BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052C15

Length=896
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010096960.1|  ABC transporter B family member 10                 489   2e-171   
emb|CDP13052.1|  unnamed protein product                                491   3e-160   Coffea canephora [robusta coffee]
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    489   3e-159   Fragaria vesca subsp. vesca
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    485   4e-158   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002304346.1|  P-glycoprotein                                     483   3e-157   Populus trichocarpa [western balsam poplar]
ref|XP_006432793.1|  hypothetical protein CICLE_v100000602mg            478   4e-157   
ref|XP_006352948.1|  PREDICTED: ABC transporter B family member 2...    483   4e-157   Solanum tuberosum [potatoes]
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    483   4e-157   
ref|XP_009764894.1|  PREDICTED: ABC transporter B family member 2...    481   1e-156   Nicotiana sylvestris
gb|KDO53161.1|  hypothetical protein CISIN_1g0008301mg                  477   2e-156   Citrus sinensis [apfelsine]
ref|XP_011028151.1|  PREDICTED: ABC transporter B family member 2...    477   2e-156   Populus euphratica
ref|XP_004245909.2|  PREDICTED: ABC transporter B family member 2...    481   2e-156   Solanum lycopersicum
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    480   4e-156   Pyrus x bretschneideri [bai li]
ref|XP_003612850.1|  ABC transporter B family member                    479   8e-156   Medicago truncatula
ref|XP_011028150.1|  PREDICTED: ABC transporter B family member 2...    477   4e-155   Populus euphratica
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    477   5e-155   Citrus sinensis [apfelsine]
gb|KHN38940.1|  ABC transporter B family member 2                       476   8e-155   Glycine soja [wild soybean]
gb|KHN04865.1|  ABC transporter B family member 2                       476   9e-155   Glycine soja [wild soybean]
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    476   9e-155   Glycine max [soybeans]
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                476   2e-154   Erythranthe guttata [common monkey flower]
gb|KJB51627.1|  hypothetical protein B456_008G225400                    476   2e-154   Gossypium raimondii
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    475   2e-154   Glycine max [soybeans]
ref|XP_007040641.1|  Multidrug/pheromone exporter, MDR family, AB...    475   2e-154   
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    474   4e-154   Cicer arietinum [garbanzo]
ref|XP_002299180.2|  P-glycoprotein                                     475   7e-154   
ref|XP_008238211.1|  PREDICTED: ABC transporter B family member 2...    474   9e-154   Prunus mume [ume]
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             471   1e-152   Prunus persica
gb|KHN30010.1|  ABC transporter B family member 2                       471   1e-152   Glycine soja [wild soybean]
ref|XP_006585887.1|  PREDICTED: ABC transporter B family member 2...    471   1e-152   Glycine max [soybeans]
gb|EPS64351.1|  hypothetical protein M569_10429                         470   2e-152   Genlisea aurea
ref|XP_011018527.1|  PREDICTED: ABC transporter B family member 2...    469   2e-152   Populus euphratica
ref|XP_011018526.1|  PREDICTED: ABC transporter B family member 2...    468   1e-151   Populus euphratica
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             466   7e-151   Phaseolus vulgaris [French bean]
ref|XP_011082358.1|  PREDICTED: ABC transporter B family member 2...    463   2e-149   Sesamum indicum [beniseed]
gb|KDP36504.1|  hypothetical protein JCGZ_09330                         459   5e-149   Jatropha curcas
ref|NP_172538.1|  ABC transporter B family member 10                    459   4e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010055296.1|  PREDICTED: ABC transporter B family member 2...    454   7e-148   
ref|XP_010274280.1|  PREDICTED: ABC transporter B family member 2...    454   2e-147   Nelumbo nucifera [Indian lotus]
gb|AAF17668.1|AC009398_17  F20B24.12                                    458   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002277547.1|  PREDICTED: ABC transporter B family member 2       457   3e-147   Vitis vinifera
gb|AAF23176.1|AF216497_1  P-glycoprotein                                456   3e-147   Gossypium hirsutum [American cotton]
ref|XP_010055295.1|  PREDICTED: ABC transporter B family member 2...    454   4e-147   
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    455   7e-147   Camelina sativa [gold-of-pleasure]
gb|KJB21121.1|  hypothetical protein B456_003G183800                    456   1e-146   Gossypium raimondii
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      454   1e-146   Camelina sativa [gold-of-pleasure]
ref|XP_008800115.1|  PREDICTED: ABC transporter B family member 2...    455   2e-146   Phoenix dactylifera
ref|XP_009595706.1|  PREDICTED: ABC transporter B family member 2...    454   3e-146   Nicotiana tomentosiformis
emb|CDY37953.1|  BnaC05g08210D                                          453   3e-146   Brassica napus [oilseed rape]
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             454   4e-146   Eutrema salsugineum [saltwater cress]
ref|XP_010274279.1|  PREDICTED: ABC transporter B family member 2...    454   4e-146   Nelumbo nucifera [Indian lotus]
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             453   4e-146   Capsella rubella
ref|XP_004165322.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    451   5e-146   
ref|XP_010055294.1|  PREDICTED: ABC transporter B family member 2...    453   5e-146   Eucalyptus grandis [rose gum]
dbj|BAD07905.1|  putative MDR-like ABC transporter                      437   9e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    452   2e-145   Tarenaya hassleriana [spider flower]
ref|XP_004136398.1|  PREDICTED: ABC transporter B family member 2...    451   3e-145   
ref|XP_007156412.1|  hypothetical protein PHAVU_003G283900g             451   4e-145   Phaseolus vulgaris [French bean]
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       451   4e-145   Cucumis sativus [cucumbers]
gb|KJB21124.1|  hypothetical protein B456_003G183800                    451   6e-145   Gossypium raimondii
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    450   6e-145   Cucumis melo [Oriental melon]
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    450   7e-145   Arabis alpina [alpine rockcress]
ref|XP_010240898.1|  PREDICTED: ABC transporter B family member 2...    450   1e-144   Nelumbo nucifera [Indian lotus]
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             449   2e-144   Eutrema salsugineum [saltwater cress]
ref|XP_010436379.1|  PREDICTED: ABC transporter B family member 2       449   2e-144   
ref|XP_002869639.1|  multidrug resistance protein 2                     449   3e-144   
emb|CDX94395.1|  BnaC01g17890D                                          448   3e-144   
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             448   4e-144   
gb|AAM20507.1|  P-glycoprotein-2                                        447   6e-144   Arabidopsis thaliana [mouse-ear cress]
emb|CAA71277.1|  P-glycoprotein-2                                       447   6e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018531.1|  PREDICTED: ABC transporter B family member 2...    443   1e-143   Populus euphratica
ref|NP_194326.2|  P-glycoprotein 2                                      448   1e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    446   1e-143   Camelina sativa [gold-of-pleasure]
ref|XP_006368377.1|  P-glycoprotein                                     446   2e-143   
emb|CDX93393.1|  BnaA06g06550D                                          446   3e-143   
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    446   4e-143   Phoenix dactylifera
ref|XP_002892589.1|  P-glycoprotein 10                                  445   5e-143   Arabidopsis lyrata subsp. lyrata
ref|XP_011018530.1|  PREDICTED: ABC transporter B family member 2...    444   5e-143   Populus euphratica
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      445   6e-143   Brassica rapa
emb|CDX89380.1|  BnaA01g15130D                                          446   8e-143   
ref|XP_011018529.1|  PREDICTED: ABC transporter B family member 2...    444   2e-142   Populus euphratica
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       444   2e-142   Brassica rapa
ref|XP_009396844.1|  PREDICTED: ABC transporter B family member 2...    442   6e-142   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    441   1e-141   Arabis alpina [alpine rockcress]
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    441   2e-141   Elaeis guineensis
ref|XP_003572841.1|  PREDICTED: ABC transporter B family member 2...    441   5e-141   Brachypodium distachyon [annual false brome]
gb|EEC73824.1|  hypothetical protein OsI_08549                          437   1e-139   Oryza sativa Indica Group [Indian rice]
ref|NP_001047803.1|  Os02g0693700                                       437   1e-139   
gb|AET03262.2|  ABC transporter B family protein                        424   2e-139   Medicago truncatula
ref|XP_006647720.1|  PREDICTED: ABC transporter B family member 2...    436   2e-139   Oryza brachyantha
gb|EMT33461.1|  ABC transporter B family member 2                       437   2e-139   
gb|EMS51604.1|  ABC transporter B family member 2                       434   4e-139   Triticum urartu
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    433   2e-138   Elaeis guineensis
ref|XP_004509739.1|  PREDICTED: ABC transporter B family member 2...    431   2e-138   
ref|XP_004509738.1|  PREDICTED: ABC transporter B family member 2...    431   1e-137   Cicer arietinum [garbanzo]
emb|CDY42770.1|  BnaA03g47690D                                          428   3e-137   Brassica napus [oilseed rape]
ref|XP_003628786.1|  ABC transporter B family member                    421   4e-137   
ref|XP_006854029.1|  hypothetical protein AMTR_s00048p00046670          430   5e-137   Amborella trichopoda
ref|XP_009137566.1|  PREDICTED: ABC transporter B family member 2...    426   8e-136   Brassica rapa
ref|XP_010538383.1|  PREDICTED: ABC transporter B family member 2...    426   2e-135   Tarenaya hassleriana [spider flower]
emb|CDX92739.1|  BnaC07g39970D                                          422   2e-134   
ref|NP_001130840.1|  uncharacterized protein LOC100191944               406   3e-133   
ref|XP_002452712.1|  hypothetical protein SORBIDRAFT_04g031170          416   9e-132   Sorghum bicolor [broomcorn]
gb|ABG75919.1|  MDR-like ABC transporter                                416   1e-131   Ginkgo biloba [ginkgo]
ref|XP_004953524.1|  PREDICTED: ABC transporter B family member 2...    413   9e-131   Setaria italica
ref|XP_008676453.1|  PREDICTED: uncharacterized protein LOC100191...    405   9e-128   
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    398   4e-125   
ref|XP_004167222.1|  PREDICTED: ABC transporter B family member 1...    375   6e-125   
dbj|BAF01897.1|  putative P-glycoprotein                                381   1e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KJB21123.1|  hypothetical protein B456_003G183800                    393   2e-123   Gossypium raimondii
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3       388   1e-121   
gb|KHG20565.1|  ABC transporter B family member 19                      389   1e-121   Gossypium arboreum [tree cotton]
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1       388   2e-121   
gb|ABX82929.1|  LO4                                                     388   3e-121   Solanum pennellii
ref|NP_001234209.1|  L04                                                387   3e-121   Solanum lycopersicum
ref|XP_006603863.1|  PREDICTED: ABC transporter B family member 1...    384   4e-121   
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      387   5e-121   Populus euphratica
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581             387   6e-121   
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                387   7e-121   Populus trichocarpa [western balsam poplar]
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        387   9e-121   Ricinus communis
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      386   9e-121   Elaeis guineensis
gb|KJB33610.1|  hypothetical protein B456_006G021600                    384   2e-120   Gossypium raimondii
ref|XP_002969904.1|  ATP-binding cassette transporter                   385   2e-120   
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      385   2e-120   Prunus mume [ume]
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...    385   2e-120   Solanum tuberosum [potatoes]
gb|KHN45492.1|  ABC transporter B family member 19                      384   3e-120   Glycine soja [wild soybean]
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    385   4e-120   Tarenaya hassleriana [spider flower]
ref|XP_002965566.1|  ATP-binding cassette transporter                   384   5e-120   
ref|XP_002877137.1|  P-glycoprotein 19                                  384   5e-120   Arabidopsis lyrata subsp. lyrata
gb|AIU41631.1|  ABC transporter family protein                          384   5e-120   Hevea brasiliensis [jebe]
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    384   6e-120   
gb|KJB11390.1|  hypothetical protein B456_001G256100                    384   7e-120   Gossypium raimondii
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    384   7e-120   Glycine max [soybeans]
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             384   7e-120   
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    384   9e-120   Cicer arietinum [garbanzo]
gb|KJB33609.1|  hypothetical protein B456_006G021600                    384   1e-119   Gossypium raimondii
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 19      383   1e-119   Fragaria vesca subsp. vesca
ref|XP_006593671.1|  PREDICTED: ABC transporter B family member 1...    380   1e-119   Glycine max [soybeans]
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             383   2e-119   Prunus persica
gb|KHG22495.1|  ABC transporter B family member 19                      382   3e-119   Gossypium arboreum [tree cotton]
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             382   3e-119   Capsella rubella
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      382   4e-119   Tarenaya hassleriana [spider flower]
gb|KEH24996.1|  ABC transporter B family protein                        382   4e-119   Medicago truncatula
ref|XP_002973102.1|  ATP-binding cassette transporter                   381   5e-119   
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      382   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    382   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      382   5e-119   Pyrus x bretschneideri [bai li]
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        381   8e-119   Lactuca sativa [cultivated lettuce]
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      381   8e-119   
ref|NP_189528.1|  ABC transporter B family member 19                    381   8e-119   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                    381   9e-119   Arabis alpina [alpine rockcress]
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             381   1e-118   Eutrema salsugineum [saltwater cress]
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         381   1e-118   Jatropha curcas
emb|CDY65012.1|  BnaCnng45670D                                          381   1e-118   Brassica napus [oilseed rape]
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    380   1e-118   Glycine max [soybeans]
emb|CDY00109.1|  BnaC09g01920D                                          380   1e-118   
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             381   2e-118   
gb|EYU34087.1|  hypothetical protein MIMGU_mgv1a000781mg                375   2e-118   Erythranthe guttata [common monkey flower]
emb|CDY20012.1|  BnaA09g02390D                                          380   2e-118   Brassica napus [oilseed rape]
emb|CDX86408.1|  BnaA06g31250D                                          380   3e-118   
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    380   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19      380   3e-118   Phoenix dactylifera
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19      380   3e-118   Brassica rapa
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      379   4e-118   Nelumbo nucifera [Indian lotus]
gb|AFW59635.1|  hypothetical protein ZEAMMB73_350646                    368   4e-118   
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...    379   5e-118   Brassica rapa
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      379   5e-118   Sesamum indicum [beniseed]
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19      379   6e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010552958.1|  PREDICTED: ABC transporter B family member 1...    376   6e-118   
emb|CDP02220.1|  unnamed protein product                                379   7e-118   Coffea canephora [robusta coffee]
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...    378   1e-117   
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      378   1e-117   Eucalyptus grandis [rose gum]
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     378   2e-117   Eucalyptus grandis [rose gum]
gb|AFW58472.1|  hypothetical protein ZEAMMB73_248443                    369   2e-117   
ref|XP_010108971.1|  ABC transporter B family member 19                 377   2e-117   Morus notabilis
dbj|BAC41846.1|  putative P-glycoprotein                                377   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...    377   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN28720.2|  MDR-like p-glycoprotein                                 377   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579371.1|  PREDICTED: ABC transporter B family member 1...    377   4e-117   Brachypodium distachyon [annual false brome]
dbj|BAG96130.1|  unnamed protein product                                372   4e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...    376   5e-117   Tarenaya hassleriana [spider flower]
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      375   1e-116   Cucumis melo [Oriental melon]
dbj|BAK05967.1|  predicted protein                                      375   1e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    375   1e-116   
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      375   2e-116   Vitis vinifera
gb|EPS61919.1|  hypothetical protein M569_12874                         373   2e-116   Genlisea aurea
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    375   2e-116   Brachypodium distachyon [annual false brome]
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608             374   2e-116   
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             374   3e-116   Phaseolus vulgaris [French bean]
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19      374   3e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       375   6e-116   Cucumis sativus [cucumbers]
dbj|BAJ96840.1|  predicted protein                                      373   1e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC77398.1|  hypothetical protein OsI_16157                          372   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_008804466.1|  PREDICTED: ABC transporter B family member 1...    367   1e-115   
emb|CAD59581.1|  MDR-like ABC transporter                               372   1e-115   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40903.1|  OSJNBa0036B21.21                                       372   1e-115   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052982.1|  Os04g0459000                                       372   2e-115   
gb|EMT32511.1|  ABC transporter B family member 19                      372   2e-115   
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...    372   2e-115   Sesamum indicum [beniseed]
ref|XP_004173903.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    358   7e-115   
gb|AFW59636.1|  hypothetical protein ZEAMMB73_350646                    368   1e-114   
tpg|DAA35747.1|  TPA: hypothetical protein ZEAMMB73_634725              365   2e-114   
gb|KDO72552.1|  hypothetical protein CISIN_1g000856mg                   365   2e-114   Citrus sinensis [apfelsine]
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    369   3e-114   Setaria italica
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          369   4e-114   Sorghum bicolor [broomcorn]
ref|NP_001169660.1|  uncharacterized protein LOC100383541               369   5e-114   Zea mays [maize]
ref|XP_002448624.1|  hypothetical protein SORBIDRAFT_06g030350          368   5e-114   Sorghum bicolor [broomcorn]
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...    368   6e-114   
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    368   7e-114   Oryza brachyantha
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1       369   7e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      368   7e-114   Nicotiana sylvestris
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      368   8e-114   Nicotiana tomentosiformis
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    367   9e-114   Elaeis guineensis
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    367   1e-113   Phoenix dactylifera
dbj|BAF02132.1|  putative ABC transporter                               358   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...    367   2e-113   Nelumbo nucifera [Indian lotus]
gb|EAZ32166.1|  hypothetical protein OsJ_16371                          366   2e-113   Oryza sativa Japonica Group [Japonica rice]
emb|CAD59582.1|  MDR-like ABC transporter                               366   4e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg             365   5e-113   Citrus clementina [clementine]
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...    367   5e-113   
emb|CAC09461.2|  H0423H10.7                                             366   5e-113   Oryza sativa [red rice]
ref|XP_004977001.1|  PREDICTED: ABC transporter B family member 1...    365   6e-113   Setaria italica
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg             367   6e-113   Prunus persica
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...    365   8e-113   Zea mays [maize]
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    365   9e-113   
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1       366   9e-113   Pyrus x bretschneideri [bai li]
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1       366   9e-113   
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...    365   9e-113   Citrus sinensis [apfelsine]
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                   365   1e-112   Citrus sinensis [apfelsine]
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...    366   1e-112   Pyrus x bretschneideri [bai li]
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    364   1e-112   
ref|XP_002994484.1|  hypothetical protein SELMODRAFT_138662             364   1e-112   
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1       365   1e-112   Pyrus x bretschneideri [bai li]
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...    365   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    364   2e-112   
ref|XP_002969903.1|  ATP-binding cassette transporter                   362   6e-112   
gb|EMS56432.1|  ABC transporter B family member 19                      363   6e-112   Triticum urartu
gb|KHN09525.1|  ABC transporter B family member 1                       363   6e-112   Glycine soja [wild soybean]
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative        363   8e-112   Ricinus communis
gb|KJB36509.1|  hypothetical protein B456_006G163000                    363   9e-112   Gossypium raimondii
gb|KGN58980.1|  Multidrug resistance protein 1, 2                       363   1e-111   Cucumis sativus [cucumbers]
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...    363   1e-111   
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...    363   1e-111   Glycine max [soybeans]
gb|KDO84909.1|  hypothetical protein CISIN_1g000851mg                   359   2e-111   Citrus sinensis [apfelsine]
ref|XP_004304461.2|  PREDICTED: ABC transporter B family member 1       362   2e-111   Fragaria vesca subsp. vesca
ref|XP_006473688.1|  PREDICTED: ABC transporter B family member 1...    357   3e-111   Citrus sinensis [apfelsine]
gb|AIU41628.1|  ABC transporter family protein                          362   3e-111   Hevea brasiliensis [jebe]
ref|XP_011034998.1|  PREDICTED: ABC transporter B family member 1...    357   3e-111   Populus euphratica
ref|XP_007027421.1|  ATP binding cassette subfamily B1 isoform 3        360   3e-111   
gb|AFW66244.1|  hypothetical protein ZEAMMB73_446753                    352   3e-111   
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1       362   3e-111   Vitis vinifera
gb|KHN02316.1|  ABC transporter B family member 1                       361   5e-111   Glycine soja [wild soybean]
gb|AES81895.2|  ABC transporter B family protein                        361   5e-111   Medicago truncatula
gb|KDP29159.1|  hypothetical protein JCGZ_16548                         361   6e-111   Jatropha curcas
ref|XP_008347376.1|  PREDICTED: ABC transporter B family member 1...    339   1e-110   
gb|KHG30028.1|  ABC transporter B family member 1                       360   1e-110   Gossypium arboreum [tree cotton]
ref|XP_002323485.2|  P glycoprotein1                                    360   1e-110   
gb|KJB16771.1|  hypothetical protein B456_002G246800                    360   1e-110   Gossypium raimondii
ref|XP_002986365.1|  ATP-binding cassette transporter                   359   2e-110   Selaginella moellendorffii
ref|XP_001782700.1|  ATP-binding cassette transporter, subfamily ...    358   2e-110   
ref|XP_010101619.1|  ABC transporter B family member 1                  360   3e-110   
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             358   3e-110   Citrus clementina [clementine]
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   358   3e-110   Citrus sinensis [apfelsine]
ref|XP_007027420.1|  ATP binding cassette subfamily B1 isoform 2        359   3e-110   
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    358   3e-110   Vitis vinifera
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079             358   3e-110   Selaginella moellendorffii
gb|KHG25987.1|  ABC transporter B family member 1                       358   4e-110   Gossypium arboreum [tree cotton]
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1        359   4e-110   
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    357   4e-110   Populus euphratica
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g             358   5e-110   Phaseolus vulgaris [French bean]
gb|EMT10010.1|  Putative multidrug resistance protein                   347   6e-110   
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1       358   7e-110   
ref|XP_001784237.1|  ATP-binding cassette transporter, subfamily ...    357   7e-110   
ref|NP_001275319.1|  P-glycoprotein                                     358   7e-110   Solanum tuberosum [potatoes]
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...    358   7e-110   Nicotiana sylvestris
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1       358   7e-110   Nicotiana tomentosiformis
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    357   8e-110   Citrus sinensis [apfelsine]
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...    357   8e-110   Eucalyptus grandis [rose gum]
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                356   1e-109   
ref|NP_181228.1|  ABC transporter B family member 1                     357   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879630.1|  ATPGP1                                             357   1e-109   
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...    357   2e-109   
emb|CDP06775.1|  unnamed protein product                                355   2e-109   
emb|CAN71068.1|  hypothetical protein VITISV_031708                     357   2e-109   
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1       357   2e-109   
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg             357   2e-109   
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             356   2e-109   
ref|XP_006381407.1|  P glycoprotein1                                    357   2e-109   
ref|NP_001046147.2|  Os02g0190000                                       345   3e-109   
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    356   3e-109   
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1       356   3e-109   
gb|KEH42187.1|  ABC transporter B family protein                        356   4e-109   
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1       356   4e-109   
gb|EEE56476.1|  hypothetical protein OsJ_05696                          354   5e-109   
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...    355   6e-109   
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       355   6e-109   
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...    355   7e-109   
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180          354   9e-109   
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g             355   9e-109   
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    355   9e-109   
sp|Q6YUU5.1|MDR_ORYSJ  RecName: Full=Putative multidrug resistanc...    354   1e-108   
gb|AAM98246.1|  putative ABC transporter                                354   1e-108   
ref|XP_004951620.1|  PREDICTED: putative multidrug resistance pro...    353   1e-108   
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg             354   1e-108   
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...    355   1e-108   
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                   354   2e-108   
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                   354   2e-108   
ref|XP_009398790.1|  PREDICTED: putative multidrug resistance pro...    338   2e-108   
ref|NP_001288986.1|  ABC transporter B family member 1                  353   3e-108   
ref|XP_002453447.1|  hypothetical protein SORBIDRAFT_04g006100          352   3e-108   
ref|XP_006647008.1|  PREDICTED: LOW QUALITY PROTEIN: putative mul...    352   3e-108   
ref|XP_008466472.1|  PREDICTED: ABC transporter B family member 1...    327   3e-108   
ref|XP_008679898.1|  PREDICTED: putative multidrug resistance pro...    352   4e-108   
ref|XP_002983357.1|  hypothetical protein SELMODRAFT_117838             353   4e-108   
ref|XP_002962569.1|  ATP-binding cassette transporter                   353   4e-108   
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310          352   4e-108   
gb|KHN39060.1|  ABC transporter B family member 1                       352   6e-108   
ref|XP_004954680.1|  PREDICTED: putative multidrug resistance pro...    352   6e-108   
ref|XP_004952829.1|  PREDICTED: putative multidrug resistance pro...    351   9e-108   
emb|CDY46744.1|  BnaA03g16880D                                          352   1e-107   
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       352   1e-107   
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...    352   1e-107   
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...    352   1e-107   
dbj|BAJ53110.1|  JHL20J20.17                                            349   1e-107   
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...    352   1e-107   
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       352   1e-107   
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       350   1e-107   
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    350   1e-107   
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...    352   1e-107   
emb|CDX79704.1|  BnaC03g20400D                                          352   2e-107   
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...    350   2e-107   
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    350   2e-107   
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        350   2e-107   
gb|EEC72653.1|  hypothetical protein OsI_06178                          348   3e-107   
gb|EEC72650.1|  hypothetical protein OsI_06174                          332   4e-107   
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    349   5e-107   
tpg|DAA57982.1|  TPA: hypothetical protein ZEAMMB73_959488              327   5e-107   
gb|KDP36900.1|  hypothetical protein JCGZ_08191                         348   6e-107   
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    349   6e-107   
ref|XP_002893495.1|  P-glycoprotein 13                                  348   8e-107   
gb|AIU41630.1|  ABC transporter family protein                          346   2e-106   
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...    348   2e-106   
gb|KCW56142.1|  hypothetical protein EUGRSUZ_I01894                     328   2e-106   
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...    347   2e-106   
ref|XP_006471185.1|  PREDICTED: ABC transporter B family member 2...    333   2e-106   
gb|KHN12634.1|  ABC transporter B family member 13                      347   3e-106   
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    347   3e-106   
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             346   6e-106   
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             346   8e-106   
ref|XP_001766529.1|  ATP-binding cassette transporter, subfamily ...    344   9e-106   
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1       347   1e-105   
ref|XP_010439807.1|  PREDICTED: ABC transporter B family member 1...    344   1e-105   
gb|KHN48276.1|  ABC transporter B family member 1                       345   1e-105   
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    345   1e-105   
gb|EEE56475.1|  hypothetical protein OsJ_05694                          345   1e-105   
ref|XP_004958185.1|  PREDICTED: putative multidrug resistance pro...    345   1e-105   
dbj|BAJ94109.1|  predicted protein                                      343   2e-105   
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...    345   2e-105   
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...    345   2e-105   
gb|KDO72403.1|  hypothetical protein CISIN_1g0408752mg                  332   2e-105   
ref|XP_010033242.1|  PREDICTED: ABC transporter B family member 1...    345   2e-105   
ref|NP_001132781.1|  uncharacterized protein LOC100194270               321   2e-105   
gb|KCW52827.1|  hypothetical protein EUGRSUZ_J02160                     344   3e-105   
ref|XP_006341813.1|  PREDICTED: ABC transporter B family member 1...    344   3e-105   
emb|CDY20020.1|  BnaA09g02310D                                          343   4e-105   
gb|KDP28338.1|  hypothetical protein JCGZ_14109                         335   4e-105   
dbj|BAJ99881.1|  predicted protein                                      343   5e-105   
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...    343   5e-105   
gb|KDP28018.1|  hypothetical protein JCGZ_19098                         320   6e-105   
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...    343   6e-105   
gb|KDO72405.1|  hypothetical protein CISIN_1g006496mg                   331   6e-105   
emb|CAN63836.1|  hypothetical protein VITISV_036111                     335   8e-105   
ref|XP_003571049.1|  PREDICTED: putative multidrug resistance pro...    343   8e-105   
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1       344   8e-105   
ref|NP_001046144.1|  Os02g0189800                                       333   9e-105   
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg             343   1e-104   
emb|CAN81148.1|  hypothetical protein VITISV_020814                     323   1e-104   
emb|CDP07374.1|  unnamed protein product                                343   1e-104   
ref|XP_004239490.1|  PREDICTED: ABC transporter B family member 1...    343   1e-104   
ref|NP_001054584.1|  Os05g0137200                                       322   1e-104   
ref|XP_004173442.1|  PREDICTED: ABC transporter B family member 1...    331   2e-104   
gb|EPS59910.1|  hypothetical protein M569_14895                         323   3e-104   
emb|CDY13118.1|  BnaA09g16990D                                          338   5e-104   
gb|KDO53163.1|  hypothetical protein CISIN_1g0008301mg                  330   5e-104   
gb|EYU38561.1|  hypothetical protein MIMGU_mgv1a000268mg                342   6e-104   
ref|NP_174115.1|  ABC transporter B family member 13                    341   6e-104   
gb|KJB21122.1|  hypothetical protein B456_003G183800                    336   7e-104   
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    341   7e-104   
ref|XP_009413182.1|  PREDICTED: putative multidrug resistance pro...    338   8e-104   
ref|XP_004170679.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    336   8e-104   
gb|ADZ48235.1|  multidrug/pheromone exporter protein                    340   8e-104   
ref|XP_003618401.1|  ABC transporter B family member                    323   9e-104   
gb|EMT27767.1|  ABC transporter B family member 4                       340   9e-104   
gb|EFA81848.1|  ABC transporter B family protein                        341   1e-103   
dbj|BAJ94394.1|  predicted protein                                      320   1e-103   
ref|XP_010241472.1|  PREDICTED: ABC transporter B family member 1...    331   1e-103   
gb|KJB11429.1|  hypothetical protein B456_001G258500                    340   1e-103   
ref|XP_011035776.1|  PREDICTED: ABC transporter B family member 1...    340   1e-103   
dbj|GAM28104.1|  hypothetical protein SAMD00019534_112800               341   1e-103   
ref|XP_010670369.1|  PREDICTED: ABC transporter B family member 1...    340   1e-103   
gb|EMS46445.1|  ABC transporter B family member 4                       340   1e-103   
gb|KHN39417.1|  ABC transporter B family member 13                      339   2e-103   
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    339   2e-103   
ref|XP_002517423.1|  multidrug resistance protein 1, 2, putative        328   2e-103   
gb|KHN19193.1|  ABC transporter B family member 15                      330   2e-103   
ref|XP_008779540.1|  PREDICTED: putative multidrug resistance pro...    339   2e-103   
ref|XP_009111595.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    339   2e-103   
gb|KHG27894.1|  ABC transporter B family member 15                      339   2e-103   
emb|CDM83826.1|  unnamed protein product                                338   2e-103   
ref|XP_011459839.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    340   2e-103   
ref|XP_007017851.1|  P-glycoprotein 13                                  339   2e-103   
ref|XP_007151162.1|  hypothetical protein PHAVU_004G023100g             339   3e-103   
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    340   3e-103   
ref|XP_010660995.1|  PREDICTED: ABC transporter B family member 1...    337   5e-103   
ref|XP_003625677.1|  ABC transporter-like protein                       327   6e-103   
ref|XP_009413177.1|  PREDICTED: putative multidrug resistance pro...    338   7e-103   
ref|XP_003633838.1|  PREDICTED: ABC transporter B family member 1...    338   8e-103   
gb|EYU46633.1|  hypothetical protein MIMGU_mgv1a024403mg                336   8e-103   
ref|XP_011098546.1|  PREDICTED: ABC transporter B family member 1...    338   8e-103   
dbj|BAJ99824.1|  predicted protein                                      338   9e-103   
emb|CDY00133.1|  BnaC09g01680D                                          337   9e-103   
ref|NP_001054045.1|  Os04g0642000                                       325   9e-103   
ref|XP_009113936.1|  PREDICTED: ABC transporter B family member 2...    337   1e-102   
emb|CDP02174.1|  unnamed protein product                                337   1e-102   
gb|AES59767.2|  ABC transporter B family protein                        337   1e-102   
ref|XP_002960513.1|  ATP-binding cassette transporter                   338   1e-102   
ref|XP_010042764.1|  PREDICTED: ABC transporter B family member 1...    326   1e-102   
gb|KDP28337.1|  hypothetical protein JCGZ_14108                         337   1e-102   
ref|XP_004494063.1|  PREDICTED: ABC transporter B family member 1...    337   1e-102   
ref|XP_010942174.1|  PREDICTED: putative multidrug resistance pro...    337   2e-102   
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...    337   2e-102   
gb|KCW46763.1|  hypothetical protein EUGRSUZ_K00570                     334   2e-102   
ref|XP_003589516.1|  ABC transporter B family member                    337   2e-102   
ref|XP_004489352.1|  PREDICTED: ABC transporter B family member 1...    337   2e-102   
ref|XP_004142341.1|  PREDICTED: ABC transporter B family member 1...    337   2e-102   
ref|XP_002323866.1|  ABC transporter family protein                     336   2e-102   
ref|XP_003567026.1|  PREDICTED: ABC transporter B family member 4...    336   3e-102   
ref|XP_011466258.1|  PREDICTED: ABC transporter B family member 1...    336   3e-102   
ref|XP_010241454.1|  PREDICTED: ABC transporter B family member 1...    337   3e-102   
ref|XP_002527657.1|  multidrug resistance protein 1, 2, putative        335   3e-102   
ref|XP_010232190.1|  PREDICTED: ABC transporter B family member 4...    336   3e-102   
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    336   3e-102   
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...    337   3e-102   
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g             336   3e-102   
ref|XP_008230690.1|  PREDICTED: ABC transporter B family member 1...    336   4e-102   
ref|XP_002515184.1|  multidrug resistance protein 1, 2, putative        336   4e-102   
ref|XP_003601883.1|  ABC transporter B family member                    335   4e-102   
ref|XP_002967209.1|  hypothetical protein SELMODRAFT_86998              336   4e-102   
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                    335   4e-102   
ref|XP_002445666.1|  hypothetical protein SORBIDRAFT_07g023730          338   4e-102   
ref|XP_008458712.1|  PREDICTED: ABC transporter B family member 1...    335   4e-102   
ref|XP_009621573.1|  PREDICTED: putative multidrug resistance pro...    331   4e-102   
ref|XP_007163242.1|  hypothetical protein PHAVU_001G218000g             336   5e-102   
ref|XP_010544933.1|  PREDICTED: ABC transporter B family member 2...    336   5e-102   
gb|KDO53162.1|  hypothetical protein CISIN_1g0008301mg                  330   5e-102   
ref|XP_006392796.1|  hypothetical protein EUTSA_v10011187mg             335   5e-102   
ref|XP_009793196.1|  PREDICTED: putative multidrug resistance pro...    335   6e-102   
ref|XP_006375419.1|  multidrug resistant ABC transporter family p...    336   6e-102   
ref|XP_009413168.1|  PREDICTED: putative multidrug resistance pro...    335   6e-102   
ref|XP_007217654.1|  hypothetical protein PRUPE_ppa000356mg             335   6e-102   
ref|XP_010552465.1|  PREDICTED: ABC transporter B family member 1...    335   6e-102   
ref|NP_189480.1|  ABC transporter B family member 18                    335   7e-102   
ref|XP_011040312.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    334   7e-102   
ref|XP_007021040.1|  Multidrug/pheromone exporter, MDR family, AB...    335   8e-102   
gb|AES72134.2|  multidrug resistance-associated protein ABC domai...    335   8e-102   
ref|XP_010035396.1|  PREDICTED: ABC transporter B family member 4...    334   9e-102   
dbj|BAG91391.1|  unnamed protein product                                323   9e-102   
ref|XP_008810360.1|  PREDICTED: ABC transporter B family member 4...    330   1e-101   
gb|KCW46762.1|  hypothetical protein EUGRSUZ_K00570                     334   1e-101   
gb|EPS73347.1|  hypothetical protein M569_01408                         334   1e-101   
ref|XP_004310162.1|  PREDICTED: putative multidrug resistance pro...    334   1e-101   
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    335   1e-101   
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...    335   1e-101   
ref|XP_010255510.1|  PREDICTED: ABC transporter B family member 1...    334   2e-101   
gb|EAY75483.1|  hypothetical protein OsI_03383                          334   2e-101   
ref|XP_010035392.1|  PREDICTED: ABC transporter B family member 4...    334   2e-101   
ref|XP_006644563.1|  PREDICTED: ABC transporter B family member 4...    333   2e-101   
gb|KJB81830.1|  hypothetical protein B456_013G163700                    334   2e-101   
ref|XP_002301547.1|  multidrug resistant ABC transporter family p...    333   2e-101   
ref|NP_001043963.1|  Os01g0695800                                       310   2e-101   
ref|XP_003618400.1|  ABC transporter B family member                    325   2e-101   
ref|XP_007040642.1|  Multidrug/pheromone exporter, MDR family, AB...    332   2e-101   
gb|KJB33695.1|  hypothetical protein B456_006G026800                    334   2e-101   
ref|XP_010091424.1|  ABC transporter B family member 11                 334   2e-101   
dbj|BAD12940.1|  putative P-glycoprotein 1                              334   2e-101   
ref|XP_006386686.1|  hypothetical protein POPTR_0002s18860g             333   2e-101   
gb|ACA51872.1|  CM800                                                   309   2e-101   
ref|XP_010523879.1|  PREDICTED: ABC transporter B family member 4...    333   3e-101   
ref|XP_010666235.1|  PREDICTED: ABC transporter B family member 1...    333   3e-101   
emb|CDY18472.1|  BnaA04g21150D                                          327   3e-101   
ref|XP_003618412.1|  ABC transporter B family member                    333   3e-101   
gb|AES74630.2|  ABC transporter B family protein                        333   3e-101   
dbj|BAF00235.1|  P-glycoprotein                                         328   3e-101   
gb|EYU46880.1|  hypothetical protein MIMGU_mgv1a000319mg                333   3e-101   
emb|CDY67695.1|  BnaCnng55980D                                          331   3e-101   
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...    333   3e-101   
gb|EPS59348.1|  p-glycoprotein                                          329   3e-101   
ref|XP_009590357.1|  PREDICTED: ABC transporter B family member 1...    333   3e-101   
ref|XP_629966.1|  ABC transporter B family protein                      334   3e-101   
ref|XP_002877104.1|  P-glycoprotein 18                                  332   4e-101   
gb|EMS51757.1|  ABC transporter B family member 11                      333   4e-101   



