDATV+NA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  263  VVVTETGWPSKGDSNEPDATVDNANTYNSNLIRHVLNKTGTPKHPGITVSTYIYELYNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  +GS +Y ++L GS +  +AN+++   +C A+ GA    LQ  +D
Sbjct  323  TKAGPLSEKNWGLFDASGSPIYILHLTGSGS-VLANDTTNQTYCTAKEGADPKMLQAALD  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G  +CS +  G+ CY PDTL  HA+YA++ YY ++    GTCDF+G A  TT D
Sbjct  382  WACG-VGKVDCSPMLQGESCYEPDTLSAHATYAFDTYYHQMGKAPGTCDFNGVAAITTTD  440

Query  367  PSYGSCIFTGS--SNSSIGGVPTPAFGPT  287
            PS+G+CIF+GS   N++   V  P+   T
Sbjct  441  PSHGTCIFSGSLGRNATSVNVTAPSMNST  469



>ref|NP_001184967.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 sp|O65399.3|E131_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 1; AltName: Full=(1->3)-beta-glucan 
endohydrolase 1; Short=(1->3)-beta-glucanase 
1; AltName: Full=Beta-1,3-endoglucanase 1; Short=Beta-1,3-glucanase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28791.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=511

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EP AT++NA  YN+NLI+ V + TG P   +M    YIYELFNED
Sbjct  280  VLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNED  339

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE SWG+F+ N + VY +++ GS    +AN+++   +CIA  G     LQ  +D
Sbjct  340  LRAPPVSEASWGLFYGNSTPVYLLHVSGSGTF-LANDTTNQTYCIAMDGVDAKTLQAALD  398

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G +NCS IQPG+ CY P+ ++ HAS+A+N YYQ+     G+CDF G A  TT D
Sbjct  399  WACGP-GRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTD  457

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  458  PSHGSCIFPGS  468



>ref|XP_004498268.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=496

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 139/202 (69%), Gaps = 7/202 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDAT +NA  YN+NLIR V N++G P + ++ +  YIYEL+NED
Sbjct  258  ILVTESGWPSKGDSSEPDATPDNANTYNSNLIRHVLNNSGTPKQPRVAVSTYIYELYNED  317

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GPVSE +WG+F+ NG+ VY ++L G  AG + AN+++   FC+A+  A    +Q  +
Sbjct  318  LRSGPVSENNWGLFYANGAPVYTLHLTG--AGTVFANDTTNQTFCVAKSNADTKMIQAAL  375

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQ C  PD + +HA+YA+N YYQ +    GTCDF G A+ TT 
Sbjct  376  DWACGP-GKVDCSPLLHGQACSEPDNVVSHATYAFNAYYQLMDKSPGTCDFKGVASVTTT  434

Query  370  DPSYGSCIFTGS---SNSSIGG  314
            +PS+GSCIF GS   + SSI G
Sbjct  435  NPSHGSCIFPGSGGQNGSSING  456



>ref|XP_009110702.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Brassica rapa]
 emb|CDY21013.1| BnaA08g25120D [Brassica napus]
Length=519

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G   EP AT++NA  Y +NLI+ V + TG P   ++    YIYELFNED
Sbjct  284  VLVTETGWPSQGDKMEPHATIDNADTYTSNLIKHVFDRTGTPLRPEVTPSVYIYELFNED  343

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
            KR  PVSE SWG+F+ N + VY +++ GS A  +AN+++   +C+A  G     LQ  +D
Sbjct  344  KRAPPVSEASWGLFYGNTTPVYLLHVSGSGAF-LANDTTNKTYCVAMDGVDVKTLQAALD  402

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++ HAS+A+N YYQ+     G+CDF G A  TT D
Sbjct  403  WACGP-GRANCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTD  461

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  462  PSHGSCIFPGS  472



>emb|CDM84006.1| unnamed protein product [Triticum aestivum]
Length=494

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 131/207 (63%), Gaps = 5/207 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +++TETGWP  G+  E  AT +NA  YN NLIR V ND+G P++    I  YI+ LFNE+
Sbjct  260  IMITETGWPHKGAAKETGATPDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNEN  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIAN--NSSAGVFCIAQPGASENKLQKG  554
            ++PG  SER+WG+F P+ S++Y I+  G     I    N S G +C+A    SE  LQ G
Sbjct  320  RKPGIESERNWGLFSPDQSSIYSIDWTGRGNVDIMTGGNRSNGTWCVASTNVSETALQNG  379

Query  553  IDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatttt  374
            ++WACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    C F G    TT
Sbjct  380  LNWACGP-GNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGGAGMRTT  438

Query  373  vDPSYGSCIFT--GSSNSSIGGVPTPA  299
             DPSY +C++   GS  S+     TPA
Sbjct  439  KDPSYDTCVYMAAGSKISTKNSTATPA  465



>ref|XP_002456331.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
 gb|EES01451.1| hypothetical protein SORBIDRAFT_03g034100 [Sorghum bicolor]
Length=497

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 139/216 (64%), Gaps = 7/216 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +++TE+GWP  G+  E  AT +NA  YN NLIR V ND+G P++    I  YI+ LFNE+
Sbjct  261  IMITESGWPNKGAAKETGATPDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNEN  320

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI---ANNSSA-GVFCIAQPGASENKLQ  560
            ++PG  SER+WG+FFP+ S++Y ++  G     +   AN +SA G +CIA   ASE  LQ
Sbjct  321  RKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANGTWCIASANASETDLQ  380

Query  559  KGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatt  380
              ++WACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    CDF G    
Sbjct  381  NALNWACGP-GNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFSGAGIR  439

Query  379  ttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTAPV  278
            TT DPSY +C++  + N  S++     PA   + PV
Sbjct  440  TTKDPSYDTCVYLAAGNKMSTMNSTSLPAQSNSGPV  475



>ref|XP_004490818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Cicer arietinum]
Length=448

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 129/190 (68%), Gaps = 2/190 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDAT++NA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  260  VVVTESGWPSKGGSNEPDATIDNANNYNSNLIKHVFNKTGTPKHPGTAVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PG +SE++WG+F  NG  +Y ++L GS A  +AN++S   FC+A+ GA    +Q  +D
Sbjct  320  TKPGVLSEKNWGLFDANGVPIYILHLTGSGA-VLANDTSNQTFCVAKDGADPKMIQAALD  378

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G   C  +  GQPCY PD +  HA+YA++ YY ++ +   +CDF G AT TT D
Sbjct  379  WACGP-GKVECDLLLQGQPCYEPDNVIAHANYAFDSYYHKMGNTPDSCDFKGVATITTSD  437

Query  367  PSYGSCIFTG  338
            PS+GSCIF G
Sbjct  438  PSHGSCIFPG  447



>gb|KCW69377.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=451

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 132/190 (69%), Gaps = 2/190 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTETGWP  G ++EPDATV+NA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  263  VVVTETGWPSKGDSNEPDATVDNANTYNSNLIRHVLNKTGTPKHPGITVSTYIYELYNED  322

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  +GS +Y ++L GS +  +AN+++   +C A+ GA    LQ  +D
Sbjct  323  TKAGPLSEKNWGLFDASGSPIYILHLTGSGS-VLANDTTNQTYCTAKEGADPKMLQAALD  381

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G  +CS +  G+ CY PDTL  HA+YA++ YY ++    GTCDF+G A  TT D
Sbjct  382  WACG-VGKVDCSPMLQGESCYEPDTLSAHATYAFDTYYHQMGKAPGTCDFNGVAAITTTD  440

Query  367  PSYGSCIFTG  338
            PS+G+CIF+G
Sbjct  441  PSHGTCIFSG  450



>ref|XP_011023920.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Populus 
euphratica]
Length=488

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 124/192 (65%), Gaps = 12/192 (6%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            + VTE+GWP  G +SEPDAT+ENA  YN+NLIR V N+TG P   K+ +  YIYEL+NED
Sbjct  259  IFVTESGWPSKGDSSEPDATLENANTYNSNLIRHVLNNTGTPKHPKIAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPG +SE++WG+F  +G  VY ++L G+    +AN+++   FC+A+ GA    LQ  +D
Sbjct  319  LRPGALSEKNWGLFDADGMPVYTLHLTGAGT-VLANDTTNQTFCVAKEGADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  GQPCY PD +  H++YA+N Y+Q++            +  T   
Sbjct  378  WACGP-GKVDCSYLLQGQPCYEPDNVVAHSTYAFNAYFQKMAK----------SPGTCDF  426