>ref|XP_010096960.1| ABC transporter B family member 10 [Morus notabilis]
 gb|EXB66537.1| ABC transporter B family member 10 [Morus notabilis]
Length=315

 Score =   489 bits (1260),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 256/268 (96%), Gaps = 0/268 (0%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            QMVASVFEVLDRKTE+  D GE+L  V+GTIELRD++F YPSRP+  IFKDFN++VR GK
Sbjct  40   QMVASVFEVLDRKTEVSGDTGEDLTTVDGTIELRDIKFCYPSRPEVVIFKDFNLKVRSGK  99

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            SMALVGQSGSGKSSVISLILRFYDP +GKV+IDGKDIK LK+KSLRKHIGLVQQEPALFA
Sbjct  100  SMALVGQSGSGKSSVISLILRFYDPTAGKVLIDGKDIKRLKIKSLRKHIGLVQQEPALFA  159

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            T+IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  160  TTIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQRQRVAI  219

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLKNPEILLLDEATSALDVESER+VQQALDRLMK+RT+V+VAHRLSTIKNADQI V+
Sbjct  220  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMKNRTTVIVAHRLSTIKNADQISVI  279

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINL  92
            QDGKIIEQGTHSTLIEN++GAYYKLIN+
Sbjct  280  QDGKIIEQGTHSTLIENKNGAYYKLINI  307



>emb|CDP13052.1| unnamed protein product [Coffea canephora]
Length=1261

 Score =   491 bits (1264),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 234/274 (85%), Positives = 259/274 (95%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDR+TEIL DVGE++ K+EG IEL++V+FSYPSRPD  IFKDFN+RV PG+
Sbjct  986   QMVASVFEVLDRRTEILGDVGEDVTKIEGMIELKNVDFSYPSRPDVLIFKDFNLRVSPGR  1045

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++L LRFYDP SGKVMIDGKD+K ++LKSLRKHIGLVQQEPALFA
Sbjct  1046  SMALVGQSGSGKSSVLALTLRFYDPTSGKVMIDGKDVKKIRLKSLRKHIGLVQQEPALFA  1105

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENI+YGKEGA ESEVIEAAK ANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1106  TSIYENIVYGKEGAPESEVIEAAKFANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  1165

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALDVESER+VQ ALDRLMK+RT+V+VAHRLSTIKNADQI V+
Sbjct  1166  ARAVLKNPSILLLDEATSALDVESERVVQAALDRLMKNRTTVMVAHRLSTIKNADQISVI  1225

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKIIEQGTHS+L+EN+DG YYKLINLQ+HQ+Q
Sbjct  1226  QDGKIIEQGTHSSLLENKDGPYYKLINLQRHQKQ  1259


 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T     +  G +L KV+G I+ +DV FSYPSRPD  IF    + +  GK +A
Sbjct  346  IFEMIERNTITNTSSKNGRKLDKVDGHIQFKDVSFSYPSRPDVLIFDKLCLDIPSGKIVA  405

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP+SG++++DG DIK+L LK LRK IGLV QEPALFAT+I
Sbjct  406  LVGGSGSGKSTVVSLIERFYDPLSGQILLDGSDIKDLDLKWLRKQIGLVNQEPALFATTI  465

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  A KL+ A +FI+ LP+   T+VGERGVQLSGGQKQR+AI+RA
Sbjct  466  RENILYGKGDATLEEITRAVKLSEAMTFINNLPDRLETQVGERGVQLSGGQKQRIAISRA  525

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP +LLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  526  IVKNPSVLLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADIIAVVQNG  585

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +I+E G+H  LI   +GAY  L+ LQ+
Sbjct  586  RIVETGSHEELISKPNGAYASLVQLQE  612



>ref|XP_004301784.1| PREDICTED: ABC transporter B family member 2-like [Fragaria vesca 
subsp. vesca]
Length=1261

 Score =   489 bits (1258),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 231/274 (84%), Positives = 260/274 (95%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVF+V DR+TEIL D+GEE+ KVEGTIELR V+FSYPSRPD  +F+DFN++V  GK
Sbjct  988   QMVASVFDVTDRRTEILGDIGEEVTKVEGTIELRGVQFSYPSRPDVLLFRDFNLKVHSGK  1047

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             +MALVGQSGSGKSSVISLILRFYDP +GKVMIDGKDIK + LKSLR+HIGLVQQEPALFA
Sbjct  1048  TMALVGQSGSGKSSVISLILRFYDPTAGKVMIDGKDIKKVNLKSLRRHIGLVQQEPALFA  1107

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1108  TSIYENILYGKEGASEAEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQRQRVAI  1167

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALD+ESER+VQQALDRLMK+RT+++VAHRLSTI+NAD+I V+
Sbjct  1168  ARAVLKNPEILLLDEATSALDLESERVVQQALDRLMKTRTTIMVAHRLSTIQNADEISVI  1227

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKI+EQG+HSTLIENR+GAYYKLIN+QQ QQ 
Sbjct  1228  QDGKIVEQGSHSTLIENRNGAYYKLINIQQQQQH  1261


 Score =   327 bits (839),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+EG I+ +DV FSYPSR D  IF   N+ +  GK +A
Sbjct  359  IFEMIERNTVNQSSSKTGRKLDKLEGHIQFKDVSFSYPSRTDVSIFDKLNLDIPAGKIVA  418

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G+V++DG +I  L LK +R+ IGLV QEPALFATSI
Sbjct  419  LVGGSGSGKSTVISLIERFYEPLAGQVLLDGNNISELDLKWMRQQIGLVNQEPALFATSI  478

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYG+  A+  ++ +AAKLA A SFI+ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  479  RENILYGRGDASMDDIKQAAKLAEALSFINNLPERFETQVGERGIQLSGGQKQRIAIARA  538

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLST++NAD I V+Q+G
Sbjct  539  IVKNPSILLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTVRNADVIAVVQEG  598

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N +G Y  L++LQ+
Sbjct  599  KIVETGSHEELISNPNGVYAALVHLQE  625



>ref|XP_010677330.1| PREDICTED: ABC transporter B family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=1256

 Score =   485 bits (1249),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 236/274 (86%), Positives = 255/274 (93%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM+ SVFEVLDR+TE+  D GEEL KVEG+IELR VEF YPSRPD  +FKDFN++VR GK
Sbjct  983   QMLESVFEVLDRRTEVKGDSGEELTKVEGSIELRGVEFIYPSRPDVIVFKDFNLKVRAGK  1042

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMIDGKDI+ L+LKSLRKHIGLVQQEPALFA
Sbjct  1043  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIDGKDIRRLQLKSLRKHIGLVQQEPALFA  1102

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENI+YGKEGATESEVIEAAKLANAHSFIS LPEGY+TKVGERGVQLSGGQKQRVAI
Sbjct  1103  TSIYENIVYGKEGATESEVIEAAKLANAHSFISGLPEGYNTKVGERGVQLSGGQKQRVAI  1162

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALDVESER+VQQALDRLMK+RT+VVVAHRLSTIKNADQI V+
Sbjct  1163  ARAVLKNPAILLLDEATSALDVESERVVQQALDRLMKNRTTVVVAHRLSTIKNADQISVI  1222

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKI+EQGTHS+LIEN +GAY KLINLQQ QQ 
Sbjct  1223  QDGKIVEQGTHSSLIENDNGAYCKLINLQQQQQH  1256


 Score =   327 bits (839),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRK--TEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R   ++  +  G +L KV+G IE RDV F YPSRP+  IF  F + +  GK +A
Sbjct  353  IFEMIERAKVSKAGSRSGMKLNKVDGHIEFRDVCFCYPSRPEAKIFDKFCLDIPAGKIVA  412

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  413  LVGGSGSGKSTVISLIERFYEPLAGQILLDRNDIRELDLKWLRQQIGLVSQEPALFATSI  472

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LPE Y T+VGERG+QLSGGQKQRVAIARA
Sbjct  473  RENILYGKDEATLDEITRAAKLSEAISFINNLPERYETQVGERGIQLSGGQKQRVAIARA  532

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQQALDR+M  RT+VVVAHRLST++NAD I V+Q G
Sbjct  533  LVKNPSILLLDEATSALDAESEKSVQQALDRVMVGRTTVVVAHRLSTVRNADIIAVVQGG  592

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N   AY  LI LQ+
Sbjct  593  KIVETGSHDELISNPVSAYSSLIQLQE  619



>ref|XP_002304346.1| P-glycoprotein [Populus trichocarpa]
 gb|EEE79325.1| P-glycoprotein [Populus trichocarpa]
Length=1250

 Score =   483 bits (1243),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 232/271 (86%), Positives = 256/271 (94%), Gaps = 0/271 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
              M ASVFE+LDRKT+++ DVGEEL  VEGTIELR V+FSYPSRPD  IFKDF++RVR GK
Sbjct  973   HMAASVFEILDRKTQVMGDVGEELKNVEGTIELRGVQFSYPSRPDALIFKDFDLRVRSGK  1032

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKVMIDG DIK LK+KSLRKHIGLVQQEPALFA
Sbjct  1033  SMALVGQSGSGKSSVLSLILRFYDPTAGKVMIDGIDIKELKVKSLRKHIGLVQQEPALFA  1092

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1093  TSIYENILYGKEGASEAEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1152

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+VVVAHRLSTIKNADQI ++
Sbjct  1153  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMRNRTTVVVAHRLSTIKNADQISII  1212

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
             Q+GKIIEQGTHS+L+EN+DGAY+KL+ LQQ 
Sbjct  1213  QEGKIIEQGTHSSLVENKDGAYFKLVRLQQQ  1243


 Score =   327 bits (839),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +I ++ G ++ +V+G IE +DV F YPSRPD  IF  F + +  GK +A
Sbjct  341  IFEMIEKNTMSKISSESGRKVDRVDGHIEFKDVCFRYPSRPDVTIFDKFCLDIPSGKIVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFYDP+ GK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  401  LVGGSGSGKSTVISLIERFYDPLFGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LP+ + T+VGERG+QLSGGQKQR+A++RA
Sbjct  461  RENILYGKDDATLEEITRAAKLSGAMSFINNLPDKFETQVGERGIQLSGGQKQRIALSRA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+A+DR +  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  521  IVKNPSILLLDEATSALDAESEKSVQEAIDRAIVGRTTVVVAHRLSTIRNADVIAVVQEG  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N    Y  L++LQ+
Sbjct  581  KIVEIGSHEELISNPQSTYASLVHLQE  607



>ref|XP_006432793.1| hypothetical protein CICLE_v100000602mg, partial [Citrus clementina]
 gb|ESR46033.1| hypothetical protein CICLE_v100000602mg, partial [Citrus clementina]
Length=1049

 Score =   478 bits (1229),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFEVLDRKT+++ D+GEEL  VEGTIELR V FSYPSRP+  IFKDFN++VR GK
Sbjct  772   QMAASVFEVLDRKTQVIGDIGEELTNVEGTIELRGVHFSYPSRPEVVIFKDFNLKVRAGK  831

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKS+V+SLILRFYDP +GKVM+DG DIK L LKSLRKHI LVQQEPALFA
Sbjct  832   SMALVGQSGSGKSTVLSLILRFYDPTAGKVMVDGIDIKRLNLKSLRKHIALVQQEPALFA  891

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+GA+E EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  892   TSIYENILYGKDGASEGEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  951

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQAL RLM+ RT+++VAHRLSTIKNADQI V+
Sbjct  952   ARAVLKNPEILLLDEATSALDVESERVVQQALQRLMRKRTTIIVAHRLSTIKNADQISVI  1011

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             + GKIIEQGTHS+L+EN DGAY+KLINLQQ Q
Sbjct  1012  ESGKIIEQGTHSSLVENEDGAYFKLINLQQRQ  1043


 Score =   333 bits (854),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 208/271 (77%), Gaps = 2/271 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+ G IE +DV F YPSRPD  IF  F + +  GK +A
Sbjct  139  IFEMIERDTMSKASSKTGRKLDKLSGHIEFKDVSFCYPSRPDVAIFNKFCLDIPAGKIVA  198

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK L LK LR+ IGLV QEPALFAT+I
Sbjct  199  LVGGSGSGKSTVISLIERFYEPLSGEILLDGNNIKGLDLKWLRQQIGLVNQEPALFATTI  258

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFIS LPE + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  259  RENILYGKDDATMEEITRAAKLSEAMSFISNLPERFETQVGERGIQLSGGQKQRIAISRA  318

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q  
Sbjct  319  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQGR  378

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
            KI+E G+H  LI N + AY  L+ LQ+   Q
Sbjct  379  KIVETGSHEELISNPNSAYAALVQLQEAASQ  409



>ref|XP_006352948.1| PREDICTED: ABC transporter B family member 2-like [Solanum tuberosum]
Length=1257

 Score =   483 bits (1243),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTEI  D GEE+  VEGTIE +DVEF YP+RPD  IF+DFNMRV  GK
Sbjct  984   QMVASVFEVLDRKTEIATDSGEEVTAVEGTIEFKDVEFCYPARPDVHIFRDFNMRVHAGK  1043

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMA+VGQSGSGKSSV++LILRFYDPISGKV+IDGKDI+ LKL SLRKHIGLVQQEPALFA
Sbjct  1044  SMAIVGQSGSGKSSVLALILRFYDPISGKVIIDGKDIRKLKLNSLRKHIGLVQQEPALFA  1103

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+EVI+AAKLANAHSFISALP+GYST+VGERGVQLSGGQKQRVAI
Sbjct  1104  TTIYENILYGKEGASEAEVIQAAKLANAHSFISALPDGYSTQVGERGVQLSGGQKQRVAI  1163

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+V+VAHRLSTIK+ADQI VL
Sbjct  1164  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMRNRTTVIVAHRLSTIKDADQISVL  1223

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI++QGTHS LIENRDGAYYKLINL
Sbjct  1224  QDGKIVDQGTHSALIENRDGAYYKLINL  1251


 Score =   320 bits (820),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G++L KV+G I+ +DV FSYPSRPD  IF   ++ +  GK +A
Sbjct  352  IFEMIERDTISKTSSKSGQKLSKVDGHIQFKDVCFSYPSRPDVVIFDKLSLDIPSGKIVA  411

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG DI++L L  LR+ IGLV QEPALFAT+I
Sbjct  412  LVGGSGSGKSTVISLIERFYEPLSGQILLDGCDIRHLDLNWLRQQIGLVNQEPALFATTI  471

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  ++  AAKL+ A +FI+ LP+ + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  472  RENILYGKSDASLEDIARAAKLSEAMTFINNLPDRFETQVGERGVQLSGGQKQRIAISRA  531

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ ALDR+M  RT+V+VAHRLSTI+NAD I V+ +G
Sbjct  532  IVKNPSILLLDEATSALDAESEKSVQDALDRVMVGRTTVIVAHRLSTIRNADIIAVVNNG  591

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   + AY  L+ LQ 
Sbjct  592  KIVETGSHEELISKPNSAYASLVQLQH  618



>ref|XP_008373592.1| PREDICTED: ABC transporter B family member 2-like [Malus domestica]
Length=1261

 Score =   483 bits (1243),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+SVFEVLDR TE+L DVGEEL+KVEGTIELR V F YPSRPD  IFKDFN++VR GK
Sbjct  986   QMVSSVFEVLDRGTEVLGDVGEELMKVEGTIELRSVHFGYPSRPDVSIFKDFNLKVRSGK  1045

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP SGKVMIDGKDIK L +KSLRKHIGLVQQEPALFA
Sbjct  1046  SMALVGQSGSGKSSVLSLILRFYDPTSGKVMIDGKDIKKLNIKSLRKHIGLVQQEPALFA  1105

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+GA+E+EVIEAAKLANAHSFISALPEGY TKVGERGVQLSGGQ+QRVAI
Sbjct  1106  TSIYENILYGKDGASEAEVIEAAKLANAHSFISALPEGYLTKVGERGVQLSGGQRQRVAI  1165

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLMK+RT+V+VAHRLSTIKNAD+I V+
Sbjct  1166  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMKNRTTVLVAHRLSTIKNADEISVI  1225

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI+EQG HSTLIENR+G Y+KLIN+
Sbjct  1226  QDGKIVEQGGHSTLIENRNGPYFKLINI  1253


 Score =   327 bits (839),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  ++ G +L K+EG I+ +DV FSYPSR D  IF   N+ +  GK +A
Sbjct  355  IFEMIERNTMSQSSSNNGHKLNKIEGHIQFKDVCFSYPSRSDVSIFNKLNLDIPAGKIVA  414

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+ ISLI RFY+P++G++++DG +IK L +K LR+ IGLV QEPALFATSI
Sbjct  415  LVGGSGSGKSTAISLIERFYEPLAGQILLDGHNIKELDIKWLRQQIGLVNQEPALFATSI  474

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SF++ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  475  KENILYGKYDATFDEITRAAKLSEALSFVNNLPERFETQVGERGIQLSGGQKQRIAIARA  534

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP +LLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLST++NAD I V+Q+G
Sbjct  535  IVKNPSVLLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTVRNADVIAVVQEG  594

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N +G Y  L+ LQ+
Sbjct  595  KIVETGSHEELISNPNGVYAALVQLQE  621



>ref|XP_009764894.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
sylvestris]
Length=1260

 Score =   481 bits (1239),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/267 (86%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDR+TEIL+D GEE+ +VEG+IE +DVEF YP+RPD  IFKDFNMRV  GK
Sbjct  985   QMVASVFEVLDRRTEILSDTGEEITRVEGSIEFKDVEFCYPARPDVHIFKDFNMRVHAGK  1044

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMA+VGQSGSGKSSV+SLILRFYDP+SGKV+IDGKDIK LKLKS+RKHI LVQQEPALFA
Sbjct  1045  SMAIVGQSGSGKSSVLSLILRFYDPVSGKVIIDGKDIKKLKLKSVRKHISLVQQEPALFA  1104

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVI+AAKLANAH+FISALP GYST+VGERGVQLSGGQKQRVAI
Sbjct  1105  TSIYENILYGKEGASEAEVIQAAKLANAHNFISALPHGYSTQVGERGVQLSGGQKQRVAI  1164

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPE+LLLDEATSALDVESERIVQ ALDRLMK+RT+V+VAHRLSTIKNADQI VL
Sbjct  1165  ARAVLKNPEMLLLDEATSALDVESERIVQHALDRLMKNRTTVIVAHRLSTIKNADQISVL  1224

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             QDGKI+EQGTHS L+EN+DGAYYKLIN
Sbjct  1225  QDGKIVEQGTHSALVENKDGAYYKLIN  1251


 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +     G++L KV+G I+ RDV FSYPSRPD  IF   ++ +  GK +A
Sbjct  345  IFEMIERDTISKTSFKSGQQLSKVDGHIQFRDVCFSYPSRPDVAIFDKISLDIPSGKIVA  404

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG +++DG DI++L LK +R+ IGLV QEPALFAT+I
Sbjct  405  LVGGSGSGKSTVISLIERFYEPLSGHLLLDGTDIRHLDLKWMRQQIGLVNQEPALFATTI  464

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  ++  AAKL+ A +FI+ LP+ + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  465  RENILYGKGDASLEDIARAAKLSEAMTFINNLPDRFETQVGERGVQLSGGQKQRIAISRA  524

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ ALDR+M  RT+V+VAHRLSTI+NAD I V+  G
Sbjct  525  IVKNPSILLLDEATSALDAESEKSVQDALDRVMVGRTTVIVAHRLSTIRNADIIAVVNTG  584

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   DGAY  L+ LQQ
Sbjct  585  KIVETGSHEELISKPDGAYASLVQLQQ  611



>gb|KDO53161.1| hypothetical protein CISIN_1g0008301mg, partial [Citrus sinensis]
Length=1086

 Score =   477 bits (1228),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFEVLDRKT+++ D+GEEL  VEGTIELR V FSYPSRP+  IFKDFN++VR GK
Sbjct  809   QMAASVFEVLDRKTQVIGDIGEELTNVEGTIELRGVHFSYPSRPEVVIFKDFNLKVRAGK  868

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKS+V+SLILRFYDP +GKVM+DG DIK L LKSLRKHI LVQQEPALFA
Sbjct  869   SMALVGQSGSGKSTVLSLILRFYDPTAGKVMVDGIDIKRLNLKSLRKHIALVQQEPALFA  928

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+GA+E EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  929   TSIYENILYGKDGASEGEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  988

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQAL RLM+ RT+++VAHRLSTIKNADQI V+
Sbjct  989   ARAVLKNPEILLLDEATSALDVESERVVQQALQRLMRKRTTIIVAHRLSTIKNADQISVI  1048

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             + GKIIEQGTHS+L+EN DGAY+KLINLQQ Q
Sbjct  1049  ESGKIIEQGTHSSLVENEDGAYFKLINLQQRQ  1080


 Score =   330 bits (845),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/271 (61%), Positives = 207/271 (76%), Gaps = 2/271 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+ G IE +DV F YPSRPD  IF  F + +  GK +A
Sbjct  176  IFEMIERDTMSKASSKTGRKLDKLSGHIEFKDVSFCYPSRPDVAIFDKFCLDIPAGKIVA  235

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK L LK LR+ IGLV QEPALFAT+I
Sbjct  236  LVGGSGSGKSTVISLIERFYEPLSGEILLDGNNIKGLDLKWLRQQIGLVNQEPALFATTI  295

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFIS LPE + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  296  RENILYGKDDATMEEITRAAKLSEAMSFISNLPERFETQVGERGIQLSGGQKQRIAISRA  355

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE  VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q  
Sbjct  356  IVKNPSILLLDEATSALDAESENSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQGR  415

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
            KI++ G+H  LI N + AY  L+ LQ+   Q
Sbjct  416  KIVKTGSHEELISNPNSAYAALVQLQEAASQ  446



>ref|XP_011028151.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
 ref|XP_011028152.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1081

 Score =   477 bits (1227),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
              M ASVFE+LDRKT+++ DVGEEL  V+G IELR V+FSYPSRPD  IFK+F++RVR GK
Sbjct  804   HMAASVFEILDRKTQVMGDVGEELKNVDGAIELRGVQFSYPSRPDALIFKEFDLRVRSGK  863

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKV+IDG DIK LK+KSLRKHIGLVQQEPALFA
Sbjct  864   SMALVGQSGSGKSSVLSLILRFYDPTAGKVIIDGIDIKKLKVKSLRKHIGLVQQEPALFA  923

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  924   TSIYENILYGKEGASEAEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  983

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+VVVAHRLSTIKNADQI ++
Sbjct  984   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMRNRTTVVVAHRLSTIKNADQISII  1043

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+GKIIEQGTHS+LIEN+DGAY+KL+ LQQ +
Sbjct  1044  QEGKIIEQGTHSSLIENKDGAYFKLVRLQQQE  1075


 Score =   327 bits (838),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +I ++ G ++ +V+G IE +DV F YPSRPD  IF  F + +  GK +A
Sbjct  172  IFEMIEKNTMSKISSESGRKVDRVDGHIEFKDVCFRYPSRPDVTIFDKFCLDIPSGKIVA  231

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFYDP+ GK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  232  LVGGSGSGKSTVISLIERFYDPLYGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  291

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ A   E+  AAKL+ A SFI+ LP  + T+VGERG+QLSGGQKQR+A++RA
Sbjct  292  RENILYGKDDAALDEITRAAKLSGAMSFINNLPNKFETQVGERGIQLSGGQKQRIALSRA  351

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+A+DR +  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  352  IVKNPCILLLDEATSALDAESEKSVQEAIDRAIVGRTAVVVAHRLSTIRNADVIAVVQEG  411

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI NR   Y  L++LQ+
Sbjct  412  KIVEIGSHEELISNRPSTYASLVHLQE  438



>ref|XP_004245909.2| PREDICTED: ABC transporter B family member 2-like [Solanum lycopersicum]
Length=1257

 Score =   481 bits (1238),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTEI+ D GEEL  VEGTIE +DVEF YP+RPD  IF+DFNMRV  GK
Sbjct  984   QMVASVFEVLDRKTEIVTDSGEELTVVEGTIEFKDVEFCYPARPDVHIFRDFNMRVHAGK  1043

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMA+VGQSGSGKSSV++LILRFYDPISGKV+IDGKDI+ LKL SLRKHIGLVQQEPALFA
Sbjct  1044  SMAIVGQSGSGKSSVLALILRFYDPISGKVIIDGKDIRKLKLNSLRKHIGLVQQEPALFA  1103

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+EVI+AAKLANAHSFISALP+GYST+VGERGVQLSGGQKQRVAI
Sbjct  1104  TTIYENILYGKEGASEAEVIQAAKLANAHSFISALPDGYSTQVGERGVQLSGGQKQRVAI  1163