Query  367  PSYGSCIFTGSS  332
              +GSCIF GS+
Sbjct  427  KGHGSCIFPGSA  438



>ref|XP_008672638.1| PREDICTED: uncharacterized protein LOC100278152 isoform X2 [Zea 
mays]
 gb|ACN28065.1| unknown [Zea mays]
 tpg|DAA57721.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
 tpg|DAA57722.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=496

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 138/216 (64%), Gaps = 7/216 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +++TE+GWP  G+  E  AT +NA  YN NLIR V ND+G P++    I  YI+ LFNE+
Sbjct  260  IMITESGWPNKGAVKETGATPDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNEN  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI---ANNSSA-GVFCIAQPGASENKLQ  560
            ++PG  SER+WG+FFP+ S++Y ++  G     +   AN +SA G +CIA   ASE  LQ
Sbjct  320  RKPGIESERNWGLFFPDKSSIYSLDWTGRGNVDVMTGANITSANGTWCIASTNASETDLQ  379

Query  559  KGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatt  380
              ++WACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    CDF G    
Sbjct  380  NALNWACGP-GNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFGGAGIR  438

Query  379  ttvDPSYGSCIFTGSSN--SSIGGVPTPAFGPTAPV  278
            TT DPSY +C++  + N  S+      PA   + PV
Sbjct  439  TTKDPSYDTCVYLAAGNKMSTTNSTSLPARSDSGPV  474



>ref|XP_004969893.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Setaria 
italica]
Length=496

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 7/215 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G+  E  AT +NA  YN NLIR V ND+G P++    I  YI+ LFNE+
Sbjct  260  IMVTESGWPNKGAAKETGATPDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNEN  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI---ANNSSA-GVFCIAQPGASENKLQ  560
            ++PG  SER+WG+FFP+ S++Y ++  G     +   AN +SA G +CIA   ASE  LQ
Sbjct  320  RKPGIESERNWGLFFPDQSSIYSLDWTGRGNVDVMTGANITSANGTWCIASANASETDLQ  379

Query  559  KGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatt  380
              ++WACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    CDF G    
Sbjct  380  NALNWACGP-GNVDCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANVVACDFGGAGIR  438

Query  379  ttvDPSYGSCIFT--GSSNSSIGGVPTPAFGPTAP  281
            TT DPSY +C++   GS  S++     PA   ++P
Sbjct  439  TTKDPSYDTCVYLAAGSKMSTMNSTSLPARSGSSP  473



>ref|XP_010926119.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Elaeis guineensis]
Length=501

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSE-PDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            VVV E+GWP  G  SE PDAT +NA  YN+NLIR V N TG P    + +  YIYEL++E
Sbjct  261  VVVLESGWPHKGDPSEEPDATADNADTYNSNLIRHVLNSTGTPKHPGIAVPTYIYELYDE  320

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D+RPG VSER+WG+F  NG  VY ++L GS    +AN+++   +CIA+ GA    LQ  +
Sbjct  321  DQRPGAVSERNWGLFDANGVPVYTLHLTGSGV-LLANDTTNQTYCIAKEGADAKLLQAAL  379

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PDT++ HA+YA+N YY  +    GTC F+G AT TT 
Sbjct  380  DWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAFNAYYHGMGMGSGTCYFNGVATITTT  438

Query  370  DPSYGSCIFTGS  335
            DPS+G C F GS
Sbjct  439  DPSHGDCTFPGS  450



>ref|XP_007163382.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
 gb|ESW35376.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
Length=498

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVV+ETGWP  G ++EPDATVENA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  259  VVVSETGWPSKGDSNEPDATVENANTYNSNLIKHVLNVTGTPKHPGIGVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + G +SE++WG+F  NG  +Y + L   S G +AN+++   +C+A+ GA    LQ GID
Sbjct  319  AKAGSLSEKNWGLFDANGKPIYVLQL-TESGGVLANDTTNQTYCVAKDGADPKMLQAGID  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD++  HA+YA++ YY ++     +CDF+  AT ++ +
Sbjct  378  WACGP-GKVDCSPLLQGEPCYEPDSVVAHANYAFDTYYHQMGKSPQSCDFNDMATISSTN  436

Query  367  PSYGSCIFTGS  335
            PS+GSC+F GS
Sbjct  437  PSHGSCVFPGS  447



>dbj|BAJ85556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 135/215 (63%), Gaps = 7/215 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +++TETGWP  G+T E  AT +NA  YN NLIR V ND+G P++    I  YI+ LFNE+
Sbjct  260  IMITETGWPHKGATKETGATPDNAQTYNTNLIRHVVNDSGTPAKPGEEIDVYIFSLFNEN  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIAN----NSSAGVFCIAQPGASENKLQ  560
            ++PG  SER+WG+F P+ S++Y ++  G     I       SS G +C+A    SE  LQ
Sbjct  320  RKPGIESERNWGLFSPDQSSIYSVDWTGRGNVDIMTGGNLTSSNGTWCVASTNVSETALQ  379

Query  559  KGIDWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtatt  380
             G++WACGP GN +CSAIQP QPCY PDTL +HASYA+N YYQ+  +    C F G    
Sbjct  380  NGLNWACGP-GNVDCSAIQPSQPCYQPDTLVSHASYAFNSYYQQNGATDVACGFGGAGMR  438

Query  379  ttvDPSYGSCIFT--GSSNSSIGGVPTPAFGPTAP  281
            TT DPSY +C++   GS  S+     +PA   ++P
Sbjct  439  TTKDPSYDTCLYMAAGSKISTKNSTTSPARSGSSP  473



>ref|XP_006395868.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33154.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=422

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            +VVTE+GWP  G   E DATVENA  YN+NLI+ V N TG P      +  YIYEL+NED
Sbjct  242  IVVTESGWPSKGDAKEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNED  301

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             RPGPVSE++WG+F  NG+ VY + L G+ A  +AN+++   FCIA+    +  LQ  +D
Sbjct  302  TRPGPVSEKNWGLFHTNGTPVYTLRLAGAGA-ILANDTTNQTFCIAKEKVDKKMLQAALD  360

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRV  425
            WACGP G  +CSA+  G+ CY PD +  H++YA+N YYQ++
Sbjct  361  WACGP-GKVDCSALMQGEACYEPDDVVAHSTYAFNAYYQKM  400



>gb|KHN03485.1| Glucan endo-1,3-beta-glucosidase 1 [Glycine soja]
Length=310

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 127/195 (65%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G + EP AT +NA  YN+NLIR V + TG P   +     +IYELFNED
Sbjct  66   VLVTETGWPAKGDSKEPYATKDNADTYNSNLIRHVFDRTGTPLHPETTSSVFIYELFNED  125

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N S  Y +++ G     +AN+++   +CIA  G     LQ  +D
Sbjct  126  LRAPPVSEANWGLFYGNTSPAYLLHVSGIGTF-LANDTTNQTYCIAMDGFDSKTLQAALD  184

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ C+ P+ ++NHASYA++ YYQ+     GTCDF G A  TT D
Sbjct  185  WACGP-GRANCSEIQPGESCFQPNNVKNHASYAFDSYYQKEGKAQGTCDFKGLAMITTTD  243

Query  367  PSYGSCIFTGSSNSS  323
            PS+GSCIF GS   S
Sbjct  244  PSHGSCIFPGSKKVS  258



>gb|ACN30650.1| unknown [Zea mays]
 gb|ACN31599.1| unknown [Zea mays]
 gb|ACR36210.1| unknown [Zea mays]
 gb|AFW89170.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=501

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 131/197 (66%), Gaps = 3/197 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGS-TSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V+VTETGWP  G  +SEPDAT +NA  YN+NLIR V N TG P   ++ +  YIYEL++E
Sbjct  262  VMVTETGWPHKGDPSSEPDATSDNADTYNSNLIRHVMNSTGTPKHPRVAVPTYIYELYDE  321

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN+++   +C+A+ GA    LQ  +
Sbjct  322  DTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGV-LLANDTTNQTYCVAREGADPKMLQAAL  380