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+V+VAHRLSTIK+ADQI VL
Sbjct  1164  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMRNRTTVIVAHRLSTIKDADQISVL  1223

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI++QGTHS LIENRDGAY+KLI+L
Sbjct  1224  QDGKIVDQGTHSALIENRDGAYFKLIHL  1251


 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G++L KV+G I+ +DV FSYPSRPD  IF   ++ +  GK +A
Sbjct  352  IFEMIERDTISKTSSKSGQKLSKVDGHIQFKDVCFSYPSRPDVVIFDKLSLDIPSGKIVA  411

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG DI++L LK LR+ IGLV QEPALFAT+I
Sbjct  412  LVGGSGSGKSTVISLIERFYEPLSGQILLDGFDIRHLDLKWLRQQIGLVNQEPALFATTI  471

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  ++  AAKL+ A +FI+ LP+ + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  472  RENILYGKSDASLEDIARAAKLSEAMTFINNLPDRFETQVGERGVQLSGGQKQRIAISRA  531

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ ALDR+M  RT+V+VAHRLSTI+NAD I V+ +G
Sbjct  532  IVKNPSILLLDEATSALDAESEKSVQDALDRVMVGRTTVIVAHRLSTIRNADIIAVVNNG  591

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   + AY  L+ LQQ
Sbjct  592  KIVETGSHEELISKPNSAYASLVQLQQ  618



>ref|XP_009371200.1| PREDICTED: ABC transporter B family member 2-like [Pyrus x bretschneideri]
Length=1261

 Score =   480 bits (1236),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+SVFEVLDR+TE+L DVGEEL+KVEGTIELR V F YPSRPD  IFKDFN+ VR GK
Sbjct  986   QMVSSVFEVLDRRTEVLGDVGEELMKVEGTIELRSVHFGYPSRPDVSIFKDFNLVVRSGK  1045

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP SGKVMIDGKDIK L +KSLRKHIGLVQQEPALFA
Sbjct  1046  SMALVGQSGSGKSSVLSLILRFYDPTSGKVMIDGKDIKKLNIKSLRKHIGLVQQEPALFA  1105

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+GA+E+EVIEAAKLANAHSFISALPEGY TKVGERGVQLSGGQ+QRVAI
Sbjct  1106  TSIYENILYGKDGASEAEVIEAAKLANAHSFISALPEGYLTKVGERGVQLSGGQRQRVAI  1165

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLMK+RT+V+VAHRLSTIKNAD+I V+
Sbjct  1166  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMKNRTTVLVAHRLSTIKNADEISVI  1225

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI+EQG+HSTL ENR+G Y+KLIN+
Sbjct  1226  QDGKIVEQGSHSTLRENRNGPYFKLINI  1253


 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 208/268 (78%), Gaps = 2/268 (1%)
 Frame = -2

Query  883  SVFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            ++FE+++R T  +  ++ G +L K+EG I+ +DV FSYPSR D  IF   N+ +  GK +
Sbjct  354  TIFEMIERNTMSQSSSNNGHKLNKIEGHIQFKDVCFSYPSRSDVSIFDKLNLDIPAGKIV  413

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            ALVG SGSGK + ISLI RFY+P++G++++DG +IK L +K LR+ IGLV QEPALFATS
Sbjct  414  ALVGGSGSGKRTAISLIERFYEPLAGQILLDGHNIKELDIKWLRQQIGLVNQEPALFATS  473

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  AT  E+  AAKL+ A SF++ LPE + T+VGERG+QLSGGQKQR+AIAR
Sbjct  474  IKENILYGKYDATFDEITRAAKLSEALSFVNNLPERFETQVGERGIQLSGGQKQRIAIAR  533

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A++KNP +LLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLST+++AD I V+Q+
Sbjct  534  AIVKNPSVLLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTVRHADVIAVVQE  593

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            GKI+E G+H  LI N +G Y  L+ LQ+
Sbjct  594  GKIVETGSHEELISNPNGVYAALVQLQE  621



>ref|XP_003612850.1| ABC transporter B family member [Medicago truncatula]
 gb|AES95808.1| ABC transporter B family-like protein [Medicago truncatula]
Length=1234

 Score =   479 bits (1233),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 233/274 (85%), Positives = 254/274 (93%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DRK+EI  D GEEL  VEGTIEL+ + FSYPSRPD  IFKDF++RV  GK
Sbjct  959   QMVASVFEVMDRKSEIKGDAGEELKTVEGTIELKRINFSYPSRPDVIIFKDFSLRVPSGK  1018

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILRFYDP SGKV+IDGKDI  + LKSLRKHIGLVQQEPALFA
Sbjct  1019  SVALVGQSGSGKSSVISLILRFYDPTSGKVLIDGKDITRINLKSLRKHIGLVQQEPALFA  1078

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FISALPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1079  TSIYENILYGKEGASDSEVIEAAKLANAHNFISALPEGYSTKVGERGVQLSGGQRQRVAI  1138

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+V+VAHRLSTI+NADQI VL
Sbjct  1139  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMQNRTTVMVAHRLSTIRNADQISVL  1198

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKIIEQGTHS+LIEN+DG YYKL+NLQQ Q  
Sbjct  1199  QDGKIIEQGTHSSLIENKDGPYYKLVNLQQQQNH  1232


 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 204/266 (77%), Gaps = 2/266 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K++G I+  DV FSYPSRPD  IF + N+ +  GK +A
Sbjct  329  IFEMIERDTVSKKSSKTGRKLSKLDGHIQFNDVCFSYPSRPDVGIFTNLNLDIPAGKIVA  388

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+PISG++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  389  LVGGSGSGKSTVVSLIERFYEPISGQILLDKNDIRELDLKWLRQQIGLVNQEPALFATSI  448

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A SFI+ LPE   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  449  KENILYGKDDATLEELKRAVKLSDAQSFINNLPERLDTQVGERGIQLSGGQKQRIAISRA  508

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT++VVAHRLSTI+NAD I V+Q G
Sbjct  509  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTIVVAHRLSTIRNADVIAVVQGG  568

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQ  89
            +I+E G H  L+ N    Y  L+ LQ
Sbjct  569  RIVETGNHEKLMSNPTSVYASLVQLQ  594



>ref|XP_011028150.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1250

 Score =   477 bits (1228),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
              M ASVFE+LDRKT+++ DVGEEL  V+G IELR V+FSYPSRPD  IFK+F++RVR GK
Sbjct  973   HMAASVFEILDRKTQVMGDVGEELKNVDGAIELRGVQFSYPSRPDALIFKEFDLRVRSGK  1032

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKV+IDG DIK LK+KSLRKHIGLVQQEPALFA
Sbjct  1033  SMALVGQSGSGKSSVLSLILRFYDPTAGKVIIDGIDIKKLKVKSLRKHIGLVQQEPALFA  1092

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1093  TSIYENILYGKEGASEAEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1152

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+VVVAHRLSTIKNADQI ++
Sbjct  1153  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMRNRTTVVVAHRLSTIKNADQISII  1212

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+GKIIEQGTHS+LIEN+DGAY+KL+ LQQ +
Sbjct  1213  QEGKIIEQGTHSSLIENKDGAYFKLVRLQQQE  1244


 Score =   327 bits (839),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +I ++ G ++ +V+G IE +DV F YPSRPD  IF  F + +  GK +A
Sbjct  341  IFEMIEKNTMSKISSESGRKVDRVDGHIEFKDVCFRYPSRPDVTIFDKFCLDIPSGKIVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFYDP+ GK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  401  LVGGSGSGKSTVISLIERFYDPLYGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ A   E+  AAKL+ A SFI+ LP  + T+VGERG+QLSGGQKQR+A++RA
Sbjct  461  RENILYGKDDAALDEITRAAKLSGAMSFINNLPNKFETQVGERGIQLSGGQKQRIALSRA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+A+DR +  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  521  IVKNPCILLLDEATSALDAESEKSVQEAIDRAIVGRTAVVVAHRLSTIRNADVIAVVQEG  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI NR   Y  L++LQ+
Sbjct  581  KIVEIGSHEELISNRPSTYASLVHLQE  607



>ref|XP_006471591.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006471592.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Citrus sinensis]
Length=1265

 Score =   477 bits (1228),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFEVLDRKT+++ D+GEEL  VEGTIELR V FSYPSRP+  IFKDFN++VR GK
Sbjct  988   QMAASVFEVLDRKTQVIGDIGEELTNVEGTIELRGVHFSYPSRPEVVIFKDFNLKVRAGK  1047

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKS+V+SLILRFYDP +GKVM+DG DIK L LKSLRKHI LVQQEPALFA
Sbjct  1048  SMALVGQSGSGKSTVLSLILRFYDPTAGKVMVDGIDIKRLNLKSLRKHIALVQQEPALFA  1107

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+GA+E EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1108  TSIYENILYGKDGASEGEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  1167

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQAL RLM+ RT+++VAHRLSTIKNADQI V+
Sbjct  1168  ARAVLKNPEILLLDEATSALDVESERVVQQALQRLMRKRTTIIVAHRLSTIKNADQISVI  1227

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             + GKIIEQGTHS+L+EN DGAY+KLINLQQ Q
Sbjct  1228  ESGKIIEQGTHSSLVENEDGAYFKLINLQQRQ  1259


 Score =   333 bits (853),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 208/271 (77%), Gaps = 2/271 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+ G IE +DV F YPSRPD  IF  F + +  GK +A
Sbjct  355  IFEMIERDTMSKASSKTGRKLDKLSGHIEFKDVSFCYPSRPDVAIFNKFCLDIPAGKIVA  414

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK L LK LR+ IGLV QEPALFAT+I
Sbjct  415  LVGGSGSGKSTVISLIERFYEPLSGEILLDGNNIKGLDLKWLRQQIGLVNQEPALFATTI  474

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFIS LPE + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  475  RENILYGKDDATMEEITRAAKLSEAMSFISNLPERFETQVGERGIQLSGGQKQRIAISRA  534

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q  
Sbjct  535  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQGR  594

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
            KI+E G+H  LI N + AY  L+ LQ+   Q
Sbjct  595  KIVETGSHEELISNPNSAYAALVQLQEAASQ  625



>gb|KHN38940.1| ABC transporter B family member 2 [Glycine soja]
Length=1204

 Score =   476 bits (1224),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 229/273 (84%), Positives = 254/273 (93%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DRK+ I  DVGEEL  V+GTIEL+ + FSYPSRPD  IFKDFN+RV  GK
Sbjct  931   QMVASVFEVMDRKSGISCDVGEELKTVDGTIELKRINFSYPSRPDVIIFKDFNLRVPAGK  990

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILRFYDP SG+V+IDGKDI  L LKSLR+HIGLVQQEPALFA
Sbjct  991   SVALVGQSGSGKSSVISLILRFYDPTSGRVLIDGKDITRLNLKSLRRHIGLVQQEPALFA  1050

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FIS LPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1051  TSIYENILYGKEGASDSEVIEAAKLANAHNFISGLPEGYSTKVGERGVQLSGGQRQRVAI  1110

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+++VAHRLSTI+NADQI VL
Sbjct  1111  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMQNRTTIMVAHRLSTIRNADQISVL  1170

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDGKII+QGTHS+LIEN++GAYYKL+NLQQ  Q
Sbjct  1171  QDGKIIDQGTHSSLIENKNGAYYKLVNLQQQHQ  1203


 Score =   319 bits (817),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R+T  +  +  G +L K+EG I+ ++V FSYPSRPD  IF +  + +  GK +A
Sbjct  298  IFEMIERETVSKSSSKTGRKLGKLEGHIQFKNVCFSYPSRPDVAIFNNLCLDIPSGKIIA  357

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  358  LVGGSGSGKSTVISLIERFYEPISGQILLDRNDIRELDLKWLRQQIGLVNQEPALFATSI  417

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A  FI+ LP+   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  418  KENILYGKDDATLEELKRAVKLSDAQPFINNLPDRLETQVGERGIQLSGGQKQRIAISRA  477

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  478  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADMIAVVQGG  537

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  L+ N    Y  L+ LQ+
Sbjct  538  KIVETGNHEELMANPTSVYASLVQLQE  564



>gb|KHN04865.1| ABC transporter B family member 2 [Glycine soja]
Length=1246

 Score =   476 bits (1226),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 230/274 (84%), Positives = 255/274 (93%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DRK+ I  +VGEEL  V+GTIEL+ + FSYPSRPD  IFKDFN+RV  GK
Sbjct  972   QMVASVFEVMDRKSGISCEVGEELKTVDGTIELKRINFSYPSRPDVIIFKDFNLRVPAGK  1031

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILRFYDP SG+V+IDGKDI  L LKSLR+HIGLVQQEPALFA
Sbjct  1032  SVALVGQSGSGKSSVISLILRFYDPTSGRVLIDGKDITRLNLKSLRRHIGLVQQEPALFA  1091

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FIS LPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1092  TSIYENILYGKEGASDSEVIEAAKLANAHNFISGLPEGYSTKVGERGVQLSGGQRQRVAI  1151

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+V+VAHRLSTI+NADQI VL
Sbjct  1152  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMQNRTTVMVAHRLSTIRNADQISVL  1211

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKII+QGTHS+LIEN++GAYYKL+NLQQ Q Q
Sbjct  1212  QDGKIIDQGTHSSLIENKNGAYYKLVNLQQQQHQ  1245


 Score =   318 bits (816),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+EG I+ +++ FSYPSRPD  IF +  + +  GK +A
Sbjct  339  IFEMIERDTVSKSSSKTGRKLGKLEGHIQFKNICFSYPSRPDVAIFNNLCLDIPSGKIVA  398

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  399  LVGGSGSGKSTVISLIERFYEPLSGQILLDRNDIRELDLKWLRQQIGLVNQEPALFATSI  458

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A SFI+ LP+   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  459  KENILYGKDDATLEELKRAVKLSDAQSFINNLPDRLETQVGERGIQLSGGQKQRIAISRA  518

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  519  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADMIAVVQGG  578

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  L+ N    Y  L+ LQ+
Sbjct  579  KIVETGNHEELMANPTSVYASLVQLQE  605



>ref|XP_003517674.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1246

 Score =   476 bits (1226),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 230/274 (84%), Positives = 255/274 (93%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DRK+ I  +VGEEL  V+GTIEL+ + FSYPSRPD  IFKDFN+RV  GK
Sbjct  972   QMVASVFEVMDRKSGISCEVGEELKTVDGTIELKRINFSYPSRPDVIIFKDFNLRVPAGK  1031

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILRFYDP SG+V+IDGKDI  L LKSLR+HIGLVQQEPALFA
Sbjct  1032  SVALVGQSGSGKSSVISLILRFYDPTSGRVLIDGKDITRLNLKSLRRHIGLVQQEPALFA  1091

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FIS LPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1092  TSIYENILYGKEGASDSEVIEAAKLANAHNFISGLPEGYSTKVGERGVQLSGGQRQRVAI  1151

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+V+VAHRLSTI+NADQI VL
Sbjct  1152  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMQNRTTVMVAHRLSTIRNADQISVL  1211

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKII+QGTHS+LIEN++GAYYKL+NLQQ Q Q
Sbjct  1212  QDGKIIDQGTHSSLIENKNGAYYKLVNLQQQQHQ  1245


 Score =   318 bits (816),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+EG I+ +++ FSYPSRPD  IF +  + +  GK +A
Sbjct  339  IFEMIERDTVSKSSSKTGRKLGKLEGHIQFKNICFSYPSRPDVAIFNNLCLDIPSGKIVA  398

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  399  LVGGSGSGKSTVISLIERFYEPLSGQILLDRNDIRELDLKWLRQQIGLVNQEPALFATSI  458

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A SFI+ LP+   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  459  KENILYGKDDATLEELKRAVKLSDAQSFINNLPDRLETQVGERGIQLSGGQKQRIAISRA  518

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  519  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADMIAVVQGG  578

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  L+ N    Y  L+ LQ+
Sbjct  579  KIVETGNHEELMANPTSVYASLVQLQE  605



>gb|EYU34148.1| hypothetical protein MIMGU_mgv1a000301mg [Erythranthe guttata]
Length=1278

 Score =   476 bits (1226),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/273 (84%), Positives = 255/273 (93%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             +MV SVFEVLDR++EI+ DVGE++ +V+GTIEL+DVEFSYPSRP+  IFKDFN+RV  G 
Sbjct  1005  KMVESVFEVLDRRSEIINDVGEDIGRVQGTIELKDVEFSYPSRPNVLIFKDFNLRVDIGT  1064

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVI+LILRFYDPISGK+MIDGKDIK +KLK LR+HIGLVQQEPALFA
Sbjct  1065  SMALVGQSGSGKSSVIALILRFYDPISGKIMIDGKDIKKVKLKMLRRHIGLVQQEPALFA  1124

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGATE E+IEAAK ANAH+FIS LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1125  TTIYENILYGKEGATEGEIIEAAKQANAHTFISGLPEGYSTKVGERGVQLSGGQKQRVAI  1184

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALD+ESER+VQQALDRLMK+RT+V+VAHRLSTIKNA QI VL
Sbjct  1185  ARAILKNPSILLLDEATSALDLESERVVQQALDRLMKNRTTVMVAHRLSTIKNAHQISVL  1244

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDGKIIEQGTHSTL+EN+DGAY+KLINLQ  QQ
Sbjct  1245  QDGKIIEQGTHSTLLENKDGAYFKLINLQNQQQ  1277


 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G +L KV+G I+ ++V FSYPSRPD+ IF    + + PGK +A
Sbjct  359  IFKMIERNTVSKTSSKNGRKLSKVDGHIQFKNVTFSYPSRPDSLIFNKLCLEIPPGKIVA  418

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG +++DG DI++L LK LR  IGLV QEPALFAT+I
Sbjct  419  LVGGSGSGKSTVISLIERFYEPVSGHILLDGNDIRDLDLKWLRHQIGLVNQEPALFATTI  478

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             +NILYGK+ AT  E+  AAKL+ A +FIS LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  479  RDNILYGKDDATTEEITRAAKLSEAINFISNLPDRFETQVGERGIQLSGGQKQRIAISRA  538

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT++VVAHRLSTI+NAD I V+ +G
Sbjct  539  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTIVVAHRLSTIRNADVIAVVHNG  598

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             I+E G+H  LI   + +Y  L+ LQ+
Sbjct  599  AIVETGSHEELISRPNSSYASLVQLQE  625



>gb|KJB51627.1| hypothetical protein B456_008G225400 [Gossypium raimondii]
Length=1248

 Score =   476 bits (1224),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 225/273 (82%), Positives = 256/273 (94%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKT+++ DVGEE+  VEGTIELR V FSYPSRPD  IFKDF+++VR GK
Sbjct  974   QMVASVFEIMDRKTQVVGDVGEEVTNVEGTIELRGVHFSYPSRPDVVIFKDFDLKVRSGK  1033

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+ LILRFYDP +GKVMIDG+DI+ LKLKSLRKHIGLVQQEPALFA
Sbjct  1034  SMALVGQSGSGKSSVLVLILRFYDPTAGKVMIDGRDIRKLKLKSLRKHIGLVQQEPALFA  1093

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESE+IEAAKLANAH FIS+LPEGYSTKVGERGVQLSGGQKQR+AI
Sbjct  1094  TSIYENILYGKEGASESEIIEAAKLANAHGFISSLPEGYSTKVGERGVQLSGGQKQRIAI  1153

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTIKNADQI V+
Sbjct  1154  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVMVAHRLSTIKNADQISVI  1213

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             Q G+II++G+HS+LIEN++G Y+KLINLQQ Q 
Sbjct  1214  QGGRIIDKGSHSSLIENKEGPYFKLINLQQQQH  1246


 Score =   332 bits (851),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 211/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KVEG IE +DV F+YPSRPD  IF  F++ +  GK +A
Sbjct  343  IFEMIERNTVSKTSSKTGHKLGKVEGHIEFKDVSFNYPSRPDVVIFNRFSLNIPAGKIVA  402

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G+V++DG ++++L LK LR+ IGLV QEPALFAT+I
Sbjct  403  LVGGSGSGKSTVISLIERFYEPLAGEVLLDGNNVRDLDLKWLRQQIGLVNQEPALFATTI  462

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  463  RENILYGKYDATLGEITRAAKLSGAITFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  522

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  523  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQSG  582

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N + AY  L+ LQ+
Sbjct  583  KIVETGSHDELISNPNSAYSSLVQLQE  609



>ref|XP_003533440.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1245

 Score =   475 bits (1223),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/273 (84%), Positives = 254/273 (93%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DRK+ I  DVGEEL  V+GTIEL+ + FSYPSRPD  IFKDFN+RV  GK
Sbjct  972   QMVASVFEVMDRKSGISCDVGEELKTVDGTIELKRINFSYPSRPDVIIFKDFNLRVPAGK  1031

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILRFYDP SG+V+IDGKDI  L LKSLR+HIGLVQQEPALFA
Sbjct  1032  SVALVGQSGSGKSSVISLILRFYDPTSGRVLIDGKDITRLNLKSLRRHIGLVQQEPALFA  1091

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FIS LPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1092  TSIYENILYGKEGASDSEVIEAAKLANAHNFISGLPEGYSTKVGERGVQLSGGQRQRVAI  1151

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+++VAHRLSTI+NADQI VL
Sbjct  1152  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMQNRTTIMVAHRLSTIRNADQISVL  1211

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDGKII+QGTHS+LIEN++GAYYKL+NLQQ  Q
Sbjct  1212  QDGKIIDQGTHSSLIENKNGAYYKLVNLQQQHQ  1244


 Score =   319 bits (817),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R+T  +  +  G +L K+EG I+ ++V FSYPSRPD  IF +  + +  GK +A
Sbjct  339  IFEMIERETVSKSSSKTGRKLGKLEGHIQFKNVCFSYPSRPDVAIFNNLCLDIPSGKIIA  398

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  399  LVGGSGSGKSTVISLIERFYEPISGQILLDRNDIRELDLKWLRQQIGLVNQEPALFATSI  458

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A  FI+ LP+   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  459  KENILYGKDDATLEELKRAVKLSDAQPFINNLPDRLETQVGERGIQLSGGQKQRIAISRA  518

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  519  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADMIAVVQGG  578

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  L+ N    Y  L+ LQ+
Sbjct  579  KIVETGNHEELMANPTSVYASLVQLQE  605



>ref|XP_007040641.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
 gb|EOY25142.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
isoform 1 [Theobroma cacao]
Length=1251

 Score =   475 bits (1223),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/267 (85%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKT++  DVGEEL  VEGTIELR V FSYPSRPD  IFKDF+++VR GK
Sbjct  975   QMVASVFEIMDRKTQVAGDVGEELTNVEGTIELRGVHFSYPSRPDVVIFKDFDLKVRSGK  1034

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP  G+VMIDG+DI+ L+LKSLRKHIGLVQQEPALFA
Sbjct  1035  SMALVGQSGSGKSSVLALILRFYDPTVGRVMIDGRDIRKLQLKSLRKHIGLVQQEPALFA  1094

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYG+EGA+ESEVIEAAKLANAH FIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1095  TSIYENILYGREGASESEVIEAAKLANAHGFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1154

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTIKNADQI V+
Sbjct  1155  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVMVAHRLSTIKNADQISVI  1214

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             Q+GKIIEQGTHSTLIEN+DG Y+KLIN
Sbjct  1215  QEGKIIEQGTHSTLIENKDGPYFKLIN  1241


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KVEG IE +DV FSYPSRPD  IF  F + +  GK +A
Sbjct  342  IFEMIERNTVSKTSSKTGYKLSKVEGHIEFKDVSFSYPSRPDVVIFNKFCLNIPAGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G +++DG +IK+L LK LR+ IGLV QEPALFAT+I
Sbjct  402  LVGGSGSGKSTVISLIERFYEPLTGDILLDGNNIKDLDLKWLRQQIGLVNQEPALFATTI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E++ AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDEATLDEIMRAAKLSEAIAFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  522  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQNG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             I+E G+H  LI N   AY  L+ LQ+
Sbjct  582  TIVETGSHEELISNPYSAYSSLVQLQE  608



>ref|XP_004512509.1| PREDICTED: ABC transporter B family member 2-like [Cicer arietinum]
Length=1237

 Score =   474 bits (1221),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 230/274 (84%), Positives = 252/274 (92%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRK+ I  D GEEL  VEGTIEL+ + FSYPSRPD  IFKDFN+RV  GK
Sbjct  962   QMVASVFEVLDRKSGISCDTGEELRTVEGTIELKRINFSYPSRPDVIIFKDFNLRVPSGK  1021

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILR+YDPISGKV+IDGKDI  + LKSLRKHIGLVQQEPALFA
Sbjct  1022  SVALVGQSGSGKSSVISLILRYYDPISGKVLIDGKDITTINLKSLRKHIGLVQQEPALFA  1081

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FIS LP+GYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1082  TSIYENILYGKEGASDSEVIEAAKLANAHTFISGLPDGYSTKVGERGVQLSGGQRQRVAI  1141

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTI+NADQI VL
Sbjct  1142  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMQNRTTVMVAHRLSTIRNADQISVL  1201

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKIIEQGTHS+LIEN+ G YYKL+NLQQ Q  
Sbjct  1202  QDGKIIEQGTHSSLIENKHGPYYKLVNLQQQQHH  1235


 Score =   323 bits (828),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 205/266 (77%), Gaps = 2/266 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+EG I+ +DV FSYPSRPD  IF +FN+ +  GK +A
Sbjct  330  IFEMIERDTVSKKSSKTGHKLSKLEGHIQFKDVCFSYPSRPDIEIFNNFNLDIPAGKIIA  389

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+PISG +++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  390  LVGGSGSGKSTVVSLIERFYEPISGHILLDKNDIRELDLKWLRQQIGLVNQEPALFATSI  449

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A SFI+ LP+   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  450  KENILYGKDDATLEELKRAVKLSDAQSFINNLPDRLDTQVGERGIQLSGGQKQRIAISRA  509

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP +LLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+Q G
Sbjct  510  IVKNPSVLLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADVIAVVQGG  569

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQ  89
            +I+E G H  L+ N    Y  L+ LQ
Sbjct  570  RIVETGNHEELMSNPTSVYASLVQLQ  595



>ref|XP_002299180.2| P-glycoprotein [Populus trichocarpa]
 gb|EEE83985.2| P-glycoprotein [Populus trichocarpa]
Length=1285

 Score =   475 bits (1222),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 255/272 (94%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFE+LDRKT+++ DVGEEL  V+GTIELR V+FSYPSRPDT IF DF++RVR GK
Sbjct  1002  QMAASVFEILDRKTQVMGDVGEELKNVKGTIELRGVQFSYPSRPDTLIFMDFDLRVRSGK  1061

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKVMIDG DI+ LK+KSLRKHIGLVQQEPALFA
Sbjct  1062  SMALVGQSGSGKSSVLSLILRFYDPTAGKVMIDGIDIRKLKVKSLRKHIGLVQQEPALFA  1121

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+E+IEAAKLANAH FIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1122  TTIYENILYGKEGASETELIEAAKLANAHGFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1181

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLM++RT+V+VAHRLSTIK+ADQI V+
Sbjct  1182  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMRNRTTVMVAHRLSTIKDADQISVI  1241

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKIIEQGTHS+LIEN+DG+Y+KL  LQQ Q
Sbjct  1242  QGGKIIEQGTHSSLIENKDGSYFKLFRLQQQQ  1273


 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 207/269 (77%), Gaps = 6/269 (2%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIK----VEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            +FE+++R T  L++  ++ IK    V+G IE +DV F YPSRPD  IF  F + +  GK 
Sbjct  360  IFEMIERNT--LSNTSKKSIKKLEKVDGHIEFKDVCFGYPSRPDVTIFDKFCLDIPSGKI  417

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
            +ALVG SGSGKS+VISLI RFY+P+ G++++DG DI++L LK LRK IGLV QEPALFA 
Sbjct  418  VALVGGSGSGKSTVISLIERFYEPLFGQILLDGNDIRDLDLKWLRKQIGLVNQEPALFAA  477

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            +I ENILYGK+ AT  E+  AA L+ A SFI+ LP+ + T+VGERG+QLSGGQKQR+A++
Sbjct  478  TIRENILYGKDDATLEEITRAATLSEAMSFINNLPDRFETQVGERGIQLSGGQKQRIALS  537

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLSTI+NAD I V+Q
Sbjct  538  RAIVKNPCILLLDEATSALDAESEKSVQEALDRAMLGRTTVVVAHRLSTIRNADVIAVVQ  597

Query  172  DGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +GKI+E G+H  LI N    Y  L++LQ+
Sbjct  598  EGKIVEIGSHEELISNPQSTYASLVHLQE  626



>ref|XP_008238211.1| PREDICTED: ABC transporter B family member 2-like [Prunus mume]
Length=1271

 Score =   474 bits (1221),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFEVLDR+TE+L D+GEEL K+EGTIELR V FSYPSRPD  +F+DF+++VR GK
Sbjct  994   QMAASVFEVLDRRTEVLGDIGEELTKLEGTIELRSVHFSYPSRPDVLLFRDFSLKVRSGK  1053

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKVMIDGKDIK LK++SLRKHIGLVQQEPALFA
Sbjct  1054  SMALVGQSGSGKSSVLSLILRFYDPTTGKVMIDGKDIKKLKIRSLRKHIGLVQQEPALFA  1113

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+G++E+EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1114  TSIYENILYGKDGSSEAEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQRQRVAI  1173

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLMK+RT+V+VAHRLSTI+NAD+I V+
Sbjct  1174  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMKNRTTVLVAHRLSTIQNADEISVI  1233

Query  175   QDGKIIEQGTHSTLIENRDGAYYKL  101
             QDGKI+EQG+HS+LIENR+GAY+KL
Sbjct  1234  QDGKIVEQGSHSSLIENRNGAYFKL  1258


 Score =   330 bits (845),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T     +  G++L K+EG I+ +D+ FSYPSRPD  IF   N+ +  GK +A
Sbjct  362  IFEMIERNTISRSSSKNGKKLDKIEGHIQFKDICFSYPSRPDVTIFNKLNLDIPAGKIVA  421

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++DG +I  + LK LR+ IGLV QEPALFATSI
Sbjct  422  LVGGSGSGKSTVISLIERFYEPLAGQILLDGNNIGEIDLKWLRQQIGLVNQEPALFATSI  481

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  482  KENILYGKSDATFDEITHAAKLSEALSFINNLPERFETQVGERGIQLSGGQKQRIAIARA  541

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLST++NAD I V+Q+G
Sbjct  542  IVKNPSILLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTVRNADVIAVVQEG  601

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N +G Y  L+ LQ+
Sbjct  602  KIVETGSHEELISNPNGVYAILVQLQE  628



>ref|XP_007210429.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
 gb|EMJ11628.1| hypothetical protein PRUPE_ppa000340mg [Prunus persica]
Length=1267

 Score =   471 bits (1213),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 223/265 (84%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFEVLD +TE+L ++GEEL+KVEGTIELR V FSYPSRPD  +F+DF+++VR GK
Sbjct  993   QMAASVFEVLDHRTEVLGEIGEELMKVEGTIELRSVHFSYPSRPDVLLFRDFSLKVRSGK  1052