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PDT++ HA+YA+N YY  +    GTC F G A  TT 
Sbjct  381  DWACGP-GKVDCSVLMQGQPCYDPDTVEAHATYAFNAYYHGMGMGSGTCYFSGVAVVTTT  439

Query  370  DPSYGSCIFTGSSNSSI  320
            DPS+GSC++ G + +S+
Sbjct  440  DPSHGSCVYGGKNGTSL  456



>gb|KEH40580.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=506

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 132/191 (69%), Gaps = 4/191 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            ++VTE+GWP  G +SEPDAT +NA  YN+NLIR V N+TG P + K+ +  YIYEL+NED
Sbjct  260  ILVTESGWPSKGGSSEPDATPDNANTYNSNLIRHVLNNTGTPKQPKVTVSTYIYELYNED  319

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQI-ANNSSAGVFCIAQPGASENKLQKGI  551
             R GP SE +WG+F+ NG+ VY ++L G  AG + AN+++   FC+A+  A    +Q  +
Sbjct  320  LRSGPASESNWGLFYANGAPVYTLHLTG--AGTVFANDTTNQTFCVAKSNADSKMIQAAL  377

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPC  PD +  HA+YA+N YYQ++    G+CDF G A+ TT 
Sbjct  378  DWACGP-GKVDCSPLLHGQPCSEPDNVVAHATYAFNAYYQKMDKSPGSCDFKGVASVTTT  436

Query  370  DPSYGSCIFTG  338
            +PS+GSC F G
Sbjct  437  NPSHGSCRFAG  447



>ref|XP_009589694.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Nicotiana 
tomentosiformis]
Length=500

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 130/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EPDAT++NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  262  VMVTESGWPSQGDSDEPDATLDNANTYNSNLIKHVLNKTGTPKHPGIAVSTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PG +SE++WG+F  NG+ VY + L   S    AN++S   +C A+ GA    LQ  +D
Sbjct  322  NKPGHLSEKNWGLFNANGTPVYILRL-TESGSMFANDTSNQTYCAAKDGADSKMLQAALD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CSA+  G+PCY PD +  HA+YA++ YY  +    GTCDF+G AT TT +
Sbjct  381  WACGP-GKVDCSALLQGEPCYEPDNVAAHATYAFDAYYHMMGRAPGTCDFNGVATITTTN  439

Query  367  PSYGSCIFTGS  335
            PS+GSC+F+GS
Sbjct  440  PSHGSCVFSGS  450



>gb|EYU45799.1| hypothetical protein MIMGU_mgv1a004953mg [Erythranthe guttata]
Length=503

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G ++EPDA ++NA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  267  VLVTESGWPSKGDSNEPDANMDNANTYNSNLIRHVLNKTGTPKHPGISVSTYIYELYNED  326

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG   Y + L GS +  +AN+++   FC A+ GA E  +Q  +D
Sbjct  327  AKAGPLSEKNWGLFDKNGVPTYILRLTGSGS-VLANDTTNQTFCTAKEGADEKMVQAALD  385

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS++  GQ CY PDT+  HA+YA++ YY ++    G+CDF+G AT TT +
Sbjct  386  WACGP-GKVDCSSLLQGQACYEPDTVVAHATYAFDAYYHQMGKTPGSCDFNGVATITTTN  444

Query  367  PSYGSCIFTGS  335
            PS+GSC+F GS
Sbjct  445  PSHGSCLFLGS  455



>gb|ACF80565.1| unknown [Zea mays]
 tpg|DAA44126.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=469

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 3/197 (2%)
 Frame = -1

Query  907  VVVTETGWPWFG-STSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V+VTETGWP  G S+SEPDAT +NA  YN+NLIR V N TG P    + +  Y+YEL++E
Sbjct  229  VMVTETGWPHKGDSSSEPDATSDNADTYNSNLIRHVMNSTGTPKHPGVAVPTYVYELYDE  288

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN+++   +C+A+ GA    LQ  +
Sbjct  289  DTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGV-LLANDTTNQTYCVAREGADPKMLQAAL  347

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PDT+  HA+YA+N YY  +    GTC F G A  TT 
Sbjct  348  DWACGP-GKVDCSVLMQGQPCYDPDTVDAHATYAFNAYYHGMGMGSGTCYFSGVAVVTTT  406

Query  370  DPSYGSCIFTGSSNSSI  320
            DPS+GSC++ G + +S+
Sbjct  407  DPSHGSCVYAGKNGTSL  423



>gb|EEC82319.1| hypothetical protein OsI_26597 [Oryza sativa Indica Group]
Length=521

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VT +GWP  G  +E  A V+NA AYN NLIR V N++G P +    +  +I+ELFNED
Sbjct  290  VMVTASGWPSHGGQNEKAANVDNALAYNTNLIRHVLNNSGTPGQPNNQVSTFIFELFNED  349

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R GPVSE++WGI FPN + VY +     +     +    G FC+A   A  + L++ +D
Sbjct  350  LRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNTDSPVLRGTFCVANSSAPHSALKQSLD  409

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G+ANCSAIQPGQPCY  D +   ASYA+NDYY R ++ GGTC+F+ TA  T+ D
Sbjct  410  WACGP-GSANCSAIQPGQPCYKSDDIVAVASYAFNDYYHRTRASGGTCNFNSTAMVTSTD  468

Query  367  PSYGSCIF  344
            PS+GSCIF
Sbjct  469  PSHGSCIF  476



>ref|XP_011096055.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Sesamum indicum]
Length=515

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 130/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G + EP AT++NA  YN+NLI+ V + +G P   ++    YIYELFNED
Sbjct  272  VLVTETGWPSRGDSKEPYATIDNADTYNSNLIKHVFDRSGTPLHPEITSSVYIYELFNED  331

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N + VY +++ GS    +AN+++   +CIA  G     LQ  +D
Sbjct  332  LRSPPVSEANWGLFYGNTTPVYLLHVSGSGTF-LANDTTNQTYCIAADGIDAKTLQTALD  390

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPGQ CY P+ ++NHASYA++ YYQ+     G+CDF G A  TT D
Sbjct  391  WACGP-GRANCSEIQPGQSCYQPNNVKNHASYAFDSYYQKEGKSSGSCDFKGAAMITTTD  449

Query  367  PSYGSCIFTGS  335
            PS+G+CIF GS
Sbjct  450  PSHGNCIFPGS  460



>ref|XP_006649652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Oryza brachyantha]
Length=525

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 130/192 (68%), Gaps = 3/192 (2%)
 Frame = -1

Query  907  VVVTETGWPWFGS-TSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V+VTETGWP  G  ++EPDAT +NA  YN+NLIR V N TG P    + +  +IYEL++E
Sbjct  284  VMVTETGWPHKGDPSNEPDATSDNADTYNSNLIRHVMNTTGTPKHPGVAVPTFIYELYDE  343

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN+++   +C+A+ GA E  LQ  +
Sbjct  344  DTRPGSASEKYWGLFNMNGVPAYTLHLTGSGV-LLANDTTNQTYCVAREGADEKMLQAAL  402

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CSA+  GQPCY PDT+Q H++YA+N YY  +    GTC F G A  TT 
Sbjct  403  DWACGP-GKVDCSALMQGQPCYDPDTVQAHSTYAFNAYYHGMGMGSGTCYFSGVAVITTT  461

Query  370  DPSYGSCIFTGS  335
            DPS+GSC+++GS
Sbjct  462  DPSHGSCVYSGS  473



>ref|XP_010528550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Tarenaya hassleriana]
Length=500

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 137/212 (65%), Gaps = 6/212 (3%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            VVVTE+GWP  G ++EPDAT+ENA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  265  VVVTESGWPSKGDSNEPDATLENANTYNSNLIRHVLNKTGTPKRPGIAVSTYIYELYNED  324

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE++WG+F  NG  VY + L   S   +AN+++   +C A+ GA    LQ  +D
Sbjct  325  TKPGPLSEKNWGLFDANGDPVYILQL-TDSGSILANDTTNQTYCTAREGADPKMLQAALD  383

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +C  I+ G+ CY PD +  HA+YA++ YY ++ +    C+F+G A+ TT D
Sbjct  384  WACGP-GKVDCLPIKQGEACYEPDNVVAHANYAFDTYYHKMGNNPDACNFNGVASITTTD  442