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKVMIDGKDIK LK++SLRKHIGLVQQEPALFA
Sbjct  1053  SMALVGQSGSGKSSVLSLILRFYDPTTGKVMIDGKDIKKLKIRSLRKHIGLVQQEPALFA  1112

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGK+G++E+EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1113  TSIYENILYGKDGSSEAEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQRQRVAI  1172

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLMK+RT+V+VAHRLSTI+NAD+I V+
Sbjct  1173  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMKNRTTVLVAHRLSTIQNADEISVI  1232

Query  175   QDGKIIEQGTHSTLIENRDGAYYKL  101
             QDGKI+EQG+HS+LIENR GAY+KL
Sbjct  1233  QDGKIVEQGSHSSLIENRKGAYFKL  1257


 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T     +  G++L K+EG I+ +D+ FSYPSRPD  IF   N+ +  GK +A
Sbjct  361  IFEMIERNTISRSSSKNGKKLNKIEGHIQFKDICFSYPSRPDVTIFNKLNLDIPAGKIVA  420

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P +G++++DG +I  L LK LR+ IGLV QEPALFATSI
Sbjct  421  LVGGSGSGKSTVISLIERFYEPPAGQILLDGNNIGELDLKWLRQQIGLVNQEPALFATSI  480

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  481  RENILYGKSDATFDEITRAAKLSEALSFINNLPERFETQVGERGIQLSGGQKQRIAIARA  540

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLST++NAD I V+Q+G
Sbjct  541  IVKNPSILLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTVRNADVIAVVQEG  600

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N +G Y  L+ LQ+
Sbjct  601  KIVETGSHEELISNPNGVYAVLVQLQE  627



>gb|KHN30010.1| ABC transporter B family member 2 [Glycine soja]
Length=1253

 Score =   471 bits (1211),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/273 (83%), Positives = 250/273 (92%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVAS+FEV+DRKT IL DVGEEL  VEGTIEL+ + F YPSRPD  IF DFN++V  GK
Sbjct  975   QMVASIFEVMDRKTGILGDVGEELKTVEGTIELKRIHFCYPSRPDVVIFNDFNLKVLAGK  1034

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             ++ALVG SG GKSSVISLILRFYDP SGKVMIDGKDIK L LKSLRKHIGLVQQEPALFA
Sbjct  1035  NIALVGHSGCGKSSVISLILRFYDPTSGKVMIDGKDIKKLNLKSLRKHIGLVQQEPALFA  1094

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFISALPEGY+TKVGERGVQLSGGQKQRVAI
Sbjct  1095  TSIYENILYGKEGASEAEVIEAAKLANAHSFISALPEGYATKVGERGVQLSGGQKQRVAI  1154

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALD+ESER+VQQALD+LMK+RT+V+VAHRLSTI NADQI VL
Sbjct  1155  ARAVLKNPEILLLDEATSALDLESERVVQQALDKLMKNRTTVIVAHRLSTITNADQIAVL  1214

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             +DGKII++GTH+ L+EN DGAYYKL++LQQ Q 
Sbjct  1215  EDGKIIQRGTHARLVENTDGAYYKLVSLQQQQH  1247


 Score =   319 bits (817),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 212/269 (79%), Gaps = 4/269 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  ++ G++L K+EG I+ +DV FSYPSRPD  IF +F + +  GK +A
Sbjct  333  IFEMIERDTMSKASSENGKKLSKLEGHIQFKDVCFSYPSRPDVVIFNNFCIEIPSGKILA  392

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +I+ L LK LR+ IGLV QEPALFATSI
Sbjct  393  LVGGSGSGKSTVISLIERFYEPLSGQILLDGNNIRELDLKWLRQQIGLVNQEPALFATSI  452

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  EV +A  L++A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  453  RENILYGKDDATLEEVNQAVILSDAQSFINNLPDGLDTQVGERGIQLSGGQKQRIAISRA  512

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD-  170
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+V+VAHRLSTI+NAD I V+++ 
Sbjct  513  IVKNPSILLLDEATSALDSESEKSVQEALDRVMVGRTTVIVAHRLSTIRNADMIVVIEEG  572

Query  169  GKIIEQGTHSTLIEN-RDGAYYKLINLQQ  86
            GK++E G H  LI N  +  Y  L+ +Q+
Sbjct  573  GKVVEIGNHEELISNPNNNVYASLVQIQE  601



>ref|XP_006585887.1| PREDICTED: ABC transporter B family member 2-like [Glycine max]
Length=1254

 Score =   471 bits (1211),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/273 (83%), Positives = 250/273 (92%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVAS+FEV+DRKT IL DVGEEL  VEGTIEL+ + F YPSRPD  IF DFN++V  GK
Sbjct  976   QMVASIFEVMDRKTGILGDVGEELKTVEGTIELKRIHFCYPSRPDVVIFNDFNLKVLAGK  1035

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             ++ALVG SG GKSSVISLILRFYDP SGKVMIDGKDIK L LKSLRKHIGLVQQEPALFA
Sbjct  1036  NIALVGHSGCGKSSVISLILRFYDPTSGKVMIDGKDIKKLNLKSLRKHIGLVQQEPALFA  1095

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFISALPEGY+TKVGERGVQLSGGQKQRVAI
Sbjct  1096  TSIYENILYGKEGASEAEVIEAAKLANAHSFISALPEGYATKVGERGVQLSGGQKQRVAI  1155

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALD+ESER+VQQALD+LMK+RT+V+VAHRLSTI NADQI VL
Sbjct  1156  ARAVLKNPEILLLDEATSALDLESERVVQQALDKLMKNRTTVIVAHRLSTITNADQIAVL  1215

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             +DGKII++GTH+ L+EN DGAYYKL++LQQ Q 
Sbjct  1216  EDGKIIQRGTHARLVENTDGAYYKLVSLQQQQH  1248


 Score =   319 bits (817),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 212/269 (79%), Gaps = 4/269 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  ++ G++L K+EG I+ +DV FSYPSRPD  IF +F + +  GK +A
Sbjct  334  IFEMIERDTMSKASSENGKKLSKLEGHIQFKDVCFSYPSRPDVVIFNNFCIEIPSGKILA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +I+ L LK LR+ IGLV QEPALFATSI
Sbjct  394  LVGGSGSGKSTVISLIERFYEPLSGQILLDGNNIRELDLKWLRQQIGLVNQEPALFATSI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  EV +A  L++A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  RENILYGKDDATLEEVNQAVILSDAQSFINNLPDGLDTQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD-  170
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+V+VAHRLSTI+NAD I V+++ 
Sbjct  514  IVKNPSILLLDEATSALDSESEKSVQEALDRVMVGRTTVIVAHRLSTIRNADMIVVIEEG  573

Query  169  GKIIEQGTHSTLIEN-RDGAYYKLINLQQ  86
            GK++E G H  LI N  +  Y  L+ +Q+
Sbjct  574  GKVVEIGNHEELISNPNNNVYASLVQIQE  602



>gb|EPS64351.1| hypothetical protein M569_10429, partial [Genlisea aurea]
Length=1241

 Score =   470 bits (1210),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 223/270 (83%), Positives = 254/270 (94%), Gaps = 0/270 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             +MVASVF ++DR+TEIL DVGEE+ +++GTIEL+DVEFSYPSRPD  IFKDFN+RV  G+
Sbjct  972   KMVASVFRLIDRRTEILNDVGEEVARIDGTIELKDVEFSYPSRPDVMIFKDFNLRVDAGR  1031

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVI+LILRFYDP SG+V+ID +DIK LKLKS+RK IGLVQQEPALFA
Sbjct  1032  SMALVGQSGSGKSSVIALILRFYDPTSGRVLIDRRDIKKLKLKSVRKQIGLVQQEPALFA  1091

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENI+YGK+GATE+EV+EAAKLANAH FIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1092  TSIYENIVYGKDGATEAEVVEAAKLANAHGFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1151

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP +LLLDEATSALD ESER+VQQALDRLMK+RT+++VAHRLSTI NADQI VL
Sbjct  1152  ARAVLKNPSVLLLDEATSALDAESERVVQQALDRLMKNRTTIMVAHRLSTITNADQISVL  1211

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             QDGKIIE+GTHS+L+ENRDGAYYKLINLQ+
Sbjct  1212  QDGKIIERGTHSSLVENRDGAYYKLINLQR  1241


 Score =   323 bits (829),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R+T  +  +  G  L +VEG I+ R+V FSYPSRPD  IF    + +  GK +A
Sbjct  329  IFEMIERRTVNKTSSKEGRRLSEVEGHIQFRNVVFSYPSRPDVLIFNRLCLDIPAGKIVA  388

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VIS+I RFY+P+SG++++DG DI+ L L  LR+ IGLV QEPALFAT+I
Sbjct  389  LVGGSGSGKSTVISMIERFYEPLSGQILLDGTDIRELDLNWLRQQIGLVNQEPALFATTI  448

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  ++  AAKL+ A +FIS LPE + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  449  RENILYGKDDATAEDITRAAKLSEAINFISNLPERFETQVGERGIQLSGGQKQRIAISRA  508

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  509  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQNG  568

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             IIE G+H  LI   + AY  L+ LQ+
Sbjct  569  AIIETGSHEELISRPNSAYATLVQLQE  595



>ref|XP_011018527.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1193

 Score =   469 bits (1207),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/272 (83%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASV E+LDRKT+++ DVGEEL  V+GTIELR V+FSYPSRPDT IF DF++RVR GK
Sbjct  910   QMAASVLEILDRKTQVMGDVGEELKNVKGTIELRGVQFSYPSRPDTLIFMDFDLRVRSGK  969

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKVMIDG D++ LK+KSLRKHIGLVQQEPALFA
Sbjct  970   SMALVGQSGSGKSSVLSLILRFYDPTAGKVMIDGIDVRKLKVKSLRKHIGLVQQEPALFA  1029

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+E+IEAAKLANAH FIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1030  TTIYENILYGKEGASETELIEAAKLANAHGFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1089

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESE IVQQALDRLM +RT+V+VAHRLSTIK+ADQI VL
Sbjct  1090  ARAVLKNPEILLLDEATSALDVESESIVQQALDRLMTNRTTVMVAHRLSTIKDADQISVL  1149

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKIIEQGTHS+LIEN+DG+Y+KL  LQQ Q
Sbjct  1150  QGGKIIEQGTHSSLIENKDGSYFKLFRLQQQQ  1181


 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 207/269 (77%), Gaps = 6/269 (2%)
 Frame = -2

Query  880  VFEVLDRKTEILADVG----EELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            +FE+++R T  L++      ++L KV+G IE +DV F YPSRPD  IF  F + +  GK 
Sbjct  281  IFEMIERNT--LSNTSTKSIKKLEKVDGHIEFKDVCFGYPSRPDVTIFDKFCLDIPSGKI  338

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
            +ALVG SGSGKS++ISLI RFY+P+ G++++DG DI++L LK LR+ IGLV QEPALFA 
Sbjct  339  VALVGGSGSGKSTLISLIERFYEPLFGQILLDGNDIRDLDLKWLREQIGLVNQEPALFAA  398

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            SI ENILYGKE AT  E+  AA L+ A SFI+ LP+ + T+VGERG+QLSGGQKQR+A++
Sbjct  399  SIRENILYGKENATLEEITRAATLSEAMSFINNLPDRFETQVGERGIQLSGGQKQRIALS  458

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLSTI+NAD I V+Q
Sbjct  459  RAIVKNPCILLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTIRNADVIAVVQ  518

Query  172  DGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +GKI+E G+H  LI N    Y  L++LQ+
Sbjct  519  EGKIVEIGSHEELISNPQSTYASLVHLQE  547



>ref|XP_011018526.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1253

 Score =   468 bits (1205),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/272 (83%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASV E+LDRKT+++ DVGEEL  V+GTIELR V+FSYPSRPDT IF DF++RVR GK
Sbjct  970   QMAASVLEILDRKTQVMGDVGEELKNVKGTIELRGVQFSYPSRPDTLIFMDFDLRVRSGK  1029

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GKVMIDG D++ LK+KSLRKHIGLVQQEPALFA
Sbjct  1030  SMALVGQSGSGKSSVLSLILRFYDPTAGKVMIDGIDVRKLKVKSLRKHIGLVQQEPALFA  1089

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+E+IEAAKLANAH FIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1090  TTIYENILYGKEGASETELIEAAKLANAHGFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1149

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESE IVQQALDRLM +RT+V+VAHRLSTIK+ADQI VL
Sbjct  1150  ARAVLKNPEILLLDEATSALDVESESIVQQALDRLMTNRTTVMVAHRLSTIKDADQISVL  1209

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKIIEQGTHS+LIEN+DG+Y+KL  LQQ Q
Sbjct  1210  QGGKIIEQGTHSSLIENKDGSYFKLFRLQQQQ  1241


 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 207/269 (77%), Gaps = 6/269 (2%)
 Frame = -2

Query  880  VFEVLDRKTEILADVG----EELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            +FE+++R T  L++      ++L KV+G IE +DV F YPSRPD  IF  F + +  GK 
Sbjct  341  IFEMIERNT--LSNTSTKSIKKLEKVDGHIEFKDVCFGYPSRPDVTIFDKFCLDIPSGKI  398

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
            +ALVG SGSGKS++ISLI RFY+P+ G++++DG DI++L LK LR+ IGLV QEPALFA 
Sbjct  399  VALVGGSGSGKSTLISLIERFYEPLFGQILLDGNDIRDLDLKWLREQIGLVNQEPALFAA  458

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            SI ENILYGKE AT  E+  AA L+ A SFI+ LP+ + T+VGERG+QLSGGQKQR+A++
Sbjct  459  SIRENILYGKENATLEEITRAATLSEAMSFINNLPDRFETQVGERGIQLSGGQKQRIALS  518

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLSTI+NAD I V+Q
Sbjct  519  RAIVKNPCILLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTIRNADVIAVVQ  578

Query  172  DGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +GKI+E G+H  LI N    Y  L++LQ+
Sbjct  579  EGKIVEIGSHEELISNPQSTYASLVHLQE  607



>ref|XP_007158282.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
 gb|ESW30276.1| hypothetical protein PHAVU_002G139400g [Phaseolus vulgaris]
Length=1245

 Score =   466 bits (1199),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 224/267 (84%), Positives = 251/267 (94%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DRK+ I+ DVGEEL  VEGTI+L+ + FSYPSRPD  IFKDF++RV  GK
Sbjct  970   QMVASVFEVMDRKSGIVGDVGEELKTVEGTIDLKRINFSYPSRPDVIIFKDFSLRVPAGK  1029

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVISLILRFYDPISG+V+IDGKDI  L LKSLR+HIGLVQQEPALFA
Sbjct  1030  SVALVGQSGSGKSSVISLILRFYDPISGRVLIDGKDITKLNLKSLRRHIGLVQQEPALFA  1089

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA++SEVIEAAKLANAH+FIS LPEGYSTKVGERGVQLSGGQ+QRVAI
Sbjct  1090  TSIYENILYGKEGASDSEVIEAAKLANAHNFISGLPEGYSTKVGERGVQLSGGQRQRVAI  1149

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTI+NADQI VL
Sbjct  1150  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMQNRTTVMVAHRLSTIRNADQISVL  1209

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             QDGKIIEQGTHS+LIEN++G Y+KL+N
Sbjct  1210  QDGKIIEQGTHSSLIENKNGPYFKLVN  1236


 Score =   319 bits (818),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L K+EG I+ ++V FSYPSRPD  IF + ++ +  GK +A
Sbjct  337  IFEMIERDTVSKSSSKTGRKLGKLEGHIQFKNVCFSYPSRPDVAIFNNLSLDIPSGKIVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++D  DI+ L LK LR+ IGLV QEPALFATSI
Sbjct  397  LVGGSGSGKSTVISLIERFYEPLSGQILLDRNDIRELDLKWLRQQIGLVNQEPALFATSI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  A KL++A SFI  LP+   T+VGERG+QLSGGQKQR+AI+RA
Sbjct  457  KENILYGKDDATLEELKRAVKLSDAQSFIGNLPDRLDTQVGERGIQLSGGQKQRIAISRA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  517  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQGG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  L+ N    Y  L+ LQ+
Sbjct  577  KIVETGNHQELMSNPTSVYASLVQLQE  603



>ref|XP_011082358.1| PREDICTED: ABC transporter B family member 2-like [Sesamum indicum]
Length=1260

 Score =   463 bits (1191),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 257/268 (96%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDR+TEI+ DVGEE+ +V+GTIEL+DVEFSYPSRP+  IFKDFN+RV+ G+
Sbjct  985   QMVASVFEVLDRRTEIVNDVGEEISRVDGTIELKDVEFSYPSRPNVLIFKDFNLRVQAGR  1044

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVI+LILRFYDP SGKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1045  SMALVGQSGSGKSSVIALILRFYDPTSGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1104

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGATE E+IEAAKLANAHSFI ALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1105  TSIYENILYGKEGATEGEIIEAAKLANAHSFIDALPEGYSTKVGERGVQLSGGQKQRVAI  1164

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLMKSRT+VVVAHRLSTIKN+DQI VL
Sbjct  1165  ARAILKNPSILLLDEATSALDVESERVVQQALDRLMKSRTTVVVAHRLSTIKNSDQISVL  1224

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDG+IIEQGTHS+L+EN+DGAYYKLI+L
Sbjct  1225  QDGRIIEQGTHSSLVENKDGAYYKLISL  1252


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KV+G I+ ++V FSYPSRPD  IF    + +  GK +A
Sbjct  354  IFEMIERNTVSKTSSKYGRKLSKVDGHIQFKNVMFSYPSRPDVLIFNKLCLDIPAGKIVA  413

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG +++DG DI+ L LK LR+ IGLV QEPALFAT+I
Sbjct  414  LVGGSGSGKSTVISLIERFYEPSSGHILLDGTDIRELDLKWLRQQIGLVNQEPALFATTI  473

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             +NILYGK  AT  E+  AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  474  RDNILYGKNDATAEEITRAAKLSEAINFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  533

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI++AD I V+Q+G
Sbjct  534  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRHADVIAVVQNG  593

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             I+E G+H  LI   + AY  L+ LQ+
Sbjct  594  AIVETGSHEELISRPNSAYASLVQLQE  620



>gb|KDP36504.1| hypothetical protein JCGZ_09330 [Jatropha curcas]
Length=1126

 Score =   459 bits (1180),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT I  D+GEEL  VEGTIELR +EFSYPSRPD  IFKDF++RVR GK
Sbjct  850   QMVASVFELLDRKTHITGDIGEELKNVEGTIELRGIEFSYPSRPDVLIFKDFDLRVRSGK  909

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             ++ALVGQSGSGKSSV++LILRFYDP +GKV+IDG DIK LKLKSLRKHIGLVQQEPALFA
Sbjct  910   TVALVGQSGSGKSSVLALILRFYDPTAGKVIIDGIDIKKLKLKSLRKHIGLVQQEPALFA  969

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA E+EVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  970   TSIYENILYGKEGAFEAEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1029

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQA+DRLM++RT+++VAHRLSTIKNADQI V+
Sbjct  1030  ARAVLKNPEILLLDEATSALDVESERVVQQAIDRLMRNRTTIMVAHRLSTIKNADQISVI  1089

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDGKIIEQGTHS+L+EN DGAY+KLI+LQQ Q
Sbjct  1090  QDGKIIEQGTHSSLLENIDGAYFKLISLQQQQ  1121


 Score =   333 bits (855),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G  L K+EG IELRDV FSYPSRPD  IF    + +  GK +A
Sbjct  218  IFEMIERNTVAKTSSKTGRVLDKLEGHIELRDVCFSYPSRPDVMIFDKLCLDIPSGKIVA  277

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG DIK+L LK LR+ IGLV QEPALFATSI
Sbjct  278  LVGGSGSGKSTVISLIERFYEPLSGQILLDGNDIKHLDLKWLRQQIGLVNQEPALFATSI  337

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  338  RENILYGKDNATLDEITNAAKLSEAISFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  397

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  398  IVKNPSILLLDEATSALDAESEKSVQEALDRAMVGRTTVVVAHRLSTIRNADVIAVVQEG  457

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             I+E G+H  LI N + AY  LI+LQ+
Sbjct  458  NIVEIGSHEELISNPNSAYGSLIHLQE  484



>ref|NP_172538.1| ABC transporter B family member 10 [Arabidopsis thaliana]
 sp|Q9SGY1.2|AB10B_ARATH RecName: Full=ABC transporter B family member 10; Short=ABC transporter 
ABCB.10; Short=AtABCB10; AltName: Full=Multidrug 
resistance protein 10; AltName: Full=P-glycoprotein 10 [Arabidopsis 
thaliana]
 gb|AEE28628.1| ABC transporter B family member 10 [Arabidopsis thaliana]
Length=1227

 Score =   459 bits (1180),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/274 (79%), Positives = 250/274 (91%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV SVFE+LDR+T+++ D GEEL  VEGTIEL+ V FSYPSRPD  IF DFN+ V  GK
Sbjct  952   QMVVSVFELLDRRTQVVGDTGEELSNVEGTIELKGVHFSYPSRPDVTIFSDFNLLVPSGK  1011

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SL+LRFYDP +G +MIDG+DIK LKLKSLR+HIGLVQQEPALFA
Sbjct  1012  SMALVGQSGSGKSSVLSLVLRFYDPTAGIIMIDGQDIKKLKLKSLRRHIGLVQQEPALFA  1071

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1072  TTIYENILYGKEGASESEVMEAAKLANAHSFISSLPEGYSTKVGERGIQMSGGQRQRIAI  1131

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM+ RT+VVVAHRLSTIKN+D I V+
Sbjct  1132  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRDRTTVVVAHRLSTIKNSDMISVI  1191

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKIIEQG+H+ L+EN++G Y KLI+LQQ Q+ 
Sbjct  1192  QDGKIIEQGSHNILVENKNGPYSKLISLQQRQRH  1225


 Score =   333 bits (853),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 203/265 (77%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R TE     G +L  V G I  +DV F+YPSRPD  IF   N  +  GK +ALV
Sbjct  338  IFQMIERNTE--DKTGRKLGNVNGDILFKDVTFTYPSRPDVVIFDKLNFVIPAGKVVALV  395

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L LK LR HIGLV QEP LFAT+I E
Sbjct  396  GGSGSGKSTMISLIERFYEPTDGAVMLDGNDIRYLDLKWLRGHIGLVNQEPVLFATTIRE  455

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR++I+RA++
Sbjct  456  NIMYGKDDATSEEITNAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRISISRAIV  515

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+IVQ+ALDR+M  RT+VVVAHRLST++NAD I V+  GKI
Sbjct  516  KNPSILLLDEATSALDAESEKIVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVGGGKI  575

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +Q+
Sbjct  576  IESGSHDELISNPDGAYSSLLRIQE  600



>ref|XP_010055296.1| PREDICTED: ABC transporter B family member 2-like isoform X3 
[Eucalyptus grandis]
Length=1051

 Score =   454 bits (1167),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 227/273 (83%), Positives = 257/273 (94%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTE++ DVGEEL  VEG +ELR V FSYPSRPD  IF++F+++VR GK
Sbjct  779   QMVASVFEVLDRKTEVMGDVGEELTTVEGMVELRGVHFSYPSRPDVIIFRNFDLKVRSGK  838

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             +MALVGQSGSGKSSV++LILRFYDP++G+VMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  839   NMALVGQSGSGKSSVLTLILRFYDPMAGEVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  898

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIY+NI+YGKEGA+E EV EAAKLANAH+FIS+LPEGYSTKVG+RGVQLSGGQKQRVAI
Sbjct  899   TSIYDNIIYGKEGASEGEVFEAAKLANAHNFISSLPEGYSTKVGDRGVQLSGGQKQRVAI  958

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNPEILLLDEATSALD+ESERIVQQALDRLM++RT+++VAHRLSTIKNADQI V+
Sbjct  959   ARAILKNPEILLLDEATSALDMESERIVQQALDRLMRNRTTIMVAHRLSTIKNADQISVI  1018

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             Q+GKIIEQGTHS L+ENRDG YYKLINLQQ QQ
Sbjct  1019  QNGKIIEQGTHSALVENRDGPYYKLINLQQQQQ  1051


 Score =   334 bits (856),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G++L  VEG I+ +DV FSYPSRPD  IF    + + PGK MA
Sbjct  147  IFEMIERSTMSKTSSKTGQKLSNVEGHIQFKDVMFSYPSRPDVVIFNKLCLNIAPGKIMA  206

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+VISLI RFY+P++G++++DG ++K++ LK LR+ IGLV QEPALFATSI
Sbjct  207  IVGGSGSGKSTVISLIERFYEPLAGEILLDGYNLKDIDLKWLRQQIGLVNQEPALFATSI  266

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAK++ A SFI+ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  267  RENILYGKDKATLDEITRAAKMSEALSFINNLPERFETQVGERGIQLSGGQKQRIAIARA  326

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+R M  RT+VV+AHRLST++NAD I V+QDG
Sbjct  327  IVKNPSILLLDEATSALDAESEKSVQEALNRAMVGRTTVVIAHRLSTVRNADVISVVQDG  386

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N + AY  L+ LQ+
Sbjct  387  KIVETGNHDELISNPNSAYASLVQLQE  413



>ref|XP_010274280.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Nelumbo nucifera]
Length=1094

 Score =   454 bits (1167),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTE++ DVGEE+ KVEGTIEL+ VEFSYPSRPD+ IFKDF++RVR G 
Sbjct  815   QMVASVFEVLDRKTEVVGDVGEEVTKVEGTIELKRVEFSYPSRPDSIIFKDFDLRVRAGN  874

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKSSV+SLILRFYDP  GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  875   SMALVGASGSGKSSVLSLILRFYDPTYGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  934

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+EVIEAAKLANAH+FIS LPEGY TKVGERGVQLSGGQKQRVAI
Sbjct  935   TTIYENILYGKEGASEAEVIEAAKLANAHTFISGLPEGYRTKVGERGVQLSGGQKQRVAI  994

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALDVESERIVQQALDRLMK+RT+VVVAHRLSTI+NADQI V+
Sbjct  995   ARAVLKDPAILLLDEATSALDVESERIVQQALDRLMKNRTTVVVAHRLSTIQNADQISVI  1054

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQGTH  LIEN+DGAYYKLINL
Sbjct  1055  QDGKIIEQGTHFRLIENKDGAYYKLINL  1082


 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F+++++ T  +  A  G  L KVEG I+ +DV F YPSRP   IF   ++ +  GK +A
Sbjct  183  IFKMIEKSTVSQASAKNGRTLSKVEGHIQFKDVYFCYPSRPHVVIFDQLSLNIPSGKVVA  242

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+VISLI RFY+P+SG++++DG DIK L LK LR+ IGLV QEPALFAT+I
Sbjct  243  IVGGSGSGKSTVISLIERFYEPLSGQILLDGNDIKELDLKWLRQKIGLVNQEPALFATTI  302

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LP  Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  303  RENILYGKDDATLDEITRAAKLSEAISFINNLPNRYETQVGERGIQLSGGQKQRIAISRA  362

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQQALDRLM  RT+VVVAHRLSTI+NAD I V+QD 
Sbjct  363  ILKNPSILLLDEATSALDAESEKSVQQALDRLMVGRTTVVVAHRLSTIRNADIIAVVQDS  422

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  L+ N + AY  L++LQ+
Sbjct  423  KIVETGSHEELMSNPNSAYATLVHLQE  449



>gb|AAF17668.1|AC009398_17 F20B24.12 [Arabidopsis thaliana]
Length=1316

 Score =   458 bits (1179),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/274 (79%), Positives = 250/274 (91%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV SVFE+LDR+T+++ D GEEL  VEGTIEL+ V FSYPSRPD  IF DFN+ V  GK
Sbjct  1041  QMVVSVFELLDRRTQVVGDTGEELSNVEGTIELKGVHFSYPSRPDVTIFSDFNLLVPSGK  1100

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SL+LRFYDP +G +MIDG+DIK LKLKSLR+HIGLVQQEPALFA
Sbjct  1101  SMALVGQSGSGKSSVLSLVLRFYDPTAGIIMIDGQDIKKLKLKSLRRHIGLVQQEPALFA  1160

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1161  TTIYENILYGKEGASESEVMEAAKLANAHSFISSLPEGYSTKVGERGIQMSGGQRQRIAI  1220

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM+ RT+VVVAHRLSTIKN+D I V+
Sbjct  1221  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRDRTTVVVAHRLSTIKNSDMISVI  1280

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             QDGKIIEQG+H+ L+EN++G Y KLI+LQQ Q+ 
Sbjct  1281  QDGKIIEQGSHNILVENKNGPYSKLISLQQRQRH  1314


 Score =   318 bits (814),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/292 (56%), Positives = 203/292 (70%), Gaps = 29/292 (10%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R TE     G +L  V G I  +DV F+YPSRPD  IF   N  +  GK +ALV
Sbjct  375  IFQMIERNTE--DKTGRKLGNVNGDILFKDVTFTYPSRPDVVIFDKLNFVIPAGKVVALV  432

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L LK LR HIGLV QEP LFAT+I E
Sbjct  433  GGSGSGKSTMISLIERFYEPTDGAVMLDGNDIRYLDLKWLRGHIGLVNQEPVLFATTIRE  492

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYST------------------------  413
            NI+YGK+ AT  E+  AAKL+ A SFI+ LPEG+ T                        
Sbjct  493  NIMYGKDDATSEEITNAAKLSEAISFINNLPEGFETQVCRTSDSLEHKKLTTVNPRFCLL  552

Query  412  ---KVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKS  242
               +VGERG+QLSGGQKQR++I+RA++KNP ILLLDEATSALD ESE+IVQ+ALDR+M  
Sbjct  553  FGLQVGERGIQLSGGQKQRISISRAIVKNPSILLLDEATSALDAESEKIVQEALDRVMVG  612

Query  241  RTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            RT+VVVAHRLST++NAD I V+  GKIIE G+H  LI N DGAY  L+ +Q+
Sbjct  613  RTTVVVAHRLSTVRNADIIAVVGGGKIIESGSHDELISNPDGAYSSLLRIQE  664



>ref|XP_002277547.1| PREDICTED: ABC transporter B family member 2 [Vitis vinifera]
 emb|CBI33860.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   457 bits (1175),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 255/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKTE++ D GEEL +VEGTI+L+ +EF YPSRPD  IFKDF++RVR GK
Sbjct  969   QMVASVFELMDRKTEVMGDAGEELTRVEGTIDLKGIEFRYPSRPDVVIFKDFDLRVRAGK  1028

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDPI+GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1029  SMALVGQSGSGKSSVLSLILRFYDPIAGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1088

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI+ENILYGKEGA+E+EV+EAAKLANAHSFI  LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1089  TSIFENILYGKEGASEAEVMEAAKLANAHSFICGLPEGYSTKVGERGVQLSGGQKQRVAI  1148

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM +RT+V+VAHRLSTIKNADQI V+
Sbjct  1149  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMVNRTTVLVAHRLSTIKNADQISVI  1208

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQGTHSTL+ENR+GAY+KLINL
Sbjct  1209  QDGKIIEQGTHSTLVENREGAYFKLINL  1236