Query  367  PSYGSCIFTGS----SNSSIGGVPTPAFGPTA  284
            PS+GSC+F GS     N ++  +  P+   T+
Sbjct  443  PSHGSCVFAGSRGGGRNGTLVNITAPSMNSTS  474



>ref|NP_001130376.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF78568.1| unknown [Zea mays]
 gb|ACR36311.1| unknown [Zea mays]
 tpg|DAA44125.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=502

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 130/197 (66%), Gaps = 3/197 (2%)
 Frame = -1

Query  907  VVVTETGWPWFG-STSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNE  731
            V+VTETGWP  G S+SEPDAT +NA  YN+NLIR V N TG P    + +  Y+YEL++E
Sbjct  262  VMVTETGWPHKGDSSSEPDATSDNADTYNSNLIRHVMNSTGTPKHPGVAVPTYVYELYDE  321

Query  730  DKRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGI  551
            D RPG  SE+ WG+F  NG   Y ++L GS    +AN+++   +C+A+ GA    LQ  +
Sbjct  322  DTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGV-LLANDTTNQTYCVAREGADPKMLQAAL  380

Query  550  DWACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttv  371
            DWACGP G  +CS +  GQPCY PDT+  HA+YA+N YY  +    GTC F G A  TT 
Sbjct  381  DWACGP-GKVDCSVLMQGQPCYDPDTVDAHATYAFNAYYHGMGMGSGTCYFSGVAVVTTT  439

Query  370  DPSYGSCIFTGSSNSSI  320
            DPS+GSC++ G + +S+
Sbjct  440  DPSHGSCVYAGKNGTSL  456



>gb|KJB57756.1| hypothetical protein B456_009G179400 [Gossypium raimondii]
Length=522

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 129/195 (66%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G + EP AT +NA  YN+NLI+ V + +G P   ++    YIYELFNED
Sbjct  282  VLVTESGWPSKGDSKEPYATKDNADTYNSNLIKHVLDRSGTPLHPEITSSVYIYELFNED  341

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N + VY +++ GS    +AN+++   FCIA  G     LQ  +D
Sbjct  342  LRSPPVSEANWGLFYSNSTPVYLLHVSGSGTF-LANDTTNQTFCIAMDGVDSKTLQTALD  400

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CY P+ ++NHASYA++ YYQ      G+CDF G A  TT D
Sbjct  401  WACGP-GRANCSEIQPGESCYQPNNVKNHASYAFDSYYQMEGKASGSCDFKGVAMITTTD  459

Query  367  PSYGSCIFTGSSNSS  323
            PS+GSC+F GS   S
Sbjct  460  PSHGSCVFPGSKMVS  474



>ref|XP_008365635.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1-like [Malus domestica]
Length=597

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 2/195 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+V+E+GWP  G + EP AT++NA  YN+NLI+ V + +G P   ++    YIYELFNED
Sbjct  349  VLVSESGWPSKGDSKEPYATIDNADTYNSNLIKHVLDRSGTPLHPEITSDVYIYELFNED  408

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N SAVY +++ GS +  +AN+++   +CIA  G     LQ  +D
Sbjct  409  LRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-LANDTTNQTYCIAMDGMDGKSLQAALD  467

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G ANCS IQPG+ CYSP+ +++HASYA++ YYQ+     G+CDF+G AT TT D
Sbjct  468  WACGP-GRANCSEIQPGEDCYSPNNVKSHASYAFDSYYQKQGRAAGSCDFNGVATITTTD  526

Query  367  PSYGSCIFTGSSNSS  323
            PS+GSCIF GS   S
Sbjct  527  PSHGSCIFPGSKKVS  541



>gb|KJB22745.1| hypothetical protein B456_004G064200 [Gossypium raimondii]
Length=497

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTETGWP  G + EPDAT+ENA  YN+NLIR V N TG P    + +  YIYEL+NED
Sbjct  259  VIVTETGWPSKGDSIEPDATLENANTYNSNLIRHVMNKTGTPKNPGVAVSTYIYELYNED  318

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             +PGP+SE+ WG+F  NG  VY + L GS +  ++N+++   +C A+  A    LQ  +D
Sbjct  319  MKPGPLSEKHWGLFEANGDPVYILRLTGSGS-LLSNDTTNQTYCTAKDDADPKMLQAALD  377

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G  +CS +  G+PCY PD +  HA+YA+N YY R+      CDF+G A  TT D
Sbjct  378  WACGP-GKVDCSPLLQGKPCYEPDNVIAHATYAFNTYYHRMGKTSDACDFNGVADITTTD  436

Query  367  PSYGSC  350
            PS+GSC
Sbjct  437  PSHGSC  442



>ref|XP_008224690.1| PREDICTED: glucan endo-1,3-beta-glucosidase 1 [Prunus mume]
Length=546

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP    + EP AT++NA  YN+NLI+ V + +G P   +     YIYELFNED
Sbjct  298  VLVTESGWPSKADSKEPFATIDNADTYNSNLIKHVFDRSGTPLHPETTSSVYIYELFNED  357

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N SAVY +++ GS +  +AN+++   +CIA  G     LQ  +D
Sbjct  358  LRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-LANDTTNQTYCIAMDGVDSKILQAALD  416

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G +NCS IQPGQ CYSP+ +++HASYA++ YYQ+     G+CDF G AT TT D
Sbjct  417  WACGP-GRSNCSEIQPGQDCYSPNNVKSHASYAFDSYYQKEGRAAGSCDFKGVATITTTD  475

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  476  PSHGSCIFPGS  486



>ref|XP_007211541.1| hypothetical protein PRUPE_ppa003984mg [Prunus persica]
 gb|EMJ12740.1| hypothetical protein PRUPE_ppa003984mg [Prunus persica]
Length=536

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP    + EP AT++NA  YN+NLI+ V + +G P   +     YIYELFNED
Sbjct  288  VLVTESGWPSKADSKEPFATIDNADTYNSNLIKHVFDRSGTPLHPETTSSVYIYELFNED  347

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             R  PVSE +WG+F+ N SAVY +++ GS +  +AN+++   +CIA  G     LQ  +D
Sbjct  348  LRSPPVSEANWGLFYGNSSAVYLLHVSGSGSF-LANDTTNQTYCIAMDGVDSKILQAALD  406

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACGP G +NCS IQPGQ CYSP+ +++HASYA++ YYQ+     G+CDF G AT TT D
Sbjct  407  WACGP-GRSNCSEIQPGQDCYSPNNVKSHASYAFDSYYQKEGRAAGSCDFKGVATITTTD  465

Query  367  PSYGSCIFTGS  335
            PS+GSCIF GS
Sbjct  466  PSHGSCIFPGS  476



>ref|XP_006364623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum tuberosum]
Length=499

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 129/192 (67%), Gaps = 2/192 (1%)
 Frame = -1

Query  907  VVVTETGWPWFGSTSEPDATVENAGAYNNNLIRRVSNDTGPPSELKMPIHAYIYELFNED  728
            V+VTE+GWP  G ++EPDATV+NA  YN+NLI+ V N TG P    + +  YIYEL+NED
Sbjct  262  VMVTESGWPSMGESNEPDATVDNANTYNSNLIKHVLNKTGTPKHPGIAVSTYIYELYNED  321

Query  727  KRPGPVSERSWGIFFPNGSAVYPINLGGSSAGQIANNSSAGVFCIAQPGASENKLQKGID  548
             + GP+SE++WG+F  NG+ VY + L   S    ANN+S   +C+A+ GA    LQ G+D
Sbjct  322  AKAGPLSEKNWGLFSNNGTPVYILRL-TESGSLFANNTSNQTYCVAKEGADTKMLQAGLD  380

Query  547  WACGPQGNANCSAIQPGQPCYSPDTLQNHASYAYNDYYQRVQSVggtcdfdgtattttvD  368
            WACG  G  NC+ +  G PCY PD +  HA+YA++ YY  +    GTCDF G AT TT +
Sbjct  381  WACG-TGKVNCAPLMQGGPCYDPDNVAAHATYAFDAYYHMMGKAPGTCDFTGVATITTTN  439

Query  367  PSYGSCIFTGSS  332
            PS+G+C+F+ S+
Sbjct  440  PSHGTCLFSSST  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2035318454400