 Score =   332 bits (851),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 206/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T     +  G +L K+EG I+ RD+ FSYPSRPD  IF      +  GK +A
Sbjct  337  IFEMIERNTISNTNSKTGRQLHKLEGHIQFRDISFSYPSRPDILIFNKLCFDIPSGKIVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++DG DI+ L L+ LR+ IGLV QEPALFATSI
Sbjct  397  LVGGSGSGKSTVISLIERFYEPLAGEILLDGNDIRQLDLQWLRQQIGLVNQEPALFATSI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LP+ Y T+VGERG+QLSGGQKQR+AIARA
Sbjct  457  RENILYGKDDATLDEITRAAKLSEAISFINNLPDRYETQVGERGIQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  517  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADMIAVVQHG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N   AY  L+ LQ+
Sbjct  577  KIVETGSHEELISNPSSAYASLVQLQE  603



>gb|AAF23176.1|AF216497_1 P-glycoprotein [Gossypium hirsutum]
Length=1249

 Score =   456 bits (1174),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKT+++ D GEEL  VEGTIEL+ V FSYPSRPD  IFKDF+++VR GK
Sbjct  974   QMVASVFEIMDRKTQVVGDAGEELTNVEGTIELKGVHFSYPSRPDVVIFKDFDLKVRSGK  1033

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP SGKVMIDG+D+K LKLKSLRKHIGLVQQEPALFA
Sbjct  1034  SMALVGQSGSGKSSVLALILRFYDPTSGKVMIDGRDVKKLKLKSLRKHIGLVQQEPALFA  1093

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1094  TSIYENILYGKEGASESEVVEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1153

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTIKNAD+I V+
Sbjct  1154  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVMVAHRLSTIKNADRISVI  1213

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             Q G+IIEQGTHS+LIENR+G Y+KLINL
Sbjct  1214  QGGRIIEQGTHSSLIENRNGPYFKLINL  1241


 Score =   333 bits (854),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 212/270 (79%), Gaps = 5/270 (2%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KVEG IEL++V FSYPSRPD  IF  F + +  GK +A
Sbjct  342  IFEMIERNTVSKTSSKTGRKLSKVEGNIELKNVSFSYPSRPDVVIFDRFCLNIPTGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++DG +IK L LK LR+ IGLV QEPALFAT+I
Sbjct  402  LVGGSGSGKSTVISLIERFYEPLAGEILLDGNNIKGLDLKWLRQQIGLVNQEPALFATTI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDDATVDEITRAAKLSEAIAFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  522  IVKNPPILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQNG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            KI+E GTH  LI N +  Y  L+   QHQ+
Sbjct  582  KIVETGTHDELISNPNSTYSSLV---QHQE  608



>ref|XP_010055295.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Eucalyptus grandis]
Length=1134

 Score =   454 bits (1167),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 227/273 (83%), Positives = 257/273 (94%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTE++ DVGEEL  VEG +ELR V FSYPSRPD  IF++F+++VR GK
Sbjct  862   QMVASVFEVLDRKTEVMGDVGEELTTVEGMVELRGVHFSYPSRPDVIIFRNFDLKVRSGK  921

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             +MALVGQSGSGKSSV++LILRFYDP++G+VMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  922   NMALVGQSGSGKSSVLTLILRFYDPMAGEVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  981

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIY+NI+YGKEGA+E EV EAAKLANAH+FIS+LPEGYSTKVG+RGVQLSGGQKQRVAI
Sbjct  982   TSIYDNIIYGKEGASEGEVFEAAKLANAHNFISSLPEGYSTKVGDRGVQLSGGQKQRVAI  1041

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNPEILLLDEATSALD+ESERIVQQALDRLM++RT+++VAHRLSTIKNADQI V+
Sbjct  1042  ARAILKNPEILLLDEATSALDMESERIVQQALDRLMRNRTTIMVAHRLSTIKNADQISVI  1101

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             Q+GKIIEQGTHS L+ENRDG YYKLINLQQ QQ
Sbjct  1102  QNGKIIEQGTHSALVENRDGPYYKLINLQQQQQ  1134


 Score =   334 bits (856),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G++L  VEG I+ +DV FSYPSRPD  IF    + + PGK MA
Sbjct  230  IFEMIERSTMSKTSSKTGQKLSNVEGHIQFKDVMFSYPSRPDVVIFNKLCLNIAPGKIMA  289

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+VISLI RFY+P++G++++DG ++K++ LK LR+ IGLV QEPALFATSI
Sbjct  290  IVGGSGSGKSTVISLIERFYEPLAGEILLDGYNLKDIDLKWLRQQIGLVNQEPALFATSI  349

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAK++ A SFI+ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  350  RENILYGKDKATLDEITRAAKMSEALSFINNLPERFETQVGERGIQLSGGQKQRIAIARA  409

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+R M  RT+VV+AHRLST++NAD I V+QDG
Sbjct  410  IVKNPSILLLDEATSALDAESEKSVQEALNRAMVGRTTVVIAHRLSTVRNADVISVVQDG  469

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N + AY  L+ LQ+
Sbjct  470  KIVETGNHDELISNPNSAYASLVQLQE  496



>ref|XP_010458427.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1226

 Score =   455 bits (1171),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 214/270 (79%), Positives = 252/270 (93%), Gaps = 0/270 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T+++ D GEEL  VEG IEL+DV FSYPSRPD  IF DFN++VR GK
Sbjct  953   QMVASVFELLDRRTKVVGDTGEELSNVEGKIELKDVHFSYPSRPDVTIFSDFNLKVRSGK  1012

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LKL S+R+HIGLVQQEPALFA
Sbjct  1013  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIKKLKLNSMRRHIGLVQQEPALFA  1072

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1073  TSIYENILYGKEGASESEVMEAAKLANAHSFISSLPEGYSTKVGERGIQMSGGQRQRIAI  1132

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALD+LMK+RT+VVVAHRLSTIKN+D I V+
Sbjct  1133  ARAVLKNPEILLLDEATSALDVESERVVQQALDQLMKNRTTVVVAHRLSTIKNSDMISVI  1192

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             Q+GKII+QG+HS+L+++++G Y KLI+LQ+
Sbjct  1193  QEGKIIQQGSHSSLVKDKNGPYSKLISLQR  1222


 Score =   330 bits (847),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 204/265 (77%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            + +++DR TE+    G +L +V G I L+DV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  338  IIQMIDRNTEV--KTGRKLGEVVGDIHLKDVTFTYPSRPDVVIFDKLNLVIPAGKVVALV  395

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L LK LR HIGLV QE ALFAT+I E
Sbjct  396  GGSGSGKSTLISLIERFYEPTQGAVMLDGNDIRYLDLKWLRGHIGLVNQEHALFATTIRE  455

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGKE AT  ++  AAKL  A SFI+ LPEG+ T+VGERG+QLSGGQKQR+ I+RA++
Sbjct  456  NIMYGKEDATTEDITHAAKLTEAISFINNLPEGFETQVGERGIQLSGGQKQRITISRAIV  515

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT++VVAHRLST++NAD I V+  GKI
Sbjct  516  KNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTIVVAHRLSTVRNADIIAVVGGGKI  575

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H+ LI N DGAY  L+ +Q+
Sbjct  576  IESGSHNELISNPDGAYSSLLRIQE  600



>gb|KJB21121.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1281

 Score =   456 bits (1173),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 228/267 (85%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKT+++ D GEEL  VEGTIEL+ V FSYPSRPD  IFKDF+++VR GK
Sbjct  1006  QMVASVFEIMDRKTQVVGDAGEELTNVEGTIELKGVHFSYPSRPDVVIFKDFDLKVRSGK  1065

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP SGKVMIDG+DIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1066  SMALVGQSGSGKSSVLALILRFYDPTSGKVMIDGRDIKKLKLKSLRKHIGLVQQEPALFA  1125

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1126  TSIYENILYGKEGASESEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1185

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTIKNAD+I V+
Sbjct  1186  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVMVAHRLSTIKNADRISVI  1245

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             Q G+IIEQGTHS+LIENR+G Y+KLIN
Sbjct  1246  QGGRIIEQGTHSSLIENRNGPYFKLIN  1272


 Score =   335 bits (858),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 212/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KVEG IEL++V FSYPSRPD  IF  F++ +  GK +A
Sbjct  374  IFEMIERNTVSKTSSKTGRKLSKVEGNIELKNVSFSYPSRPDVVIFDRFSLNIPAGKIVA  433

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++DG +IK+L LK LR+ IGLV QEPALFAT+I
Sbjct  434  LVGGSGSGKSTVISLIERFYEPLAGEILLDGNNIKDLDLKWLRQQIGLVNQEPALFATTI  493

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  494  RENILYGKDDATLDEITRAAKLSEAIAFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  553

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  554  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQSG  613

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E GTH  LI N +  Y  L+ LQ+
Sbjct  614  KIVETGTHDELISNPNSTYSSLVQLQE  640



>ref|XP_010491749.1| PREDICTED: ABC transporter B family member 10 [Camelina sativa]
Length=1226

 Score =   454 bits (1169),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/270 (80%), Positives = 252/270 (93%), Gaps = 0/270 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T+++ D GEEL  VEG IEL+DV FSYPSRPD  IF DFN++VR GK
Sbjct  953   QMVASVFELLDRRTKVVGDTGEELSNVEGKIELKDVHFSYPSRPDVTIFSDFNLKVRSGK  1012

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LKL S+R+HIGLVQQEPALFA
Sbjct  1013  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIKKLKLDSVRRHIGLVQQEPALFA  1072

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1073  TSIYENILYGKEGASESEVMEAAKLANAHSFISSLPEGYSTKVGERGIQMSGGQRQRIAI  1132

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALD+LMK+RT+VVVAHRLSTIKN+D I V+
Sbjct  1133  ARAVLKNPEILLLDEATSALDVESERVVQQALDQLMKNRTTVVVAHRLSTIKNSDMISVI  1192

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             Q+GKII+QG+HS+LI++++G Y KLI+LQ+
Sbjct  1193  QEGKIIQQGSHSSLIKDKNGPYSKLISLQR  1222


 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 202/265 (76%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            + ++++R TE+    G +L +V G I  +DV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  338  IIQMIERNTEV--KTGRKLGEVVGDIHFKDVTFTYPSRPDVVIFDKLNLVIPAGKVVALV  395

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L L  LR HIGLV QEPALFAT+I E
Sbjct  396  GGSGSGKSTMISLIERFYEPTQGAVMLDGNDIRYLDLMWLRGHIGLVNQEPALFATTIRE  455

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGKE AT  E+  AAKL  A SFI+ LPEG+ T+VGERG+QLSGGQKQR+ I+R ++
Sbjct  456  NIMYGKEDATTDEITHAAKLTEAISFINNLPEGFETQVGERGIQLSGGQKQRITISREIV  515

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT++VVAHRLST++NAD I V+  GKI
Sbjct  516  KNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTIVVAHRLSTVRNADIIAVVGGGKI  575

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H+ LI N DGAY  L+ +Q+
Sbjct  576  IESGSHNELISNPDGAYSSLLRIQE  600



>ref|XP_008800115.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1250

 Score =   455 bits (1170),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV SVFEV+DRKTE+L DVGE++ +VEG IE++ V+F YP RP+  IFKDF+++V+ GK
Sbjct  975   QMVGSVFEVIDRKTEVLGDVGEDVGRVEGAIEMKGVKFCYPFRPEAIIFKDFDLKVKAGK  1034

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKSSV++LILRFYDPI+GKV+IDGKDIK L+LKSLR HIGLVQQEPALFA
Sbjct  1035  SMALVGTSGSGKSSVLALILRFYDPIAGKVLIDGKDIKKLRLKSLRMHIGLVQQEPALFA  1094

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIY+NILYGK+GATE+EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1095  TSIYDNILYGKDGATEAEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  1154

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++KNP ILLLDEATSALDVESER+VQQALDR+MK+RT+V+VAHRLSTI+NAD I VL
Sbjct  1155  ARAIIKNPAILLLDEATSALDVESERVVQQALDRVMKNRTTVMVAHRLSTIQNADVISVL  1214

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             Q+GKIIEQG HSTL+EN++GAY+KLI+L
Sbjct  1215  QNGKIIEQGDHSTLVENKNGAYFKLISL  1242


 Score =   328 bits (841),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/273 (61%), Positives = 208/273 (76%), Gaps = 3/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G  L  VEG I+  +V FSYPSRPD  IF   N+ +  GK +A
Sbjct  342  IFKMIERNTVNKTSARTGRTLPSVEGHIQFCNVCFSYPSRPDVFIFNGLNLDIPSGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+ G +++DG +IK L+LK LR+ IGLV QEPALFATSI
Sbjct  402  LVGGSGSGKSTVISLIERFYEPLFGAILLDGHNIKELELKWLRQQIGLVNQEPALFATSI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A +FI+ LP+ Y T+VGERGVQLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDDATLDEITRAAKLSEAITFINHLPDRYETQVGERGVQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+QDG
Sbjct  522  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQDG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQ-QQC  71
            K++E GTH  L+ +    Y  L+ LQ+   QQC
Sbjct  582  KVVETGTHEQLMSDPCSNYASLVQLQEASYQQC  614



>ref|XP_009595706.1| PREDICTED: ABC transporter B family member 2-like [Nicotiana 
tomentosiformis]
Length=1256

 Score =   454 bits (1169),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDR+TEIL+D GEE+ +VEG+IE +DVEF YP+RPD  IFKDFNMRV  GK
Sbjct  981   QMVASVFEVLDRRTEILSDTGEEVTRVEGSIEFKDVEFCYPARPDVHIFKDFNMRVHAGK  1040

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMA+VGQSGSGKSSV+SLILRFYDP+SGKV+IDGKDIK LKLKSLRK IGLVQQEPALFA
Sbjct  1041  SMAIVGQSGSGKSSVLSLILRFYDPVSGKVIIDGKDIKKLKLKSLRKLIGLVQQEPALFA  1100

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVI+AAKLANAH+FISALP GYST+VGERGVQLSGGQKQRVAI
Sbjct  1101  TSIYENILYGKEGASEAEVIQAAKLANAHNFISALPHGYSTQVGERGVQLSGGQKQRVAI  1160

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMK+RT+V+VAHRLSTIKNADQI VL
Sbjct  1161  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKNRTTVIVAHRLSTIKNADQISVL  1220

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             +DG+I+EQGTHS L+EN+DGAYYKLIN
Sbjct  1221  RDGRIVEQGTHSALVENKDGAYYKLIN  1247


 Score =   331 bits (848),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G++L KV+G I+ RDV FSYPSRPD  IF  F++ +  GK +A
Sbjct  341  IFEMIERDTVSKTSSKSGQQLSKVDGHIQFRDVCFSYPSRPDVAIFDKFSLDIPSGKIVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG +++DG DI++L LK +R+ IGLV QEPALFAT+I
Sbjct  401  LVGGSGSGKSTVISLIERFYEPLSGHILLDGTDIRHLDLKWMRQQIGLVNQEPALFATTI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  ++  AAKL+ A +FI+ LP+ + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  461  RENILYGKGDASLEDIARAAKLSEAMTFINNLPDRFETQVGERGVQLSGGQKQRIAISRA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ ALDR+M  RT+V+VAHRLSTI+NAD I V+  G
Sbjct  521  IVKNPSILLLDEATSALDAESEKSVQNALDRVMVGRTTVIVAHRLSTIRNADIIAVVNSG  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   DGAY  L+ LQQ
Sbjct  581  KIVETGSHEELISKPDGAYASLVQLQQ  607



>emb|CDY37953.1| BnaC05g08210D [Brassica napus]
Length=1225

 Score =   453 bits (1166),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 248/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+++++ D GEEL  VEGTIEL+ V FSYPSRPD  IF+DF++ V  GK
Sbjct  952   QMVASVFELLDRRSQVVGDKGEELSNVEGTIELKGVHFSYPSRPDVTIFRDFDLTVPCGK  1011

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LKLKSLR+H+GLVQQEPALFA
Sbjct  1012  SMALVGQSGSGKSSVLSLILRFYDPTAGTIMIDGQDIKTLKLKSLRRHVGLVQQEPALFA  1071

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA ESEV+EAAKLANAH FI +LPEGYST+VGERG+Q+SGGQ+QR+AI
Sbjct  1072  TTIYENILYGKEGALESEVMEAAKLANAHDFICSLPEGYSTQVGERGIQMSGGQRQRIAI  1131

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKN+D I V+
Sbjct  1132  ARAVLKNPAILLLDEATSALDVESERVVQQALDRLMSNRTTVVVAHRLSTIKNSDMISVI  1191

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+GKIIEQG+H++LIEN +G Y +LINLQQHQ
Sbjct  1192  QEGKIIEQGSHNSLIENENGPYSRLINLQQHQ  1223


 Score =   331 bits (849),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 201/265 (76%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R  E+    G +L KVEG I+ RDV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  337  IFQMIERNKEV--KTGRKLGKVEGEIQFRDVTFTYPSRPDVVIFDKLNLVIPAGKVVALV  394

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS+VISL  RFY+P  G V +DG DI+ L LK LR HIGLV QEPALFAT+I E
Sbjct  395  GGSGSGKSTVISLTERFYEPTDGAVFLDGNDIRYLDLKWLRGHIGLVNQEPALFATTIRE  454

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT+ E+  A  L+ A SFI+ LP+G  T+VGERGVQLSGGQKQR+ I+RA+L
Sbjct  455  NIMYGKDNATDEEITRAVTLSEAVSFINKLPDGLETQVGERGVQLSGGQKQRITISRAIL  514

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALD++M  RT+VVVAHRLST++NAD I V+  G I
Sbjct  515  KNPSILLLDEATSALDAESEKSVQKALDKVMVGRTTVVVAHRLSTVRNADIIAVVHGGNI  574

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +QQ
Sbjct  575  IESGSHDELISNPDGAYSSLLRIQQ  599



>ref|XP_006413247.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
 gb|ESQ54700.1| hypothetical protein EUTSA_v10024237mg [Eutrema salsugineum]
Length=1239

 Score =   454 bits (1167),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 217/274 (79%), Positives = 246/274 (90%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IFKDF++ VR GK
Sbjct  965   QMVASVFEILDRKTQIVGETNEELTNVEGTIELKGVHFSYPSRPDVVIFKDFDLVVRSGK  1024

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LKSLRKHIGLVQQEPALFA
Sbjct  1025  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKSLRKHIGLVQQEPALFA  1084

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEVIE+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1085  TTIYENILYGNEGASQSEVIESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1144

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1145  ARAILRNPEILLLDEATSALDVESERVVQQALDRLMTNRTTVVVAHRLSTIKNADTISVL  1204

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ 
Sbjct  1205  HGGKIVEQGSHRRLVLNKTGPYFKLISLQQQQQH  1238


 Score =   337 bits (864),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+  DV FSYPSRPD  IF   N+ +  GK +A
Sbjct  338  IFKMIERDTAAKTSAKSGRKLRKVDGQIQFSDVTFSYPSRPDVVIFDKLNLTIPAGKIVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG DIK+L +K LR  IGLV QEPALFAT+I
Sbjct  398  LVGGSGSGKSTVISLIERFYEPISGAVLLDGNDIKDLDIKWLRGQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  458  RENIMYGKDDATAEELGRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  518  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  578  KIVEYGNHENLISNPDGAYSALLRLQE  604



>ref|XP_010274279.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Nelumbo nucifera]
Length=1252

 Score =   454 bits (1167),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTE++ DVGEE+ KVEGTIEL+ VEFSYPSRPD+ IFKDF++RVR G 
Sbjct  973   QMVASVFEVLDRKTEVVGDVGEEVTKVEGTIELKRVEFSYPSRPDSIIFKDFDLRVRAGN  1032

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKSSV+SLILRFYDP  GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1033  SMALVGASGSGKSSVLSLILRFYDPTYGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1092

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+EVIEAAKLANAH+FIS LPEGY TKVGERGVQLSGGQKQRVAI
Sbjct  1093  TTIYENILYGKEGASEAEVIEAAKLANAHTFISGLPEGYRTKVGERGVQLSGGQKQRVAI  1152

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALDVESERIVQQALDRLMK+RT+VVVAHRLSTI+NADQI V+
Sbjct  1153  ARAVLKDPAILLLDEATSALDVESERIVQQALDRLMKNRTTVVVAHRLSTIQNADQISVI  1212

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQGTH  LIEN+DGAYYKLINL
Sbjct  1213  QDGKIIEQGTHFRLIENKDGAYYKLINL  1240


 Score =   330 bits (846),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F+++++ T  +  A  G  L KVEG I+ +DV F YPSRP   IF   ++ +  GK +A
Sbjct  341  IFKMIEKSTVSQASAKNGRTLSKVEGHIQFKDVYFCYPSRPHVVIFDQLSLNIPSGKVVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+VISLI RFY+P+SG++++DG DIK L LK LR+ IGLV QEPALFAT+I
Sbjct  401  IVGGSGSGKSTVISLIERFYEPLSGQILLDGNDIKELDLKWLRQKIGLVNQEPALFATTI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LP  Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  461  RENILYGKDDATLDEITRAAKLSEAISFINNLPNRYETQVGERGIQLSGGQKQRIAISRA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQQALDRLM  RT+VVVAHRLSTI+NAD I V+QD 
Sbjct  521  ILKNPSILLLDEATSALDAESEKSVQQALDRLMVGRTTVVVAHRLSTIRNADIIAVVQDS  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  L+ N + AY  L++LQ+
Sbjct  581  KIVETGSHEELMSNPNSAYATLVHLQE  607



>ref|XP_006303653.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
 gb|EOA36551.1| hypothetical protein CARUB_v10011664mg [Capsella rubella]
Length=1229

 Score =   453 bits (1166),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 216/274 (79%), Positives = 253/274 (92%), Gaps = 1/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T+++ D GEEL  VEGTIEL  V FSYPSRPD  IF DFN++V  GK
Sbjct  954   QMVASVFELLDRRTKVVGDTGEELSNVEGTIELEGVYFSYPSRPDVTIFSDFNLKVPSGK  1013

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LKLKS+R+HIGLVQQEPALFA
Sbjct  1014  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIKKLKLKSMRRHIGLVQQEPALFA  1073

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEV+EAA LANAHSFIS+LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1074  TSIYENILYGKEGASESEVMEAANLANAHSFISSLPEGYSTKVGERGIQMSGGQRQRIAI  1133

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALD+LM++RT+VVVAHRLSTIKN+D I V+
Sbjct  1134  ARAVLKNPEILLLDEATSALDVESERVVQQALDQLMRNRTTVVVAHRLSTIKNSDMISVI  1193

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             Q+G+IIEQG+HS+L+++++G Y KLI+L QHQQQ
Sbjct  1194  QEGRIIEQGSHSSLVKDKNGPYSKLISL-QHQQQ  1226


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 203/265 (77%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            + ++++R T +    G EL KV G I+ RDV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  339  IIQMIERNTNV--KTGRELGKVVGDIQFRDVTFTYPSRPDVVIFDKLNLVIPAGKVVALV  396

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L LK LR HIGLV QEP+LFAT+I E
Sbjct  397  GGSGSGKSTIISLIERFYEPTEGVVMLDGNDIRYLDLKWLRGHIGLVNQEPSLFATTIRE  456

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT  E+  AA L  A SFI+ LP+G+ T+VGERG+QLSGGQKQR+AI+RA++
Sbjct  457  NIMYGKDDATADEITHAASLTEAVSFINNLPDGFETQVGERGIQLSGGQKQRIAISRAIM  516

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT++VVAHRLST++NAD I V+  GKI
Sbjct  517  KNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTIVVAHRLSTVRNADIIAVVGGGKI  576

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +Q+
Sbjct  577  IESGSHDELISNPDGAYSSLLRIQE  601



>ref|XP_004165322.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
2-like, partial [Cucumis sativus]
Length=1158

 Score =   451 bits (1161),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DR+TE+  DVGEEL  VEGTIELR+VEF YPSRPD  IFKDFN++VR GK
Sbjct  884   QMVASVFEVMDRQTEVSGDVGEELNVVEGTIELRNVEFVYPSRPDVMIFKDFNLKVRAGK  943

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSV++LILRFYDPI+GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  944   SIALVGQSGSGKSSVLALILRFYDPIAGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1003

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EV EAAKLANAH+FISALPEGYSTKVGERG+QLSGGQ+QR+AI
Sbjct  1004  TSIYENILYGKEGASEAEVFEAAKLANAHNFISALPEGYSTKVGERGIQLSGGQRQRIAI  1063

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKN DQI V+
Sbjct  1064  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMMNRTTVVVAHRLSTIKNCDQISVI  1123

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI+EQGTHS+L EN++GAYYKLIN+
Sbjct  1124  QDGKIVEQGTHSSLSENKNGAYYKLINI  1151


 Score =   319 bits (818),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 206/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G +L K++G I+ +DV FSYPSR D  IF   ++ +  GK +A
Sbjct  253  IFQMIERNTVSKSSSKTGWKLNKLDGFIQFKDVNFSYPSRQDVIIFNKLSLDIPAGKIVA  312

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK+L LK  R+ IGLV QEPALFATSI
Sbjct  313  LVGGSGSGKSTVISLIERFYEPLSGEILLDGHNIKDLDLKWFRQQIGLVNQEPALFATSI  372

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  ++  AAKL+ A SFI+ LPE + T+VGERGVQLSGG KQR+AI+RA
Sbjct  373  RENILYGKDDATLEDITRAAKLSEALSFINNLPERFETQVGERGVQLSGGXKQRIAISRA  432

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  433  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQEG  492

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   D  Y  L+  Q+
Sbjct  493  KIVETGSHDELISRPDSVYASLVQFQE  519



>ref|XP_010055294.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW71762.1| hypothetical protein EUGRSUZ_E00260 [Eucalyptus grandis]
Length=1255

 Score =   453 bits (1166),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 227/273 (83%), Positives = 257/273 (94%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEVLDRKTE++ DVGEEL  VEG +ELR V FSYPSRPD  IF++F+++VR GK
Sbjct  983   QMVASVFEVLDRKTEVMGDVGEELTTVEGMVELRGVHFSYPSRPDVIIFRNFDLKVRSGK  1042

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             +MALVGQSGSGKSSV++LILRFYDP++G+VMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1043  NMALVGQSGSGKSSVLTLILRFYDPMAGEVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1102

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIY+NI+YGKEGA+E EV EAAKLANAH+FIS+LPEGYSTKVG+RGVQLSGGQKQRVAI
Sbjct  1103  TSIYDNIIYGKEGASEGEVFEAAKLANAHNFISSLPEGYSTKVGDRGVQLSGGQKQRVAI  1162

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNPEILLLDEATSALD+ESERIVQQALDRLM++RT+++VAHRLSTIKNADQI V+
Sbjct  1163  ARAILKNPEILLLDEATSALDMESERIVQQALDRLMRNRTTIMVAHRLSTIKNADQISVI  1222

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             Q+GKIIEQGTHS L+ENRDG YYKLINLQQ QQ
Sbjct  1223  QNGKIIEQGTHSALVENRDGPYYKLINLQQQQQ  1255


 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 213/273 (78%), Gaps = 4/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G++L  VEG I+ +DV FSYPSRPD  IF    + + PGK MA
Sbjct  351  IFEMIERSTMSKTSSKTGQKLSNVEGHIQFKDVMFSYPSRPDVVIFNKLCLNIAPGKIMA  410

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+VISLI RFY+P++G++++DG ++K++ LK LR+ IGLV QEPALFATSI
Sbjct  411  IVGGSGSGKSTVISLIERFYEPLAGEILLDGYNLKDIDLKWLRQQIGLVNQEPALFATSI  470

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAK++ A SFI+ LPE + T+VGERG+QLSGGQKQR+AIARA
Sbjct  471  RENILYGKDKATLDEITRAAKMSEALSFINNLPERFETQVGERGIQLSGGQKQRIAIARA  530

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+R M  RT+VV+AHRLST++NAD I V+QDG
Sbjct  531  IVKNPSILLLDEATSALDAESEKSVQEALNRAMVGRTTVVIAHRLSTVRNADVISVVQDG  590

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ--HQQQ  74
            KI+E G H  LI N + AY  L+ LQ+  H Q+
Sbjct  591  KIVETGNHDELISNPNSAYASLVQLQETAHLQR  623



>dbj|BAD07905.1| putative MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07705.1| putative MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=653

 Score =   437 bits (1123),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 204/268 (76%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            QMV+SVFE+LDRKT++L D G ++ +VEG IELR VEF YP+RP+  +FK  ++ ++ GK
Sbjct  373  QMVSSVFEILDRKTDVLIDAGNDVKRVEGVIELRGVEFRYPARPEVVVFKGLDLLMKAGK  432

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            SMALVG SGSGKS+V+SLILRFYDPI+GKV+IDGKDI+ +KLKSLRKHIGLVQQEPALFA
Sbjct  433  SMALVGMSGSGKSTVLSLILRFYDPIAGKVLIDGKDIRKVKLKSLRKHIGLVQQEPALFA  492

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            T+IY+NILYGK+GATE+EV++AAKLANAHSFISALPEGY T+VGERGVQLSGGQ+QR+AI
Sbjct  493  TTIYDNILYGKDGATEAEVVDAAKLANAHSFISALPEGYRTRVGERGVQLSGGQRQRIAI  552

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARA++K+P ILLLDEATSALDVESER+VQQALDR+M++RT+V+VAHRLSTIKNAD I VL
Sbjct  553  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMRNRTTVMVAHRLSTIKNADVISVL  612

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINL  92
            QDGKIIEQG H  LIENR+GAY+KL++L
Sbjct  613  QDGKIIEQGAHHQLIENRNGAYHKLVSL  640



>ref|XP_010540773.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1250

 Score =   452 bits (1162),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/276 (80%), Positives = 248/276 (90%), Gaps = 3/276 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEEL---IKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVR  725
             QMVASVFE+LDRKT+++ D GEEL     VEG IELR V FSYPSRPD  IF DF+++VR
Sbjct  973   QMVASVFELLDRKTQVVGDAGEELDGSSGVEGAIELRGVHFSYPSRPDIVIFSDFDLKVR  1032

Query  724   PGKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPA  545
              GKSMALVGQSGSGKSSV+SLILRFYDP +GKV+IDG DIK L+LKSLRKHIGLVQQE A
Sbjct  1033  QGKSMALVGQSGSGKSSVLSLILRFYDPTAGKVLIDGIDIKKLRLKSLRKHIGLVQQEQA  1092

Query  544   LFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQR  365
             LFAT+IYENILYGKEG++ESEV EAAKLANAHSFIS+LP+GY+TKVGERGVQLSGGQ+QR
Sbjct  1093  LFATTIYENILYGKEGSSESEVTEAAKLANAHSFISSLPDGYNTKVGERGVQLSGGQRQR  1152

Query  364   VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
             +AIARAVLKNP ILLLDEATSALDVESER+VQQALDRLM++RT+VVVAHRLSTIKNAD I
Sbjct  1153  IAIARAVLKNPAILLLDEATSALDVESERVVQQALDRLMRNRTTVVVAHRLSTIKNADTI  1212

Query  184   CVLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
              V+QDG+IIEQG+HSTL+EN DGAY KLI LQQ   
Sbjct  1213  SVIQDGRIIEQGSHSTLVENDDGAYSKLIRLQQQSH  1248


 Score =   335 bits (858),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRK--TEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R   +E  +  G  L KV+G I  +DV FSYPSRPD  IF   N  +  GK +A
Sbjct  343  IFQMIERNALSETASKTGRTLDKVDGHIHFKDVTFSYPSRPDVVIFNKLNFHIPAGKIVA  402

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+PISG V+IDG D + L LK LR  IGLV QEPALFAT+I
Sbjct  403  LVGGSGSGKSTVVSLIERFYEPISGSVLIDGNDARELDLKWLRNQIGLVNQEPALFATTI  462

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LP+G+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  463  RENILYGKGDATVEEINRAAKLSEALSFINNLPDGFETQVGERGIQLSGGQKQRIAISRA  522

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALDVESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  523  IVKNPSILLLDEATSALDVESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADIIAVVQGG  582

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI + +GAY  L++LQ+
Sbjct  583  KIVESGSHDELISSPNGAYSSLLHLQE  609



>ref|XP_004136398.1| PREDICTED: ABC transporter B family member 2-like [Cucumis sativus]
Length=1232

 Score =   451 bits (1161),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DR+TE+  DVGEEL  VEGTIELR+VEF YPSRPD  IFKDFN++VR GK
Sbjct  958   QMVASVFEVMDRQTEVSGDVGEELNVVEGTIELRNVEFVYPSRPDVMIFKDFNLKVRAGK  1017

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSV++LILRFYDPI+GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1018  SIALVGQSGSGKSSVLALILRFYDPIAGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1077

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EV EAAKLANAH+FISALPEGYSTKVGERG+QLSGGQ+QR+AI
Sbjct  1078  TSIYENILYGKEGASEAEVFEAAKLANAHNFISALPEGYSTKVGERGIQLSGGQRQRIAI  1137

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKN DQI V+
Sbjct  1138  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMMNRTTVVVAHRLSTIKNCDQISVI  1197

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI+EQGTHS+L EN++GAYYKLIN+
Sbjct  1198  QDGKIVEQGTHSSLSENKNGAYYKLINI  1225


 Score =   321 bits (823),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G +L K++G I+ +DV FSYPSR D  IF   ++ +  GK +A
Sbjct  327  IFQMIERNTVSKSSSKTGWKLNKLDGFIQFKDVNFSYPSRQDVIIFNKLSLDIPAGKIVA  386

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK+L LK  R+ IGLV QEPALFATSI
Sbjct  387  LVGGSGSGKSTVISLIERFYEPLSGEILLDGHNIKDLDLKWFRQQIGLVNQEPALFATSI  446

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  ++  AAKL+ A SFI+ LPE + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  447  RENILYGKDDATLEDITRAAKLSEALSFINNLPERFETQVGERGVQLSGGQKQRIAISRA  506

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  507  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQEG  566

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   D  Y  L+  Q+
Sbjct  567  KIVETGSHDELISRPDSVYASLVQFQE  593



>ref|XP_007156412.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
 gb|ESW28406.1| hypothetical protein PHAVU_003G283900g [Phaseolus vulgaris]
Length=1235

 Score =   451 bits (1160),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVAS+FEV+DRKT IL D+GEEL  VEGTIEL+ + F+YPSRP+  IF +FN++V  GK
Sbjct  956   QMVASIFEVMDRKTGILGDIGEELKTVEGTIELKGIRFNYPSRPEVVIFNNFNLKVPAGK  1015

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             ++ALVG SG GKSSVISLILRFYDP  GKVMIDGKDIK L LKSLRKHIGLVQQEPALFA
Sbjct  1016  NIALVGHSGCGKSSVISLILRFYDPTFGKVMIDGKDIKKLNLKSLRKHIGLVQQEPALFA  1075

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EVIEAAKLANAHSFIS LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1076  TSIYENILYGKEGASEAEVIEAAKLANAHSFISGLPEGYSTKVGERGVQLSGGQKQRVAI  1135

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALD+ESER+VQQALD+LM++RT+V+VAHRLSTIKNADQI VL
Sbjct  1136  ARAVLKNPEILLLDEATSALDLESERVVQQALDQLMQNRTTVIVAHRLSTIKNADQIAVL  1195

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             +DGKII++G H+ L+E  DGAYYKL++L
Sbjct  1196  EDGKIIQRGIHARLVEITDGAYYKLVSL  1223


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 212/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  ++ ++ G++L K+EG I+ +DV FSYPSRPD  IF +F + + PGK +A
Sbjct  325  IFEMIERDTMNKVSSENGQKLSKLEGHIQFKDVCFSYPSRPDVVIFNNFCLEIPPGKIVA  384

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG  I+ L LK LR+ IGLV QEPALFATSI
Sbjct  385  LVGGSGSGKSTVISLIERFYEPVSGQILLDGNTIRELDLKWLRQRIGLVNQEPALFATSI  444

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+ +A  L++A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  445  RENILYGKDDATLEEINQAVMLSDAQSFINNLPDGLDTQVGERGIQLSGGQKQRIAISRA  504

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+V+VAHRLSTI+NAD I V++ G
Sbjct  505  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVIVAHRLSTIRNADMIVVIEGG  564

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            K++E G H  LI N +  Y  L+ +Q+
Sbjct  565  KVVEIGNHEELISNPNNVYASLVQIQE  591



>gb|KGN60362.1| hypothetical protein Csa_3G901080 [Cucumis sativus]
Length=1272

 Score =   451 bits (1161),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DR+TE+  DVGEEL  VEGTIELR+VEF YPSRPD  IFKDFN++VR GK
Sbjct  998   QMVASVFEVMDRQTEVSGDVGEELNVVEGTIELRNVEFVYPSRPDVMIFKDFNLKVRAGK  1057

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSV++LILRFYDPI+GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1058  SIALVGQSGSGKSSVLALILRFYDPIAGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1117

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+E+EV EAAKLANAH+FISALPEGYSTKVGERG+QLSGGQ+QR+AI
Sbjct  1118  TSIYENILYGKEGASEAEVFEAAKLANAHNFISALPEGYSTKVGERGIQLSGGQRQRIAI  1177

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKN DQI V+
Sbjct  1178  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMMNRTTVVVAHRLSTIKNCDQISVI  1237

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI+EQGTHS+L EN++GAYYKLIN+
Sbjct  1238  QDGKIVEQGTHSSLSENKNGAYYKLINI  1265


 Score =   321 bits (823),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G +L K++G I+ +DV FSYPSR D  IF   ++ +  GK +A
Sbjct  367  IFQMIERNTVSKSSSKTGWKLNKLDGFIQFKDVNFSYPSRQDVIIFNKLSLDIPAGKIVA  426

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK+L LK  R+ IGLV QEPALFATSI
Sbjct  427  LVGGSGSGKSTVISLIERFYEPLSGEILLDGHNIKDLDLKWFRQQIGLVNQEPALFATSI  486

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  ++  AAKL+ A SFI+ LPE + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  487  RENILYGKDDATLEDITRAAKLSEALSFINNLPERFETQVGERGVQLSGGQKQRIAISRA  546

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  547  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQEG  606

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   D  Y  L+  Q+
Sbjct  607  KIVETGSHDELISRPDSVYASLVQFQE  633



>gb|KJB21124.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1249

 Score =   451 bits (1159),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 229/267 (86%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKT+++ D GEEL  VEGTIEL+ V FSYPSRPD  IFKDF+++VR GK
Sbjct  974   QMVASVFEIMDRKTQVVGDAGEELTNVEGTIELKGVHFSYPSRPDVVIFKDFDLKVRSGK  1033

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP SGKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1034  SMALVGQSGSGKSSVLALILRFYDPTSGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1093

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1094  TSIYENILYGKEGASESEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1153

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTIKNAD+I V+
Sbjct  1154  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVMVAHRLSTIKNADRISVI  1213

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             Q G+IIEQGTHS+LIENR+G Y+KLIN
Sbjct  1214  QGGRIIEQGTHSSLIENRNGPYFKLIN  1240


 Score =   335 bits (860),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 212/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KVEG IEL++V FSYPSRPD  IF  F++ +  GK +A
Sbjct  342  IFEMIERNTVSKTSSKTGRKLSKVEGNIELKNVSFSYPSRPDVVIFDRFSLNIPAGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++DG +IK+L LK LR+ IGLV QEPALFAT+I
Sbjct  402  LVGGSGSGKSTVISLIERFYEPLAGEILLDGNNIKDLDLKWLRQQIGLVNQEPALFATTI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDDATLDEITRAAKLSEAIAFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  522  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQSG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E GTH  LI N +  Y  L+ LQ+
Sbjct  582  KIVETGTHDELISNPNSTYSSLVQLQE  608



>ref|XP_008465999.1| PREDICTED: ABC transporter B family member 2-like [Cucumis melo]
Length=1237

 Score =   450 bits (1158),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFEV+DR+TE+  DVGEEL  VEGTIELR+VEF YPSRPD  IFKDFN++VR GK
Sbjct  963   QMVASVFEVMDRQTEVPGDVGEELNVVEGTIELRNVEFVYPSRPDVMIFKDFNLKVRAGK  1022

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSV++LILRFYDPI+GKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1023  SIALVGQSGSGKSSVLALILRFYDPIAGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1082

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+EV EAAKLANAH+FISALPEGYSTKVGERG+QLSGGQ+QR+AI
Sbjct  1083  TTIYENILYGKEGASEAEVFEAAKLANAHNFISALPEGYSTKVGERGIQLSGGQRQRIAI  1142

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKN DQI V+
Sbjct  1143  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMMNRTTVVVAHRLSTIKNCDQISVI  1202

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKI+EQGTHS+L EN++GAYYKLIN+
Sbjct  1203  QDGKIVEQGTHSSLSENKNGAYYKLINI  1230


 Score =   324 bits (831),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G +L K++G I+ +DV FSYPSRPD  IF   ++ +  GK +A
Sbjct  332  IFQMIERNTVSKSSSKTGRKLNKLDGYIQFKDVNFSYPSRPDVIIFNKLSLDIPAGKIVA  391

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG++++DG +IK L LK  R+ IGLV QEPALFATSI
Sbjct  392  LVGGSGSGKSTVISLIERFYEPLSGEILLDGHNIKELDLKWFRQQIGLVNQEPALFATSI  451

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  ++  AAKL+ A SFI+ LPE + T+VGERGVQLSGGQKQR+AI+RA
Sbjct  452  RENILYGKDDATLEDITRAAKLSEALSFINNLPERFETQVGERGVQLSGGQKQRIAISRA  511

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP +LLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  512  IVKNPSVLLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQEG  571

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI   D  Y  L+  Q+
Sbjct  572  KIVETGSHDELISRPDSVYASLVQFQE  598



>gb|KFK29108.1| hypothetical protein AALP_AA7G090300 [Arabis alpina]
Length=1235

 Score =   450 bits (1158),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 216/274 (79%), Positives = 246/274 (90%), Gaps = 0/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL KVEGT+EL+ V FSYPSRPD  IF+DFN+ VR GK
Sbjct  961   QMVASVFEILDRKTQIVGEGSEELSKVEGTLELKGVHFSYPSRPDVVIFRDFNLIVRSGK  1020

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDI+ L LK LRKHIGLVQQEPALFA
Sbjct  1021  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIRKLDLKVLRKHIGLVQQEPALFA  1080

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYG EGAT+SEVIE+A LANAH+FI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1081  TSIYENILYGNEGATQSEVIESAILANAHTFIASLPEGYSTKVGERGVQMSGGQRQRIAI  1140

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1141  ARAILRNPEILLLDEATSALDVESERVVQQALDRLMTNRTTVVVAHRLSTIKNADTISVL  1200

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ 
Sbjct  1201  HGGKIVEQGSHRKLVLNKTGPYFKLISLQQQQQH  1234


 Score =   331 bits (848),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A+ G +L KV G I+ +DV FSYPSR D  IF   N+ +  GK +A
Sbjct  335  IFKMIERNTAAKASAESGRKLGKVNGHIQFKDVIFSYPSRSDVVIFDKLNLNIPAGKIVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PI+G V++DG DIK L LK  R  IGLV QEPALFAT+I
Sbjct  395  LVGGSGSGKSTVISLIERFYEPIAGAVLLDGNDIKELDLKWFRGQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK+ AT  EV  AAKL+ A SFI+ LP+G+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  455  RENIMYGKDHATAEEVGRAAKLSEAISFINNLPDGFETQVGERGIQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  515  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KIIE G H  LI N +GAY  L+ LQ+
Sbjct  575  KIIEFGNHENLISNPEGAYSSLLRLQE  601



>ref|XP_010240898.1| PREDICTED: ABC transporter B family member 2-like [Nelumbo nucifera]
Length=1246

 Score =   450 bits (1157),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 256/268 (96%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVF+VLDRKTEI+ DVGEE+ KV+G+IEL+ +EFSYPSRPD  IF++FN+RVR GK
Sbjct  972   QMVASVFQVLDRKTEIVGDVGEEVTKVQGSIELKHIEFSYPSRPDVIIFRNFNLRVRAGK  1031

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKSSVISLILRFYDP SGKVMIDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1032  SMALVGASGSGKSSVISLILRFYDPKSGKVMIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1091

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+E+EVI+AAKLANAH+FIS LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1092  TTIYENILYGKEGASEAEVIQAAKLANAHAFISGLPEGYSTKVGERGVQLSGGQKQRVAI  1151

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALDVESERIVQQALDRLMK+RT+V+VAHRLSTI+NADQI V+
Sbjct  1152  ARAVLKDPAILLLDEATSALDVESERIVQQALDRLMKNRTTVMVAHRLSTIQNADQISVI  1211

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQGTHSTL+E+++GAYYKLI+L
Sbjct  1212  QDGKIIEQGTHSTLVEDKNGAYYKLISL  1239


 Score =   325 bits (832),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/277 (60%), Positives = 211/277 (76%), Gaps = 10/277 (4%)
 Frame = -2

Query  880  VFEVLDRKTEILAD---VGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            +F++++R T   A     G + I  KVEG I+ +DV FSYPSRP   IF   ++ +  GK
Sbjct  341  IFKMIERNTVSKASSQQTGRQRILNKVEGHIQFKDVCFSYPSRPHVVIFNKLSLDIPSGK  400

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             +A+VG SGSGKS+VISLI RFY+P+SG +++DG DI+ L LK LR+ IGLV QEPALFA
Sbjct  401  IVAIVGGSGSGKSTVISLIERFYEPLSGHILLDGNDIRELDLKWLRQQIGLVNQEPALFA  460

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            TSI ENILYGK+ AT  E+ +AAKL+ A SFI+ LP+ Y T+VGERG+QLSGGQKQR+AI
Sbjct  461  TSIRENILYGKDDATLEEITQAAKLSEAVSFINNLPDRYETQVGERGIQLSGGQKQRIAI  520

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            +RA+LKNP ILLLDEATSALD ESE+ VQ+ALDRLM  RT++VVAHRLSTI+NAD I V+
Sbjct  521  SRAILKNPSILLLDEATSALDAESEKSVQEALDRLMVGRTTIVVAHRLSTIRNADIIAVV  580

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQ-----QHQ  80
            Q G+I+E G+H  L+ N + AY  L++LQ     QHQ
Sbjct  581  QGGRIVESGSHEELMLNPNSAYASLVHLQETAPLQHQ  617



>ref|XP_006417431.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
 gb|ESQ35784.1| hypothetical protein EUTSA_v10009914mg [Eutrema salsugineum]
Length=1226

 Score =   449 bits (1155),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/267 (79%), Positives = 246/267 (92%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T++  D GEEL  VEGTIEL+ V FSYPSRPD  IF+DFN+ V  GK
Sbjct  949   QMVASVFELLDRRTQVFGDTGEELSNVEGTIELKGVHFSYPSRPDVTIFRDFNLTVPSGK  1008

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +GK+MIDGKDIK+L+LKSLR+HIGLVQQEPAL A
Sbjct  1009  SMALVGQSGSGKSSVLSLILRFYDPTAGKIMIDGKDIKSLRLKSLRRHIGLVQQEPALLA  1068

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGY TKVGERG+Q+SGGQ+QR+AI
Sbjct  1069  TTIYENILYGKEGASESEVMEAAKLANAHSFISSLPEGYLTKVGERGIQMSGGQRQRIAI  1128

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+PEILLLDEATSALDVESER+VQ+ALDRLM +RT+VVVAHRLSTIKN+D I V+
Sbjct  1129  ARAVLKSPEILLLDEATSALDVESERVVQEALDRLMMNRTTVVVAHRLSTIKNSDMISVI  1188

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             Q+GKIIEQG+H++L+EN +G Y KLIN
Sbjct  1189  QEGKIIEQGSHNSLVENENGPYSKLIN  1215


 Score =   335 bits (860),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 207/265 (78%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R  E     G +L KV+G I+ +DV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  334  IFQMIERNQE--PKTGRKLGKVDGEIQFKDVTFTYPSRPDVVIFDKLNLVIPAGKVVALV  391

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G V++DG DI+ L LK LR+HIGLV QEPALFAT+I E
Sbjct  392  GGSGSGKSTMISLIERFYEPTEGAVLLDGNDIRYLDLKWLREHIGLVNQEPALFATTIRE  451

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NILYGK+ AT  E+  AA+L+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+ I+RA++
Sbjct  452  NILYGKDDATTEEITNAARLSEALSFINNLPEGFETQVGERGIQLSGGQKQRITISRAIV  511

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+Q GKI
Sbjct  512  KNPSILLLDEATSALDSESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIISVVQGGKI  571

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +Q+
Sbjct  572  IESGSHDELISNPDGAYSSLLRIQE  596



>ref|XP_010436379.1| PREDICTED: ABC transporter B family member 2 [Camelina sativa]
Length=1222

 Score =   449 bits (1154),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 214/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IF+DF++ VR GK
Sbjct  949   QMVASVFEILDRKTQIVGETSEELTNVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRSGK  1008

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDI+ L LK+LRKHIGLVQQEPALFA
Sbjct  1009  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIRKLDLKALRKHIGLVQQEPALFA  1068

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEVIE+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1069  TTIYENILYGNEGASQSEVIESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1128

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1129  ARAILKNPAILLLDEATSALDVESERVVQQALDRLMTNRTTVVVAHRLSTIKNADTISVL  1188

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ
Sbjct  1189  HGGKIVEQGSHRKLVLNKTGPYFKLISLQQQQQ  1221


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 205/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T   A      +L K++G I+ +DV FSYPSRPD  IF   N+ +  GK +A
Sbjct  323  IFKMIERNTMAKASARSSRKLGKIDGHIQFKDVSFSYPSRPDVVIFDKLNLAIPAGKIVA  382

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG +I  L +K LR  IGLV QEPALFAT+I
Sbjct  383  LVGGSGSGKSTVISLIERFYEPISGAVLLDGNNINELNIKWLRGQIGLVNQEPALFATTI  442

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK  AT  ++  AAKL+ A SFIS LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  443  TENIMYGKNDATAEDIARAAKLSEAISFISNLPEGFDTQVGERGIQLSGGQKQRIAISRA  502

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  503  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  562

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  563  KIVEFGNHENLISNPDGAYSSLLRLQE  589



>ref|XP_002869639.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45898.1| multidrug resistance protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=1233

 Score =   449 bits (1154),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 215/273 (79%), Positives = 244/273 (89%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IF+DF++ VR GK
Sbjct  960   QMVASVFEILDRKTQIVGETSEELTNVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRAGK  1019

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP  GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1020  SMALVGQSGSGKSSVISLILRFYDPTGGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1079

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEVIE+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1080  TTIYENILYGNEGASQSEVIESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1139

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1140  ARAILKNPAILLLDEATSALDVESERVVQQALDRLMTNRTTVVVAHRLSTIKNADTISVL  1199

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ
Sbjct  1200  HGGKIVEQGSHRKLVLNKTGPYFKLISLQQQQQ  1232


 Score =   333 bits (853),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+ +DV FSYPSRPD  IF   N+ +  GK +A
Sbjct  334  IFKMIERNTVTKASAKSGRKLGKVDGHIQFKDVTFSYPSRPDVVIFDKLNLAIPAGKIVA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG +I  + +K LR  IGLV QEPALFAT+I
Sbjct  394  LVGGSGSGKSTVISLIERFYEPISGAVLLDGNNINEVDIKWLRGQIGLVNQEPALFATTI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  RENILYGKDDATAEEINRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  514  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  573

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  574  KIVEFGNHENLISNPDGAYSSLLRLQE  600



>emb|CDX94395.1| BnaC01g17890D [Brassica napus]
Length=1234

 Score =   448 bits (1153),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEG IEL+ V FSYPSRPD  IFKDF+++VR GK
Sbjct  961   QMVASVFEILDRKTQIVGETSEELTNVEGMIELKGVHFSYPSRPDVVIFKDFDLKVRSGK  1020

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1021  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1080

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG E AT+SEVIEAA LANAHSFI++LP+GYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1081  TTIYENILYGNERATQSEVIEAATLANAHSFITSLPQGYSTKVGERGVQMSGGQRQRIAI  1140

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALD+ESER+VQQALDRLM +RT+VVVAHRLSTI+NAD I VL
Sbjct  1141  ARAILRNPEILLLDEATSALDIESERVVQQALDRLMTNRTTVVVAHRLSTIQNADTISVL  1200

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L++N+ G Y+KLI+LQQ Q 
Sbjct  1201  HGGKIVEQGSHHRLVQNKTGPYFKLISLQQQQH  1233


 Score =   332 bits (851),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 206/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G  L KV+G I+ ++V FSYPSRPD  IF   N+ +  GK +A
Sbjct  334  IFKMIERVTAAKTSAKTGRRLGKVDGHIQFKNVTFSYPSRPDVVIFDKLNISIPAGKIVA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG V +DG DIK+L +K LR  IGLV QEPALFAT+I
Sbjct  394  LVGGSGSGKSTVISLIERFYEPNSGAVWLDGNDIKDLDIKWLRGQIGLVNQEPALFATTI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK  AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  RENIMYGKHDATNEELARAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  514  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  573

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  574  KIVEFGNHENLIANPDGAYSALLRLQE  600



>ref|XP_006282856.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
 gb|EOA15754.1| hypothetical protein CARUB_v10006816mg, partial [Capsella rubella]
Length=1239

 Score =   448 bits (1153),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 214/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IF+DF++ VR GK
Sbjct  966   QMVASVFEILDRKTQIVGETNEELTNVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRSGK  1025

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDI+ L LK+LRKHIGLVQQEPALFA
Sbjct  1026  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIRKLDLKALRKHIGLVQQEPALFA  1085

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEVIE+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1086  TTIYENILYGNEGASQSEVIESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1145

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1146  ARAILKNPAILLLDEATSALDVESERVVQQALDRLMTNRTTVVVAHRLSTIKNADTISVL  1205

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ
Sbjct  1206  HGGKIVEQGSHRKLVLNKTGPYFKLISLQQQQQ  1238


 Score =   333 bits (854),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+ +DV FSYPSRP+  IF   N+ +  GK +A
Sbjct  342  IFKMIERNTVAKASAKSGRKLGKVDGHIQFKDVTFSYPSRPNVVIFDKLNLAIPAGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISL+ RFY+PISG V++DG +I  L +K LR  IGLV QEPALFATSI
Sbjct  402  LVGGSGSGKSTVISLMERFYEPISGAVLLDGNNINELDIKWLRGQIGLVNQEPALFATSI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDDATAEEIARAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  522  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  582  KIVEFGNHENLISNPDGAYSSLLRLQE  608



>gb|AAM20507.1| P-glycoprotein-2 [Arabidopsis thaliana]
Length=1233

 Score =   447 bits (1151),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 214/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IF+DF++ VR GK
Sbjct  960   QMVASVFEILDRKTQIVGETSEELNNVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRAGK  1019

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1020  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1079

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEV+E+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1080  TTIYENILYGNEGASQSEVVESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1139

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1140  ARAILKNPAILLLDEATSALDVESERVVQQALDRLMANRTTVVVAHRLSTIKNADTISVL  1199

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ
Sbjct  1200  HGGKIVEQGSHRKLVLNKSGPYFKLISLQQQQQ  1232


 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+ +D  FSYPSRPD  IF   N+ +  GK +A
Sbjct  334  IFKMIERNTVTKTSAKSGRKLGKVDGHIQFKDATFSYPSRPDVVIFDRLNLAIPAGKIVA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG +I  L +K LR  IGLV QEPALFAT+I
Sbjct  394  LVGGSGSGKSTVISLIERFYEPISGAVLLDGNNISELDIKWLRGQIGLVNQEPALFATTI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  RENILYGKDDATAEEITRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  514  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  573

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  574  KIVEFGNHENLISNPDGAYSSLLRLQE  600



>emb|CAA71277.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAA71276.1| P-glycoprotein-2 [Arabidopsis thaliana]
 emb|CAB39661.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
 emb|CAB79451.1| P-glycoprotein-2 (pgp2) [Arabidopsis thaliana]
Length=1233

 Score =   447 bits (1151),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 214/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IF+DF++ VR GK
Sbjct  960   QMVASVFEILDRKTQIVGETSEELNNVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRAGK  1019

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1020  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1079

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEV+E+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1080  TTIYENILYGNEGASQSEVVESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1139

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1140  ARAILKNPAILLLDEATSALDVESERVVQQALDRLMANRTTVVVAHRLSTIKNADTISVL  1199

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ
Sbjct  1200  HGGKIVEQGSHRKLVLNKSGPYFKLISLQQQQQ  1232


 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+ +D  FSYPSRPD  IF   N+ +  GK +A
Sbjct  334  IFKMIERNTVTKTSAKSGRKLGKVDGHIQFKDATFSYPSRPDVVIFDRLNLAIPAGKIVA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG +I  L +K LR  IGLV QEPALFAT+I
Sbjct  394  LVGGSGSGKSTVISLIERFYEPISGAVLLDGNNISELDIKWLRGQIGLVNQEPALFATTI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  RENILYGKDDATAEEITRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  514  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  573

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  574  KIVEFGNHENLISNPDGAYSSLLRLQE  600



>ref|XP_011018531.1| PREDICTED: ABC transporter B family member 2-like isoform X3 
[Populus euphratica]
Length=1074

 Score =   443 bits (1140),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             Q+ ASVFE+LDRKT++  D GEEL  VEGTIELR V+FSYPSRPDT IFKDF++RV  GK
Sbjct  803   QIAASVFELLDRKTKVTGDAGEELKNVEGTIELRGVQFSYPSRPDTLIFKDFDLRVCSGK  862

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP +GKVMIDG DIK LKLK LRKHIGLVQQEP LFA
Sbjct  863   SMALVGQSGSGKSSVLALILRFYDPTAGKVMIDGIDIKKLKLKFLRKHIGLVQQEPPLFA  922

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA E EVIEAAKLANAH FISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  923   TSIYENILYGKEGALEGEVIEAAKLANAHGFISALPEGYSTKVGERGVQLSGGQKQRVAI  982

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+V+QALDRLMK+RT+V+VAHRLSTIKNAD+I V+
Sbjct  983   ARAVLKNPEILLLDEATSALDVESERVVKQALDRLMKNRTTVIVAHRLSTIKNADEISVI  1042

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKII+QGTHS LI N +GAY+KL+ LQQ +
Sbjct  1043  QGGKIIQQGTHSNLINNMEGAYFKLVRLQQRE  1074


 Score =   335 bits (859),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 211/273 (77%), Gaps = 3/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +  +  G++L K+EG IE RDV F YPSRPD  IF  F + +  GK +A
Sbjct  172  IFEMIEKNTVSKSSSKTGQKLGKLEGHIEFRDVCFCYPSRPDVVIFNKFRLDIPSGKIVA  231

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SGK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  232  LVGGSGSGKSTVISLIERFYEPLSGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  291

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  292  RENILYGKTDATLDELTSAAKLSEAMSFINNLPDGLETQVGERGIQLSGGQKQRIAISRA  351

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+  M  RTSV+VAHRLSTI+NAD   VLQ+G
Sbjct  352  IIKNPSILLLDEATSALDAESEKSVQEALNHAMVGRTSVIVAHRLSTIRNADVTVVLQEG  411

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ-QC  71
            KI+E G+H  LI N D AY  L++LQ+    QC
Sbjct  412  KIVEIGSHEKLISNPDSAYASLVHLQEEASVQC  444



>ref|NP_194326.2| P-glycoprotein 2 [Arabidopsis thaliana]
 sp|Q8LPK2.3|AB2B_ARATH RecName: Full=ABC transporter B family member 2; Short=ABC transporter 
ABCB.2; Short=AtABCB2; AltName: Full=Multidrug resistance 
protein 2; AltName: Full=P-glycoprotein 2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAE99138.1| P-glycoprotein-2 [Arabidopsis thaliana]
 gb|AEE85137.1| P-glycoprotein 2 [Arabidopsis thaliana]
Length=1273

 Score =   448 bits (1152),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/273 (78%), Positives = 245/273 (90%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEGTIEL+ V FSYPSRPD  IF+DF++ VR GK
Sbjct  1000  QMVASVFEILDRKTQIVGETSEELNNVEGTIELKGVHFSYPSRPDVVIFRDFDLIVRAGK  1059

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1060  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1119

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG EGA++SEV+E+A LANAHSFI++LPEGYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1120  TTIYENILYGNEGASQSEVVESAMLANAHSFITSLPEGYSTKVGERGVQMSGGQRQRIAI  1179

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+LKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKNAD I VL
Sbjct  1180  ARAILKNPAILLLDEATSALDVESERVVQQALDRLMANRTTVVVAHRLSTIKNADTISVL  1239

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L+ N+ G Y+KLI+LQQ QQ
Sbjct  1240  HGGKIVEQGSHRKLVLNKSGPYFKLISLQQQQQ  1272


 Score =   333 bits (855),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+ +D  FSYPSRPD  IF   N+ +  GK +A
Sbjct  374  IFKMIERNTVTKTSAKSGRKLGKVDGHIQFKDATFSYPSRPDVVIFDRLNLAIPAGKIVA  433

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG +I  L +K LR  IGLV QEPALFAT+I
Sbjct  434  LVGGSGSGKSTVISLIERFYEPISGAVLLDGNNISELDIKWLRGQIGLVNQEPALFATTI  493

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  494  RENILYGKDDATAEEITRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  553

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  554  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  613

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  614  KIVEFGNHENLISNPDGAYSSLLRLQE  640



>ref|XP_010475946.1| PREDICTED: ABC transporter B family member 10-like [Camelina 
sativa]
Length=1224

 Score =   446 bits (1148),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/270 (79%), Positives = 250/270 (93%), Gaps = 1/270 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T+++ D GEEL  VEG IEL+DV FSYPSRPD  IF DFN++VR GK
Sbjct  952   QMVASVFELLDRRTKVVGDTGEELSNVEGKIELKDVHFSYPSRPDVTIFSDFNLKVRSGK  1011

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LK+ SLR+HIGLVQQEPALFA
Sbjct  1012  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIKKLKVNSLRRHIGLVQQEPALFA  1071

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEV+EAAKLANAHSFI +LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1072  TSIYENILYGKEGASESEVMEAAKLANAHSFICSLPEGYSTKVGERGIQMSGGQRQRIAI  1131

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALD+LMK+RT+ VVAHRLSTIKN+D I V+
Sbjct  1132  ARAVLKNPEILLLDEATSALDVESERVVQQALDQLMKNRTT-VVAHRLSTIKNSDMISVI  1190

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             Q+GKII+QG+HS+L+++++G Y KLI+LQ+
Sbjct  1191  QEGKIIQQGSHSSLVKDKNGPYSKLISLQR  1220


 Score =   331 bits (849),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 204/265 (77%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            + ++++R TE+    G +L +V G I  +DV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  337  IIQMIERNTEV--KTGRKLGEVVGDIHFKDVTFTYPSRPDVLIFDKLNLVIPAGKVVALV  394

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L LK LR HIGLV QEPALFAT+I E
Sbjct  395  GGSGSGKSTIISLIERFYEPTEGAVMLDGNDIRYLDLKWLRGHIGLVNQEPALFATTIRE  454

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGKE AT  E+  AAKL  A SFI+ LP+G+ T+VGERG+QLSGGQKQR+ I+RA++
Sbjct  455  NIMYGKEDATTEEITHAAKLTEAISFINNLPDGFETQVGERGIQLSGGQKQRITISRAIV  514

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT++VVAHRLST++NAD I V+  GKI
Sbjct  515  KNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTIVVAHRLSTVRNADIIAVVGGGKI  574

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H+ LI N DGAY  L+ +Q+
Sbjct  575  IESGSHNELISNPDGAYSSLLRIQE  599



>ref|XP_006368377.1| P-glycoprotein [Populus trichocarpa]
 gb|ERP64946.1| P-glycoprotein [Populus trichocarpa]
Length=1230

 Score =   446 bits (1148),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 226/272 (83%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             Q+ ASVFE+LDRKT+++ D GEEL  VEGTIELR V+FSYPSRPDT IFKDF+ RV  GK
Sbjct  959   QIAASVFELLDRKTQVIGDAGEELKNVEGTIELRGVQFSYPSRPDTLIFKDFDFRVCSGK  1018

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP +GKVMIDG DIK LKLK LRKHIGLVQQEP LFA
Sbjct  1019  SMALVGQSGSGKSSVLALILRFYDPTAGKVMIDGIDIKKLKLKFLRKHIGLVQQEPPLFA  1078

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA E EVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1079  TSIYENILYGKEGALEGEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  1138

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM +RT+V+VAHRLSTIKNAD+I V+
Sbjct  1139  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMTNRTTVIVAHRLSTIKNADEISVI  1198

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKII+QGTHS LI N +GAY+KL+ LQQ +
Sbjct  1199  QGGKIIQQGTHSNLINNMEGAYFKLVRLQQRE  1230


 Score =   331 bits (848),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 210/273 (77%), Gaps = 3/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +  +  G++L K+EG IE RDV F YPSRPD  IF  F + +  GK +A
Sbjct  328  IFEMIEKNTVSKSSSKTGQKLGKLEGHIEFRDVCFCYPSRPDVIIFNKFRLDIPSGKIVA  387

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SGK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  388  LVGGSGSGKSTVISLIERFYEPLSGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  447

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  448  RENILYGKTDATLDELTSAAKLSEAMSFINNLPDGLETQVGERGIQLSGGQKQRIAISRA  507

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+  M  RT+V+VAHRLSTI+NAD   VLQ+G
Sbjct  508  IIKNPSILLLDEATSALDAESEKSVQEALNHAMVGRTTVIVAHRLSTIRNADVTVVLQEG  567

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ-QC  71
            KI+E G+H  LI N +  Y  L++LQ+    QC
Sbjct  568  KIVEIGSHEKLISNPNSTYASLVHLQEEASVQC  600



>emb|CDX93393.1| BnaA06g06550D [Brassica napus]
Length=1225

 Score =   446 bits (1146),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 246/272 (90%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+++++ D GEEL  VEGTIEL+ V FSYPSRPD  IF+DF++ V  GK
Sbjct  952   QMVASVFELLDRRSQVVGDKGEELSNVEGTIELKGVHFSYPSRPDVTIFRDFDLTVPYGK  1011

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LKLKSLR+H+GLVQQEPALFA
Sbjct  1012  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIKKLKLKSLRRHVGLVQQEPALFA  1071

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA ESEV+EAAKLANAH FI +LP GYST+VGERG+QLSGGQ+QR+AI
Sbjct  1072  TTIYENILYGKEGALESEVMEAAKLANAHDFICSLPGGYSTQVGERGIQLSGGQRQRIAI  1131

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALDVESER+VQQALDRLM +RT+VVVAHRLSTIKN+D I V+
Sbjct  1132  ARAVLKNPAILLLDEATSALDVESERVVQQALDRLMSNRTTVVVAHRLSTIKNSDMISVI  1191

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+GKIIEQG+H++LIEN +G Y +LINLQQ Q
Sbjct  1192  QEGKIIEQGSHNSLIENENGPYSRLINLQQQQ  1223


 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 201/265 (76%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R  E+    G +L KV+G I  RDV F+YPSRPD  IF   N+ +  GK +ALV
Sbjct  337  IFQMIERNKEV--KTGRKLGKVDGEICFRDVTFTYPSRPDVVIFDKLNLVIPAGKVVALV  394

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS+VISLI RFY P  G V +DG DI+ L LK LR HIGLV QEPALFAT+I E
Sbjct  395  GGSGSGKSTVISLIERFYKPTDGAVFLDGNDIRYLDLKWLRGHIGLVNQEPALFATTIRE  454

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT+ E+  A  L+ A SFI+ LP+G+ T+VGERGVQLSGGQKQR+ I+RA+L
Sbjct  455  NIMYGKDDATDEEITRAVTLSEAVSFINKLPDGFETQVGERGVQLSGGQKQRITISRAIL  514

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALD++M  RT+VVVAHRLST++NAD I V+  G I
Sbjct  515  KNPSILLLDEATSALDAESEKTVQKALDKVMVGRTTVVVAHRLSTVRNADIIAVVHGGNI  574

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +Q+
Sbjct  575  IESGSHDELISNPDGAYSSLLRIQE  599



>ref|XP_008777170.1| PREDICTED: ABC transporter B family member 2-like [Phoenix dactylifera]
Length=1237

 Score =   446 bits (1146),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             +M +SVFEV+DRKTE+  D+GE++  V G IELR VEF YPSRPD  +FKDFN+R++ GK
Sbjct  966   KMASSVFEVIDRKTEMDGDIGEDVGMVTGEIELRRVEFHYPSRPDVQVFKDFNLRIKAGK  1025

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+G VMIDGKDIK L+LKSLRKHIGLVQQEPALFA
Sbjct  1026  SMALVGTSGSGKSTVLSLILRFYDPIAGNVMIDGKDIKKLRLKSLRKHIGLVQQEPALFA  1085

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENI YGK+GATE+EV+EAAKLANAHSFISALP+GYST+VG+RGVQLSGGQKQRVAI
Sbjct  1086  TTIYENISYGKDGATEAEVVEAAKLANAHSFISALPDGYSTEVGDRGVQLSGGQKQRVAI  1145

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+++NP ILLLDEATSALDVESERIVQQAL+ +MK RT+VVVAHRLSTI++AD I VL
Sbjct  1146  ARAIIRNPAILLLDEATSALDVESERIVQQALETVMKDRTTVVVAHRLSTIQSADIISVL  1205

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+GKI+EQG HS+L+E  +GAYYKLINLQQ Q
Sbjct  1206  QEGKIVEQGNHSSLLEKENGAYYKLINLQQQQ  1237


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 203/269 (75%), Gaps = 2/269 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILA--DVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++ R+    A    G+ L KV+G I+  +V FSYPSRP   +  +FN+ +  GK +A
Sbjct  337  IFEMIKRQAAAKARCSTGKTLPKVDGHIQFCNVSFSYPSRPFALVLDEFNLDIPSGKIVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+ G +++DG  IK+L+L+ LR+ IGLV QEP LFATSI
Sbjct  397  LVGGSGSGKSTVISLIERFYEPLYGAILLDGCSIKDLELRWLRQQIGLVSQEPVLFATSI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT+ E+ +A +L+ A  FI  LP+GY T+VGERG+QLSGGQKQR+AI+RA
Sbjct  457  LENILYGKYDATDDEITDALRLSGALDFIENLPDGYETQVGERGIQLSGGQKQRIAISRA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ +Q+ALDR+M  RT+V+VAHRLST++NAD I V + G
Sbjct  517  MLKNPVILLLDEATSALDAESEKSLQEALDRIMVGRTTVLVAHRLSTVRNADIITVFKGG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            KI+E GTH  LI +  GAY+ L  L + Q
Sbjct  577  KIVEAGTHEELIADTQGAYFSLARLPEQQ  605



>ref|XP_002892589.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68848.1| P-glycoprotein 10 [Arabidopsis lyrata subsp. lyrata]
Length=1229

 Score =   445 bits (1145),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 220/272 (81%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T+++ D G+EL  VEGTIEL+ V FSYPSRPD  IF DFN+ V  GK
Sbjct  954   QMVASVFELLDRRTKVVGDTGDELSNVEGTIELKGVHFSYPSRPDVTIFSDFNLNVPSGK  1013

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1014  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIKKLKLKSLRKHIGLVQQEPALFA  1073

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA+ESEV+EAAKLANAHSFIS+LPEGYSTKVGERG+Q+SGGQ+QR+AI
Sbjct  1074  TTIYENILYGKEGASESEVMEAAKLANAHSFISSLPEGYSTKVGERGIQMSGGQRQRIAI  1133

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+VVVAHRLSTIKN+D I V+
Sbjct  1134  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVVVAHRLSTIKNSDMISVI  1193

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDGKIIEQG+H++L+EN++G Y KLINLQQ Q
Sbjct  1194  QDGKIIEQGSHNSLVENKNGPYSKLINLQQQQ  1225


 Score =   331 bits (849),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 204/265 (77%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R TE     G +L KV G I  ++V F+YPSRPD  IF   N  +  GK +ALV
Sbjct  339  IFQMIERNTE--EKTGRKLGKVNGDILFKEVTFNYPSRPDVVIFDKLNFVIPAGKVVALV  396

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISLI RFY+P  G VM+DG DI+ L LK LR HIGLV QEP LFAT+I E
Sbjct  397  GGSGSGKSTMISLIERFYEPTDGAVMLDGNDIRYLDLKWLRGHIGLVNQEPVLFATTIRE  456

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT  E+  AAKL+ A SFI++LPEG+ T+VGERG+QLSGGQKQR++I+RA++
Sbjct  457  NIMYGKDDATSEEITNAAKLSEAISFINSLPEGFETQVGERGIQLSGGQKQRISISRAIV  516

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+  GKI
Sbjct  517  KNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVGGGKI  576

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +Q+
Sbjct  577  IESGSHDELISNLDGAYSSLLRIQE  601



>ref|XP_011018530.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Populus euphratica]
Length=1182

 Score =   444 bits (1142),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             Q+ ASVFE+LDRKT++  D GEEL  VEGTIELR V+FSYPSRPDT IFKDF++RV  GK
Sbjct  911   QIAASVFELLDRKTKVTGDAGEELKNVEGTIELRGVQFSYPSRPDTLIFKDFDLRVCSGK  970

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP +GKVMIDG DIK LKLK LRKHIGLVQQEP LFA
Sbjct  971   SMALVGQSGSGKSSVLALILRFYDPTAGKVMIDGIDIKKLKLKFLRKHIGLVQQEPPLFA  1030

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA E EVIEAAKLANAH FISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1031  TSIYENILYGKEGALEGEVIEAAKLANAHGFISALPEGYSTKVGERGVQLSGGQKQRVAI  1090

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+V+QALDRLMK+RT+V+VAHRLSTIKNAD+I V+
Sbjct  1091  ARAVLKNPEILLLDEATSALDVESERVVKQALDRLMKNRTTVIVAHRLSTIKNADEISVI  1150

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKII+QGTHS LI N +GAY+KL+ LQQ +
Sbjct  1151  QGGKIIQQGTHSNLINNMEGAYFKLVRLQQRE  1182


 Score =   335 bits (860),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 211/273 (77%), Gaps = 3/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +  +  G++L K+EG IE RDV F YPSRPD  IF  F + +  GK +A
Sbjct  280  IFEMIEKNTVSKSSSKTGQKLGKLEGHIEFRDVCFCYPSRPDVVIFNKFRLDIPSGKIVA  339

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SGK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  340  LVGGSGSGKSTVISLIERFYEPLSGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  399

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  400  RENILYGKTDATLDELTSAAKLSEAMSFINNLPDGLETQVGERGIQLSGGQKQRIAISRA  459

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+  M  RTSV+VAHRLSTI+NAD   VLQ+G
Sbjct  460  IIKNPSILLLDEATSALDAESEKSVQEALNHAMVGRTSVIVAHRLSTIRNADVTVVLQEG  519

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ-QC  71
            KI+E G+H  LI N D AY  L++LQ+    QC
Sbjct  520  KIVEIGSHEKLISNPDSAYASLVHLQEEASVQC  552



>ref|XP_009148411.1| PREDICTED: ABC transporter B family member 10 [Brassica rapa]
Length=1225

 Score =   445 bits (1144),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 210/272 (77%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             +MVASVFE+LDR+++++ D GEEL  VEGTIEL+ V FSYPSRPD  IF DF++ V  GK
Sbjct  952   KMVASVFELLDRRSQVVGDKGEELSNVEGTIELKGVHFSYPSRPDVTIFGDFDLTVPYGK  1011

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G +MIDG+DI+ LKLKSLR+H+GLVQQEPALFA
Sbjct  1012  SMALVGQSGSGKSSVLSLILRFYDPTAGIIMIDGQDIRKLKLKSLRRHVGLVQQEPALFA  1071

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGKEGA ESEV+EAAKLANAH FI +LP GYST+VGERG+Q+SGGQ+QR+AI
Sbjct  1072  TTIYENILYGKEGALESEVMEAAKLANAHDFICSLPGGYSTQVGERGIQMSGGQRQRIAI  1131

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALDVESER+VQQALDRLM++RT+VVVAHRLSTIKN+D I V+
Sbjct  1132  ARAVLKNPAILLLDEATSALDVESERVVQQALDRLMRNRTTVVVAHRLSTIKNSDMISVI  1191

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+GKIIEQG+H++LIEN +G Y +LINLQQHQ
Sbjct  1192  QEGKIIEQGSHNSLIENENGPYSRLINLQQHQ  1223


 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 200/265 (75%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R  E+    G +L KV+G I  RDV F+YPSRPD  +F   N+ +  GK +ALV
Sbjct  337  IFQMIERNKEV--KTGRKLGKVDGEICFRDVTFTYPSRPDVVVFDKLNLVIPAGKVVALV  394

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS+VISLI RFY+P  G V +DG D++ L LK LR HIGLV QEPA FAT+I E
Sbjct  395  GGSGSGKSTVISLIERFYEPTDGAVFLDGNDVRYLDLKWLRGHIGLVNQEPAFFATTIRE  454

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT+ E+  A  L+ A SFI+ LP+G+ T+VGERGVQLSGGQKQ + I+RA+L
Sbjct  455  NIMYGKDDATDEEITRAVTLSEAVSFINKLPDGFETQVGERGVQLSGGQKQTITISRAIL  514

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALD++M  RT+VVVAHRLST++NAD I V+  G I
Sbjct  515  KNPSILLLDEATSALDAESEKTVQKALDKVMVGRTTVVVAHRLSTVRNADIIAVVHGGNI  574

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H  LI N DGAY  L+ +Q+
Sbjct  575  IESGSHDELISNPDGAYSSLLRIQE  599



>emb|CDX89380.1| BnaA01g15130D [Brassica napus]
Length=1275

 Score =   446 bits (1146),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 212/273 (78%), Positives = 244/273 (89%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEG IEL+ V FSYPSRPD  IFKDF++ VR GK
Sbjct  1002  QMVASVFEILDRKTQIVGETSEELTNVEGMIELKAVHFSYPSRPDVVIFKDFDLIVRCGK  1061

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1062  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1121

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG E AT+SEVIEAA LANAHSFI++LP+GYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1122  TTIYENILYGNERATQSEVIEAATLANAHSFITSLPQGYSTKVGERGVQMSGGQRQRIAI  1181

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALD+ESER+VQQALDRLM +RT+VVVAHRLSTI+NAD I VL
Sbjct  1182  ARAILRNPEILLLDEATSALDIESERVVQQALDRLMTNRTTVVVAHRLSTIQNADTISVL  1241

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L++N+ G Y+KLI+LQQ Q 
Sbjct  1242  HGGKIVEQGSHHRLVQNKTGPYFKLISLQQQQH  1274


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G  L KV+G I+ ++V FSYPSRPD  IF   N+ +  GK +A
Sbjct  375  IFKMIERDTAAKTSAKTGRRLGKVDGHIQFKNVTFSYPSRPDVVIFDKLNISIPAGKIVA  434

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG V +DG DIK+L +K LR  IGLV QEPALFAT+I
Sbjct  435  LVGGSGSGKSTVISLIERFYEPNSGAVWLDGNDIKDLDIKWLRGQIGLVNQEPALFATTI  494

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK+ AT  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  495  RENIMYGKDDATNEELGRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  554

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  555  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  614

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  615  KIVEFGNHENLIANPDGAYSALLRLQE  641



>ref|XP_011018529.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Populus euphratica]
Length=1249

 Score =   444 bits (1142),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 247/272 (91%), Gaps = 0/272 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             Q+ ASVFE+LDRKT++  D GEEL  VEGTIELR V+FSYPSRPDT IFKDF++RV  GK
Sbjct  978   QIAASVFELLDRKTKVTGDAGEELKNVEGTIELRGVQFSYPSRPDTLIFKDFDLRVCSGK  1037

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP +GKVMIDG DIK LKLK LRKHIGLVQQEP LFA
Sbjct  1038  SMALVGQSGSGKSSVLALILRFYDPTAGKVMIDGIDIKKLKLKFLRKHIGLVQQEPPLFA  1097

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA E EVIEAAKLANAH FISALPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1098  TSIYENILYGKEGALEGEVIEAAKLANAHGFISALPEGYSTKVGERGVQLSGGQKQRVAI  1157

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+V+QALDRLMK+RT+V+VAHRLSTIKNAD+I V+
Sbjct  1158  ARAVLKNPEILLLDEATSALDVESERVVKQALDRLMKNRTTVIVAHRLSTIKNADEISVI  1217

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q GKII+QGTHS LI N +GAY+KL+ LQQ +
Sbjct  1218  QGGKIIQQGTHSNLINNMEGAYFKLVRLQQRE  1249


 Score =   335 bits (860),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 211/273 (77%), Gaps = 3/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++++ T  +  +  G++L K+EG IE RDV F YPSRPD  IF  F + +  GK +A
Sbjct  347  IFEMIEKNTVSKSSSKTGQKLGKLEGHIEFRDVCFCYPSRPDVVIFNKFRLDIPSGKIVA  406

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SGK+++DG DI++L LK LR+ IGLV QEPALFATSI
Sbjct  407  LVGGSGSGKSTVISLIERFYEPLSGKILLDGNDIRDLDLKWLRQQIGLVNQEPALFATSI  466

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A SFI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  467  RENILYGKTDATLDELTSAAKLSEAMSFINNLPDGLETQVGERGIQLSGGQKQRIAISRA  526

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+AL+  M  RTSV+VAHRLSTI+NAD   VLQ+G
Sbjct  527  IIKNPSILLLDEATSALDAESEKSVQEALNHAMVGRTSVIVAHRLSTIRNADVTVVLQEG  586

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ-QC  71
            KI+E G+H  LI N D AY  L++LQ+    QC
Sbjct  587  KIVEIGSHEKLISNPDSAYASLVHLQEEASVQC  619



>ref|XP_009139729.1| PREDICTED: ABC transporter B family member 2 [Brassica rapa]
Length=1234

 Score =   444 bits (1141),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 211/273 (77%), Positives = 243/273 (89%), Gaps = 0/273 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDRKT+I+ +  EEL  VEG IEL+ V FSYPSRPD  IFKDF++ VR GK
Sbjct  961   QMVASVFEILDRKTQIVGETSEELTNVEGMIELKGVHFSYPSRPDVVIFKDFDLIVRSGK  1020

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +GKVMI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  1021  SMALVGQSGSGKSSVISLILRFYDPTAGKVMIEGKDIKKLDLKALRKHIGLVQQEPALFA  1080

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG E AT+SEVIEAA LANAHSFI++LP+GYSTKVGERGVQ+SGGQ+QR+AI
Sbjct  1081  TTIYENILYGNERATQSEVIEAATLANAHSFITSLPQGYSTKVGERGVQMSGGQRQRIAI  1140

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALD+ESER+VQQALDRLM +R +VVVAHRLSTI+NAD I VL
Sbjct  1141  ARAILRNPEILLLDEATSALDIESERVVQQALDRLMTNRATVVVAHRLSTIQNADTISVL  1200

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
               GKI+EQG+H  L++N+ G Y+KLI+LQQ Q 
Sbjct  1201  HGGKIVEQGSHHRLVQNKTGPYFKLISLQQQQH  1233


 Score =   330 bits (847),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G  L KV+G I+ ++V FSYPSRPD  IF   N+ +  GK +A
Sbjct  334  IFKMIERDTAAKTSAKTGRRLGKVDGHIQFKNVTFSYPSRPDVVIFDKLNISIPAGKIVA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG V +DG DIK+L +K LR  IGLV QEPALFAT+I
Sbjct  394  LVGGSGSGKSTVISLIERFYEPNSGAVWLDGNDIKDLDIKWLRGQIGLVNQEPALFATTI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK+ +T  E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  RENIMYGKDDSTNEELGRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  514  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEG  573

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  LI N DGAY  L+ LQ+
Sbjct  574  KIVEFGNHENLIANPDGAYSALLRLQE  600



>ref|XP_009396844.1| PREDICTED: ABC transporter B family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=1241

 Score =   442 bits (1138),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 246/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM ASVFEVLDR+TE+  +VGE++ +VEG IE+R VEF YPSRPD  IF+ F++RV  GK
Sbjct  970   QMAASVFEVLDRRTEVPPEVGEDVGRVEGAIEMRGVEFCYPSRPDVLIFRGFDLRVTAGK  1029

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYD  +GKVMIDGKDI+ L+LK LRKHIG+VQQEP LFA
Sbjct  1030  SMALVGMSGSGKSTVLSLILRFYDATAGKVMIDGKDIRRLRLKELRKHIGMVQQEPVLFA  1089

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IY+NI+YGK+GATE+EV+EAAKLANAHSFISALPEGYSTK GERG+QLSGGQKQR+AI
Sbjct  1090  TTIYDNIVYGKDGATEAEVVEAAKLANAHSFISALPEGYSTKAGERGIQLSGGQKQRIAI  1149

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++KNP ILLLDEATSALDVESER+VQ AL+R+M++RT+V+VAHRLSTI NAD I VL
Sbjct  1150  ARAIIKNPAILLLDEATSALDVESERVVQHALERVMRNRTTVMVAHRLSTIHNADVISVL  1209

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             QDG+I+EQG+HSTL+ENR+GAY+KLI+LQQ
Sbjct  1210  QDGRIVEQGSHSTLVENRNGAYFKLISLQQ  1239


 Score =   327 bits (837),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/274 (60%), Positives = 208/274 (76%), Gaps = 4/274 (1%)
 Frame = -2

Query  883  SVFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            S+FE+++R T     A  G +L  V+G I+  ++ FSYPSRPD  IF   N+ +  GK +
Sbjct  336  SIFEMIERNTVNRTSAKTGRKLAGVDGHIKFVNIHFSYPSRPDVLIFNGLNLDIPSGKIV  395

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            ALVG SGSGKS+VISLI RFY+P  G +++DG DIK+L LK LR+ IGLV QEPALFATS
Sbjct  396  ALVGGSGSGKSTVISLIERFYEPQRGHILLDGHDIKDLDLKWLRQQIGLVNQEPALFATS  455

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK+ AT  E+ ++AKL+ A +FI  LP+ Y T+VGERGVQLSGGQKQR+AI+R
Sbjct  456  IRENILYGKDDATIDEIAQSAKLSEAINFIKHLPDRYETQVGERGVQLSGGQKQRIAISR  515

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q 
Sbjct  516  AILKNPSILLLDEATSALDAESEKSVQEALDRVMIGRTTVVVAHRLSTIRNADIIAVVQG  575

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ--HQQQ  74
            G+I+E GTH  L+ +   AY  L+ LQ+  H Q+
Sbjct  576  GRIVETGTHDQLMSHPTSAYASLVKLQETAHHQR  609



>gb|KFK43347.1| hypothetical protein AALP_AA1G113900 [Arabis alpina]
Length=1230

 Score =   441 bits (1135),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/268 (77%), Positives = 244/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE+LDR+T+++ D GEEL  VEG IEL+ V FSYPSRPD  IF+DF+++V  GK
Sbjct  955   QMVASVFELLDRRTQVVGDTGEELSDVEGEIELKGVHFSYPSRPDVSIFRDFDLKVPSGK  1014

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV+SLILRFYDP +G+++IDG DIK LKL SLR+HIGLVQQEPALFA
Sbjct  1015  SMALVGQSGSGKSSVLSLILRFYDPTAGEILIDGIDIKKLKLNSLRRHIGLVQQEPALFA  1074

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG+EGA+ESEV+EAAKLANAH+FI +LPEGY TKVGERG+Q+SGGQ+QR+AI
Sbjct  1075  TTIYENILYGREGASESEVMEAAKLANAHTFICSLPEGYLTKVGERGIQMSGGQRQRIAI  1134

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLMK RT+VVVAHRLSTIKN+D I V+
Sbjct  1135  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMKDRTTVVVAHRLSTIKNSDMISVI  1194

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             Q+GKIIEQG+H+ L++N++G Y KL NL
Sbjct  1195  QEGKIIEQGSHNNLVKNKNGPYSKLFNL  1222


 Score =   328 bits (842),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 205/265 (77%), Gaps = 2/265 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALV  701
            +F++++R  E  A  G  L KV+G I  R+V F+YPSRPD  IF   ++ +  GK +ALV
Sbjct  337  IFQMIERNKE--AKTGRTLGKVDGNIRFREVSFTYPSRPDVVIFDKLDLEIPAGKIVALV  394

Query  700  GQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYE  521
            G SGSGKS++ISL  RFY+P  G V++DG DI+ L LK LR HIGLV QEPALFAT+I E
Sbjct  395  GGSGSGKSTIISLTERFYEPTDGAVLLDGNDIRYLDLKWLRGHIGLVNQEPALFATTIRE  454

Query  520  NILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVL  341
            NI+YGK+ AT  E+  AAK++ A +FI+ LPEG+ T+VGERG+QLSGGQKQR+ I+RAV+
Sbjct  455  NIMYGKDDATAEEITRAAKISEALTFINNLPEGFETQVGERGIQLSGGQKQRITISRAVV  514

Query  340  KNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKI  161
            KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST++N+D I V++ GKI
Sbjct  515  KNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNSDIIAVVEGGKI  574

Query  160  IEQGTHSTLIENRDGAYYKLINLQQ  86
            IE G+H+ LI N +GAY  L+ +Q+
Sbjct  575  IESGSHNELISNPNGAYSSLLRIQE  599



>ref|XP_010908483.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1249

 Score =   441 bits (1135),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV SVFEV+DR+TE+L DVGE++ +VEG IE+R VEF YPSRP+  IF+DF+++V+ GK
Sbjct  974   QMVGSVFEVMDRETEVLGDVGEDVGRVEGVIEMRGVEFCYPSRPEVIIFRDFDLKVKAGK  1033

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V++LILRFYDP +GKV+IDGKDIK L+L+SLRKHIGLVQQEPALFA
Sbjct  1034  SMALVGTSGSGKSTVLALILRFYDPTAGKVLIDGKDIKKLRLRSLRKHIGLVQQEPALFA  1093

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IY+NI+YGK+ ATE+EVIEAAKLANAHSFISALPEGY TKVGERGVQLSGGQKQRVAI
Sbjct  1094  TTIYDNIIYGKDSATEAEVIEAAKLANAHSFISALPEGYLTKVGERGVQLSGGQKQRVAI  1153

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++KNP ILLLDEATSALD ESER+VQQALDR+MK+RT+V+VAHRLSTI+NAD I V+
Sbjct  1154  ARAIIKNPAILLLDEATSALDAESERVVQQALDRVMKNRTTVMVAHRLSTIQNADVISVV  1213

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             Q+G+IIEQG HS L+EN++G Y+KLI+L
Sbjct  1214  QNGRIIEQGNHSMLVENKNGPYFKLISL  1241


 Score =   331 bits (848),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 211/273 (77%), Gaps = 4/273 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +     G  L+ V+G I+  +V FSYPSRPD  IF   N+ +  GK +A
Sbjct  342  IFKMIERNTVSKTSGKTGRMLLSVDGHIQFCNVCFSYPSRPDVLIFNGLNLDIPSGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P+SG +++DG +IK L+LK LR+ IGLV QEPALFATSI
Sbjct  402  LVGGSGSGKSTVISLIERFYEPLSGAILLDGHNIKELELKWLRQQIGLVNQEPALFATSI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A +FI+ LP  Y T+VGERGVQLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDDATLDEITHAAKLSEAITFINHLPHRYETQVGERGVQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  522  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADIIAVVQNG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ--HQQQ  74
            K++E G+H  L+ +R  AY  L+ LQ+  HQQ+
Sbjct  582  KVVETGSHEQLMSDRCSAYASLVQLQEASHQQR  614



>ref|XP_003572841.1| PREDICTED: ABC transporter B family member 2-like [Brachypodium 
distachyon]
Length=1256

 Score =   441 bits (1133),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM +SVFE+LDRKTE+  D G+++ KVEG I+LRDVEF YPSR +  +FK  ++ ++ GK
Sbjct  975   QMASSVFEILDRKTEVRIDTGDDVKKVEGVIQLRDVEFRYPSRSEVAVFKGLDLLMKAGK  1034

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKV+IDGKDIK L+LK+LRKHIGLVQQEPALFA
Sbjct  1035  SMALVGMSGSGKSTVLSLILRFYDPIAGKVLIDGKDIKKLRLKALRKHIGLVQQEPALFA  1094

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGK+GATE+EV+EAAKLANAHSFIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  1095  TTIYENILYGKDGATEAEVVEAAKLANAHSFISSLPEGYHTKVGERGVQLSGGQKQRIAI  1154

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+MK+RT+V+VAHRLSTIKNAD I VL
Sbjct  1155  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMKNRTTVIVAHRLSTIKNADVISVL  1214

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQG H  LIEN++GAY+KL+NL
Sbjct  1215  QDGKIIEQGDHQHLIENKNGAYHKLVNL  1242


 Score =   325 bits (834),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 203/270 (75%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F +++R T  +  A  G  L  VEG+I+ RDV F+YPSRPD  I   F +    GK +A
Sbjct  338  IFRMIERSTVSKTSAKAGRTLPAVEGSIQFRDVRFAYPSRPDVAILDGFRLDFPAGKIVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SL+ RFY+P+SG V++DG DI++L +K LR  IGLV QEPALFATSI
Sbjct  398  LVGGSGSGKSTVVSLVERFYEPLSGAVLLDGHDIRDLDVKWLRGQIGLVNQEPALFATSI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  E+  AAKL+ A +FI+ LPE Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  458  RENILYGKGDASMEEINHAAKLSEAITFINHLPERYETQVGERGIQLSGGQKQRIAISRA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  518  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDAG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  578  RIVETGTHEQLMANPRSAYASLIQLQEAAQ  607



>gb|EEC73824.1| hypothetical protein OsI_08549 [Oryza sativa Indica Group]
Length=1264

 Score =   437 bits (1124),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/268 (76%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+SVFE+LDRKT++L D G ++ +VEG IELR VEF YP+RP+  +FK  ++ ++ GK
Sbjct  984   QMVSSVFEILDRKTDVLIDAGNDVKRVEGVIELRGVEFRYPARPEVVVFKGLDLLMKAGK  1043

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKV+IDGKDI+ +KLKSLRKHIGLVQQEPALFA
Sbjct  1044  SMALVGMSGSGKSTVLSLILRFYDPIAGKVLIDGKDIRKVKLKSLRKHIGLVQQEPALFA  1103

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IY+NILYGK+GATE+EV++AAKLANAHSFISALPEGY T+VGERGVQLSGGQ+QR+AI
Sbjct  1104  TTIYDNILYGKDGATEAEVVDAAKLANAHSFISALPEGYRTRVGERGVQLSGGQRQRIAI  1163

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+M++RT+V+VAHRLSTIKNAD I VL
Sbjct  1164  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMRNRTTVMVAHRLSTIKNADVISVL  1223

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQG H  LIENR+GAY+KL++L
Sbjct  1224  QDGKIIEQGAHHQLIENRNGAYHKLVSL  1251


 Score =   322 bits (826),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 205/270 (76%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G  L  V+G I+ RDV F+YPSRPD  I   F++    GK +A
Sbjct  349  IFQMIERNTVNKASSKAGRMLPSVDGHIQFRDVRFAYPSRPDVVILDRFSLDFPAGKIVA  408

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P++G V++DG DIK+L +K LR+ IGLV QEPALFATSI
Sbjct  409  LVGGSGSGKSTVVSLIERFYEPLTGAVLLDGHDIKDLDVKWLRQQIGLVNQEPALFATSI  468

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  E+  AAKL+ A +FI+ LP+ Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  469  RENILYGKGDASMDEINHAAKLSEAITFINHLPDRYETQVGERGIQLSGGQKQRIAISRA  528

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  529  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDSG  588

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  589  RIVETGTHEQLMANPRSAYASLIQLQEAAQ  618



>ref|NP_001047803.1| Os02g0693700 [Oryza sativa Japonica Group]
 emb|CAD59583.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07906.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD07706.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF09717.1| Os02g0693700 [Oryza sativa Japonica Group]
 gb|EEE57613.1| hypothetical protein OsJ_08005 [Oryza sativa Japonica Group]
Length=1264

 Score =   437 bits (1124),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/268 (76%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+SVFE+LDRKT++L D G ++ +VEG IELR VEF YP+RP+  +FK  ++ ++ GK
Sbjct  984   QMVSSVFEILDRKTDVLIDAGNDVKRVEGVIELRGVEFRYPARPEVVVFKGLDLLMKAGK  1043

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKV+IDGKDI+ +KLKSLRKHIGLVQQEPALFA
Sbjct  1044  SMALVGMSGSGKSTVLSLILRFYDPIAGKVLIDGKDIRKVKLKSLRKHIGLVQQEPALFA  1103

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IY+NILYGK+GATE+EV++AAKLANAHSFISALPEGY T+VGERGVQLSGGQ+QR+AI
Sbjct  1104  TTIYDNILYGKDGATEAEVVDAAKLANAHSFISALPEGYRTRVGERGVQLSGGQRQRIAI  1163

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+M++RT+V+VAHRLSTIKNAD I VL
Sbjct  1164  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMRNRTTVMVAHRLSTIKNADVISVL  1223

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQG H  LIENR+GAY+KL++L
Sbjct  1224  QDGKIIEQGAHHQLIENRNGAYHKLVSL  1251


 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 205/270 (76%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G  L  V+G I+ RDV F+YPSRPD  I   F++    GK +A
Sbjct  349  IFQMIERNTVNKASSKAGRTLPSVDGHIQFRDVRFAYPSRPDVVILDRFSLDFPAGKIVA  408

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P++G V++DG DIK+L +K LR+ IGLV QEPALFATSI
Sbjct  409  LVGGSGSGKSTVVSLIERFYEPLTGAVLLDGHDIKDLDVKWLRQQIGLVNQEPALFATSI  468

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+  E+  AAKL+ A +FI+ LP+ Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  469  RENILYGKGDASMDEINHAAKLSEAITFINHLPDRYETQVGERGIQLSGGQKQRIAISRA  528

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  529  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDSG  588

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  589  RIVETGTHEQLMANPRSAYASLIQLQEAAQ  618



>gb|AET03262.2| ABC transporter B family protein [Medicago truncatula]
Length=759

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/275 (77%), Positives = 246/275 (89%), Gaps = 0/275 (0%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            QMV+S+F+++DRK+ I+ DVGEEL+ VEG IEL+ + F YPSRP+  IFKDFN+ V  GK
Sbjct  484  QMVSSIFDMIDRKSGIIHDVGEELMTVEGMIELKRINFIYPSRPNVVIFKDFNLIVPSGK  543

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S+ALVG SGSGKSS+ISLILRFYDP SGKVMIDGKDIK + LKSLRK IGLVQQEPALFA
Sbjct  544  SLALVGHSGSGKSSIISLILRFYDPTSGKVMIDGKDIKKMNLKSLRKQIGLVQQEPALFA  603

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            TSIY+NILYGKE A+ESEVIEAAKLA+AH+FISALPEGYSTK G+RGV LSGGQKQRVAI
Sbjct  604  TSIYKNILYGKEEASESEVIEAAKLADAHNFISALPEGYSTKAGDRGVLLSGGQKQRVAI  663

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARA+L+NP+ILLLDEATSALDVESER+VQQALD+LM++RT+++VAHRLSTI+NADQI VL
Sbjct  664  ARAILRNPKILLLDEATSALDVESERVVQQALDKLMQNRTTIIVAHRLSTIRNADQIAVL  723

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQC  71
            QDGKIIEQG HS+L EN DGAY+KL +LQQ    C
Sbjct  724  QDGKIIEQGNHSSLFENTDGAYFKLASLQQETATC  758


 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  445  FISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESERIVQQ  266
            F  A+P     +VGERG+QLSGGQKQR+AI+RA++KNP ILLLDEATSALD ESE+ VQ+
Sbjct  7    FYEAVPVKSFLEVGERGIQLSGGQKQRIAISRAIVKNPSILLLDEATSALDAESEKSVQE  66

Query  265  ALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQ  89
            ALD +M  RT+V+VAHRLSTIKNAD I V++ G ++E G H  LI N +  Y  L+  Q
Sbjct  67   ALDHVMIGRTTVIVAHRLSTIKNADMIAVVEGGSVVETGNHEELISNPNSLYSSLVQGQ  125



>ref|XP_006647720.1| PREDICTED: ABC transporter B family member 2-like [Oryza brachyantha]
Length=1261

 Score =   436 bits (1122),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/267 (76%), Positives = 244/267 (91%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+SVFE+LDRKT++L D G ++ +VEG IELR VEF YP+RP+  +FK  ++ ++ GK
Sbjct  983   QMVSSVFEILDRKTDVLIDAGNDIKRVEGVIELRGVEFRYPARPEVVVFKGLDLLMKAGK  1042

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKV+IDG+D++ +KLKSLRKHIGLVQQEPALFA
Sbjct  1043  SMALVGMSGSGKSTVLSLILRFYDPIAGKVLIDGRDVRKVKLKSLRKHIGLVQQEPALFA  1102

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGK+GATE+EVI+AAKLANAHSFISALPEGY TKVGERGVQLSGGQ+QR+AI
Sbjct  1103  TTIYENILYGKDGATEAEVIDAAKLANAHSFISALPEGYQTKVGERGVQLSGGQRQRIAI  1162

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+M++RT+V+VAHRLSTIKNAD I VL
Sbjct  1163  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMRNRTTVMVAHRLSTIKNADVISVL  1222

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             QDGKIIEQG H  LIENR GAY+KL++
Sbjct  1223  QDGKIIEQGAHQQLIENRSGAYHKLVS  1249


 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/270 (59%), Positives = 205/270 (76%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  + VG  L  V+G I+ RDV F+YPSRPD  I   F++    GK +A
Sbjct  348  IFQMIERSTVNKASSKVGRTLPAVDGHIQFRDVRFAYPSRPDVVILDRFSLDFPAGKIVA  407

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P++G +++DG DIK+L +K LR+ IGLV QEPALFATSI
Sbjct  408  LVGGSGSGKSTVVSLIERFYEPLTGAILLDGHDIKDLDVKWLRQQIGLVNQEPALFATSI  467

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+   AKL+ A +FI+ LP+ Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  468  RENILYGKGDATMDEINHVAKLSEAITFINHLPDRYETQVGERGIQLSGGQKQRIAISRA  527

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  528  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDSG  587

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  588  RIVETGTHEQLMANPRSAYASLIQLQEAAQ  617



>gb|EMT33461.1| ABC transporter B family member 2 [Aegilops tauschii]
Length=1322

 Score =   437 bits (1124),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/267 (77%), Positives = 244/267 (91%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM +SVFE+LDRKTE+  D G+++ KVEG I+LRDVEF YPSR +  +FK  ++ ++ GK
Sbjct  1043  QMASSVFEILDRKTEVQIDTGDDIKKVEGVIQLRDVEFRYPSRSEVAVFKGLDLLMKAGK  1102

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKV+IDGKDIK LKLKSLR+HIGLVQQEPALFA
Sbjct  1103  SMALVGMSGSGKSTVLSLILRFYDPIAGKVLIDGKDIKKLKLKSLRRHIGLVQQEPALFA  1162

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGK+GATE+EVIEAAKLANAH+FIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  1163  TTIYENILYGKDGATEAEVIEAAKLANAHTFISSLPEGYQTKVGERGVQLSGGQKQRIAI  1222

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALD+ESER+VQQALDR+MK+RT+V+VAHRLSTIKNAD I V+
Sbjct  1223  ARAIVKDPAILLLDEATSALDMESERVVQQALDRVMKNRTTVMVAHRLSTIKNADVISVI  1282

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             QDGKIIEQG H  LIEN++GAY+KL+N
Sbjct  1283  QDGKIIEQGDHQHLIENKNGAYHKLVN  1309


 Score =   320 bits (821),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/274 (60%), Positives = 203/274 (74%), Gaps = 5/274 (2%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T     +  G  L  VEG I  RDV F+ PSRPD  I    ++    GK +A
Sbjct  392  IFQMIERSTVNTRSSRAGRTLQAVEGNIHFRDVRFASPSRPDVVILDRLSLDFPAGKIVA  451

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P+SG V++DG DIK+L +K LR  IGLV QEPALFATSI
Sbjct  452  LVGGSGSGKSTVVSLIERFYEPLSGAVLLDGHDIKDLDVKWLRGQIGLVNQEPALFATSI  511

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A +FI+ LPE Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  512  RENILYGKSNATADEIDHAAKLSEAITFINNLPERYETQVGERGIQLSGGQKQRIAISRA  571

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  572  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDGG  631

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQ---QHQQQ  74
            +I+E GTH  L+ N   AY  LI LQ   QHQ++
Sbjct  632  RIVETGTHEQLMANPLSAYSSLIQLQEAAQHQRK  665



>gb|EMS51604.1| ABC transporter B family member 2 [Triticum urartu]
Length=1214

 Score =   434 bits (1117),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 205/267 (77%), Positives = 244/267 (91%), Gaps = 0/267 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM +SVFE+LDRKTE+  D G+++ KVEG I+LRDVEF YPSR +  +FK  ++ ++ GK
Sbjct  933   QMASSVFEILDRKTEVQIDTGDDIKKVEGVIQLRDVEFRYPSRSEVAVFKGLDLLMKAGK  992

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKV++DGKDIK LKLKSLR+HIGLVQQEPALFA
Sbjct  993   SMALVGMSGSGKSTVLSLILRFYDPIAGKVLVDGKDIKKLKLKSLRRHIGLVQQEPALFA  1052

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGK+GATE+EVIEAAKLANAH+FIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  1053  TTIYENILYGKDGATEAEVIEAAKLANAHTFISSLPEGYQTKVGERGVQLSGGQKQRIAI  1112

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+MK+RT+V+VAHRLSTIKNA+ I V+
Sbjct  1113  ARALVKDPAILLLDEATSALDVESERVVQQALDRVMKNRTTVMVAHRLSTIKNANVISVI  1172

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             QDGKIIEQG H  LIEN++GAY+KL+N
Sbjct  1173  QDGKIIEQGDHQHLIENKNGAYHKLVN  1199


 Score =   229 bits (585),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 3/184 (2%)
 Frame = -2

Query  628  VMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESEVIEAAKLANAH  449
            V+I G D   L +K LR  IGLV QEPALFATSI ENILYGK  AT  E+  AAKL+ A 
Sbjct  422  VVIAGLD---LDVKWLRGQIGLVNQEPALFATSIRENILYGKSDATADEIDHAAKLSEAI  478

Query  448  SFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESERIVQ  269
            +FI+ LPE Y T+VGERG+QLSGGQKQR+AI+RA+LKNP ILLLDEATSALD ESE+ VQ
Sbjct  479  TFINNLPERYETQVGERGIQLSGGQKQRIAISRAILKNPSILLLDEATSALDAESEKSVQ  538

Query  268  QALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQ  89
            +ALDR+M  RT+VV+AHRLSTI+NAD I V+  G+I+E GTH  L+ N   AY  LI LQ
Sbjct  539  EALDRVMVGRTTVVIAHRLSTIRNADTIAVVDGGRIVETGTHEQLMANPLSAYSSLIQLQ  598

Query  88   QHQQ  77
            +  Q
Sbjct  599  EAAQ  602



>ref|XP_010906448.1| PREDICTED: ABC transporter B family member 2-like [Elaeis guineensis]
Length=1235

 Score =   433 bits (1113),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/271 (76%), Positives = 244/271 (90%), Gaps = 0/271 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM +SVFEV+DRKTE+  D+GE++  V GTIEL+ VEF YPSRPD  +F+DF++R++ GK
Sbjct  965   QMASSVFEVIDRKTEVDGDIGEDVGTVTGTIELQRVEFHYPSRPDILVFRDFDLRIKAGK  1024

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+GKVMIDGKDIK L+LKS+RKHIGLVQQEPALFA
Sbjct  1025  SMALVGTSGSGKSTVLSLILRFYDPIAGKVMIDGKDIKKLRLKSIRKHIGLVQQEPALFA  1084

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENI YGK+GATE EV+EAAKLANAHSFISALP+GYST+VG+RGVQLSGGQKQRVAI
Sbjct  1085  TTIYENIAYGKDGATEVEVVEAAKLANAHSFISALPDGYSTEVGDRGVQLSGGQKQRVAI  1144

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+++NP ILLLDEATSALD+E+ER+VQQAL  +MK RT++VVAHRLSTI+NAD I VL
Sbjct  1145  ARAIIRNPAILLLDEATSALDLEAERMVQQALVTVMKDRTTIVVAHRLSTIQNADIISVL  1204

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
             Q+GKIIEQG HS+L+E  +GAY  LI+LQQ 
Sbjct  1205  QEGKIIEQGNHSSLLEKENGAYCNLISLQQQ  1235


 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 205/269 (76%), Gaps = 2/269 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILA--DVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++ R+  + A  + G+ L  V+G I+  +V FSYPSRP   +  +F++ + PGK  A
Sbjct  334  MFEMIKRQAVVKASSNTGKTLPSVDGRIQFCNVSFSYPSRPFALVLDEFDLDIPPGKITA  393

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG+SGSGKS+VISL+ RFY+ +SG +++DG +IK+L+LK LR+ +GLV QEP LF TSI
Sbjct  394  LVGESGSGKSTVISLVERFYETLSGTILLDGCNIKDLELKWLRQQMGLVSQEPVLFGTSI  453

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  A KL+ A +FI  LP+ Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  454  LENILYGKFDATNDEITNALKLSGALAFIDNLPDRYETQVGERGIQLSGGQKQRIAISRA  513

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ +Q+ALDR+M  RT+V+VAHRLST+KNAD I V++ G
Sbjct  514  ILKNPAILLLDEATSALDAESEKSLQEALDRIMVGRTTVLVAHRLSTVKNADIIAVVKGG  573

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            KI+E GTH  LI +  GAY+ L NLQ  Q
Sbjct  574  KIVETGTHEELITDHQGAYFSLANLQVQQ  602



>ref|XP_004509739.1| PREDICTED: ABC transporter B family member 2-like isoform X2 
[Cicer arietinum]
Length=1132

 Score =   431 bits (1107),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 222/284 (78%), Positives = 251/284 (88%), Gaps = 7/284 (2%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+S+FEV+DRK+ I+  VGEEL  VEGTI+LR V FSYPSRP+  IF DFN+ V  GK
Sbjct  854   QMVSSIFEVIDRKSGIIHGVGEELKTVEGTIKLRRVNFSYPSRPNIVIFNDFNLTVPSGK  913

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSS+ISLILRFYDP SGKVMIDGKDIK + LKSLRKHIGLVQQEPALFA
Sbjct  914   SFALVGHSGSGKSSIISLILRFYDPTSGKVMIDGKDIKEINLKSLRKHIGLVQQEPALFA  973

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI++NILYGKE A+ESEVIEAAKLANAH+FISALP+GYSTK GERGVQLSGGQKQRVAI
Sbjct  974   TSIFKNILYGKEEASESEVIEAAKLANAHNFISALPQGYSTKTGERGVQLSGGQKQRVAI  1033

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NP+ILLLDEATSALDVESE IVQQALD+LM++RT+++VAHRLSTIKNADQI VL
Sbjct  1034  ARAILRNPKILLLDEATSALDVESESIVQQALDKLMQNRTTIIVAHRLSTIKNADQISVL  1093

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ--HQQQC*KLFGNW  50
             QDGKIIEQGTHS+L+EN DGAY+KL +LQQ  H Q+      NW
Sbjct  1094  QDGKIIEQGTHSSLLENTDGAYFKLASLQQQLHVQEH-----NW  1132


 Score =   298 bits (764),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 204/272 (75%), Gaps = 2/272 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++ R T  +  + +G +LIK++G I+L +V FSYPSRPD  IF + ++ +  GK +A
Sbjct  230  IFEMIKRDTVSKNSSKIGRKLIKLDGHIQLINVCFSYPSRPDVVIFNNLSLDIPSGKVLA  289

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS++ISLI RFY+P+SG++++D  DIK L +K LR  IGLV QEPALFATSI
Sbjct  290  LVGGSGSGKSTIISLIERFYEPLSGQILLDRNDIKELDIKWLRHQIGLVNQEPALFATSI  349

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  A +L++A +FI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  350  RENILYGKNDATVEELNSALELSDAMNFINNLPDGLDTQVGERGIQLSGGQKQRIAISRA  409

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+V+VAHRLSTI+NAD I V++ G
Sbjct  410  IVKNPSILLLDEATSALDAESEKSVQEALDRVMIGRTTVIVAHRLSTIRNADIIVVVEGG  469

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQQC  71
             ++E G H  LI N +  Y  L+        C
Sbjct  470  NVVEIGNHVELISNPNSVYASLVQGHPSPDPC  501



>ref|XP_004509738.1| PREDICTED: ABC transporter B family member 2-like isoform X1 
[Cicer arietinum]
Length=1229

 Score =   431 bits (1108),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/284 (78%), Positives = 251/284 (88%), Gaps = 7/284 (2%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+S+FEV+DRK+ I+  VGEEL  VEGTI+LR V FSYPSRP+  IF DFN+ V  GK
Sbjct  951   QMVSSIFEVIDRKSGIIHGVGEELKTVEGTIKLRRVNFSYPSRPNIVIFNDFNLTVPSGK  1010

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSS+ISLILRFYDP SGKVMIDGKDIK + LKSLRKHIGLVQQEPALFA
Sbjct  1011  SFALVGHSGSGKSSIISLILRFYDPTSGKVMIDGKDIKEINLKSLRKHIGLVQQEPALFA  1070

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI++NILYGKE A+ESEVIEAAKLANAH+FISALP+GYSTK GERGVQLSGGQKQRVAI
Sbjct  1071  TSIFKNILYGKEEASESEVIEAAKLANAHNFISALPQGYSTKTGERGVQLSGGQKQRVAI  1130

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NP+ILLLDEATSALDVESE IVQQALD+LM++RT+++VAHRLSTIKNADQI VL
Sbjct  1131  ARAILRNPKILLLDEATSALDVESESIVQQALDKLMQNRTTIIVAHRLSTIKNADQISVL  1190

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQ--HQQQC*KLFGNW  50
             QDGKIIEQGTHS+L+EN DGAY+KL +LQQ  H Q+      NW
Sbjct  1191  QDGKIIEQGTHSSLLENTDGAYFKLASLQQQLHVQE-----HNW  1229


 Score =   299 bits (765),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 204/272 (75%), Gaps = 2/272 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE++ R T  +  + +G +LIK++G I+L +V FSYPSRPD  IF + ++ +  GK +A
Sbjct  327  IFEMIKRDTVSKNSSKIGRKLIKLDGHIQLINVCFSYPSRPDVVIFNNLSLDIPSGKVLA  386

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS++ISLI RFY+P+SG++++D  DIK L +K LR  IGLV QEPALFATSI
Sbjct  387  LVGGSGSGKSTIISLIERFYEPLSGQILLDRNDIKELDIKWLRHQIGLVNQEPALFATSI  446

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  A +L++A +FI+ LP+G  T+VGERG+QLSGGQKQR+AI+RA
Sbjct  447  RENILYGKNDATVEELNSALELSDAMNFINNLPDGLDTQVGERGIQLSGGQKQRIAISRA  506

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+V+VAHRLSTI+NAD I V++ G
Sbjct  507  IVKNPSILLLDEATSALDAESEKSVQEALDRVMIGRTTVIVAHRLSTIRNADIIVVVEGG  566

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQQC  71
             ++E G H  LI N +  Y  L+        C
Sbjct  567  NVVEIGNHVELISNPNSVYASLVQGHPSPDPC  598



>emb|CDY42770.1| BnaA03g47690D [Brassica napus]
Length=1135

 Score =   428 bits (1100),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 199/271 (73%), Positives = 238/271 (88%), Gaps = 0/271 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM+ASVFE+LDRK++++ +  EEL  VEGTIEL+ ++FSYPSRP+  IFKDF++ VR G+
Sbjct  855   QMIASVFEILDRKSQLVGETSEELTNVEGTIELKGIQFSYPSRPNVVIFKDFDLIVRSGQ  914

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +G +MI+GKDIK L LK+LRKHIGLVQQEPALFA
Sbjct  915   SMALVGQSGSGKSSVISLILRFYDPTAGTIMIEGKDIKKLDLKALRKHIGLVQQEPALFA  974

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG E A+ SEVIE+A  ANAHSFI++LPEGY+TKVGERGVQ+SGGQ+QR+AI
Sbjct  975   TTIYENILYGNEEASHSEVIESAMFANAHSFITSLPEGYNTKVGERGVQMSGGQRQRIAI  1034

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALD ESER+VQQALDRLM +RT+VV+AHRLSTIKNAD I VL
Sbjct  1035  ARAILRNPEILLLDEATSALDTESERVVQQALDRLMTNRTTVVIAHRLSTIKNADTISVL  1094

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
               GKI++QG+H  L+ N+ G Y+ L NLQQ 
Sbjct  1095  HGGKIVQQGSHRWLVLNKVGPYFNLFNLQQQ  1125


 Score =   191 bits (485),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+  DV FSYPSRPD  IF   N+ +  GK++A
Sbjct  336  IFQMIERDTAAKTSAKSGRKLSKVDGHIQFTDVTFSYPSRPDVVIFDKLNLAIPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG V++DG DIK L +K LR HIGLV QEPALFAT+I
Sbjct  396  LVGGSGSGKSTVISLIERFYEPTSGAVLLDGNDIKELDIKWLRGHIGLVSQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTK  410
             ENI+YGK+GAT+ E+  AAKL++A SFI+ LPEG+ T+
Sbjct  456  RENIIYGKDGATDEEIGRAAKLSDAFSFINNLPEGFETQ  494



>ref|XP_003628786.1| ABC transporter B family member [Medicago truncatula]
Length=884

 Score =   421 bits (1083),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 245/270 (91%), Gaps = 0/270 (0%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            QMV+S+F+++DRK+ I+ DVGEEL+ VEG IEL+ + F YPSRP+  IFKDFN+ V  GK
Sbjct  493  QMVSSIFDMIDRKSGIIHDVGEELMTVEGMIELKRINFIYPSRPNVVIFKDFNLIVPSGK  552

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S+ALVG SGSGKSS+ISLILRFYDP SGKVMIDGKDIK + LKSLRK IGLVQQEPALFA
Sbjct  553  SLALVGHSGSGKSSIISLILRFYDPTSGKVMIDGKDIKKMNLKSLRKQIGLVQQEPALFA  612

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            TSIY+NILYGKE A+ESEVIEAAKLA+AH+FISALPEGYSTK G+RGV LSGGQKQRVAI
Sbjct  613  TSIYKNILYGKEEASESEVIEAAKLADAHNFISALPEGYSTKAGDRGVLLSGGQKQRVAI  672

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARA+L+NP+ILLLDEATSALDVESER+VQQALD+LM++RT+++VAHRLSTI+NADQI VL
Sbjct  673  ARAILRNPKILLLDEATSALDVESERVVQQALDKLMQNRTTIIVAHRLSTIRNADQIAVL  732

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            QDGKIIEQG HS+L EN DGAY+KL +LQQ
Sbjct  733  QDGKIIEQGNHSSLFENTDGAYFKLASLQQ  762


 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  445  FISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESERIVQQ  266
            F  A+P     +VGERG+QLSGGQKQR+AI+RA++KNP ILLLDEATSALD ESE+ VQ+
Sbjct  16   FYEAVPVKSFLEVGERGIQLSGGQKQRIAISRAIVKNPSILLLDEATSALDAESEKSVQE  75

Query  265  ALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQ  89
            ALD +M  RT+V+VAHRLSTIKNAD I V++ G ++E G H  LI N +  Y  L+  Q
Sbjct  76   ALDHVMIGRTTVIVAHRLSTIKNADMIAVVEGGSVVETGNHEELISNPNSLYSSLVQGQ  134



>ref|XP_006854029.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
 gb|ERN15496.1| hypothetical protein AMTR_s00048p00046670 [Amborella trichopoda]
Length=1263

 Score =   430 bits (1105),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 246/275 (89%), Gaps = 1/275 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD-VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPG  719
             QM ASVFE+LDR++EI+ D   EEL  VEG+IEL  V FSYPSRPD  IF DF+++V P 
Sbjct  981   QMAASVFEILDRRSEIVQDPSAEELSHVEGSIELLRVSFSYPSRPDVRIFYDFDLKVNPS  1040

Query  718   KSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALF  539
             +SMALVG SGSGKSSV++LILRFY+P +GKV+IDGKDI+ ++LKSLR+HIGLVQQEPALF
Sbjct  1041  QSMALVGASGSGKSSVLALILRFYEPTAGKVLIDGKDIRKVRLKSLRRHIGLVQQEPALF  1100

Query  538   ATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVA  359
             A SIY+NILYGK+GATES+V+EAA+LANA  FI++LP+GY+TKVGERGVQLSGGQKQRVA
Sbjct  1101  AASIYDNILYGKDGATESDVLEAARLANADGFIASLPDGYATKVGERGVQLSGGQKQRVA  1160

Query  358   IARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICV  179
             IARAVLKNP ILLLDEATSALD ESER+VQQALDRLMK+RT+++VAHRLSTI++AD I V
Sbjct  1161  IARAVLKNPAILLLDEATSALDAESERVVQQALDRLMKNRTTIMVAHRLSTIQSADVISV  1220

Query  178   LQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             LQDGKIIEQG+H +L EN+ GAYY+LI+LQQ +QQ
Sbjct  1221  LQDGKIIEQGSHESLAENKSGAYYRLIHLQQQEQQ  1255


 Score =   342 bits (877),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/273 (61%), Positives = 216/273 (79%), Gaps = 2/273 (1%)
 Frame = -2

Query  883  SVFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            S+F++++RKT     +  G+ L KVEG I+ R+V FSYPSRPD PIF+  ++ +   K +
Sbjct  348  SIFQMIERKTASKESSKTGKSLQKVEGHIQFRNVHFSYPSRPDVPIFEGLSLNIPAAKVV  407

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            ALVG SGSGKS+V+SLI RFY+P SG +++DG++++ L+LK LR  IGLV QEPALFATS
Sbjct  408  ALVGGSGSGKSTVVSLIERFYEPRSGHILLDGENVRGLELKWLRGQIGLVNQEPALFATS  467

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I +NILYGK+ AT  E+++AAKL++A SFI+ LP+ Y T+VGERG+QLSGGQKQR+AI+R
Sbjct  468  IRQNILYGKDNATMDEILQAAKLSDAVSFINNLPDRYETQVGERGIQLSGGQKQRIAISR  527

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+V+VAHRLSTI+NAD I VLQ+
Sbjct  528  AILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVIVAHRLSTIRNADMIVVLQE  587

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQHQQQC  71
            G+I+E GTH  LI N  GAY  L++LQ    Q 
Sbjct  588  GRIVESGTHEELILNPGGAYTTLVHLQDATHQA  620



>ref|XP_009137566.1| PREDICTED: ABC transporter B family member 2-like [Brassica rapa]
Length=1241

 Score =   426 bits (1096),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 198/271 (73%), Positives = 237/271 (87%), Gaps = 0/271 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM+ASVFE+LDRK +++ +  EEL  VEGTIEL+ ++FSYPSRP+  IFKDF++ VR G+
Sbjct  961   QMIASVFEILDRKGQLVGETSEELTNVEGTIELKGIQFSYPSRPNVVIFKDFDLIVRSGQ  1020

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +G +MI+GKDIK L LK+LRKHIGL+QQEPALFA
Sbjct  1021  SMALVGQSGSGKSSVISLILRFYDPTAGTIMIEGKDIKKLDLKALRKHIGLIQQEPALFA  1080

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG E A+ SEVIE+A  ANAHSFI++LPEGY+TKVGERGVQ+SGGQ+QR+AI
Sbjct  1081  TTIYENILYGNEEASHSEVIESAMFANAHSFITSLPEGYNTKVGERGVQMSGGQRQRIAI  1140

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALD ESER+VQQALDRLM +RT+VV+AHRLSTIKNAD I VL
Sbjct  1141  ARAILRNPEILLLDEATSALDTESERVVQQALDRLMTNRTTVVIAHRLSTIKNADTISVL  1200

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
               GKI++QG+H  L+ N+ G Y+ L NLQQ 
Sbjct  1201  HGGKIVQQGSHRWLVLNKVGPYFNLFNLQQQ  1231


 Score =   338 bits (866),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 209/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+  DV FSYPSRPD  IF   N+ +  GK++A
Sbjct  336  IFQMIERDTAAKTSAKSGRKLSKVDGHIQFTDVTFSYPSRPDVVIFDKLNLAIPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG V++DG DIK L +K LR HIGLV QEPALFAT+I
Sbjct  396  LVGGSGSGKSTVISLIERFYEPTSGAVLLDGSDIKELDIKWLRGHIGLVSQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK+ AT+ E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  456  RENIMYGKDDATDEEIGRAAKLSEAFSFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+AL+ +M  RT+VVVAHRLST++NAD I V+ +G
Sbjct  516  ILKNPSILLLDEATSALDAESEKSVQEALEGVMVGRTTVVVAHRLSTVRNADVIAVVHEG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G H  L+ N DGAY  L+ LQ+
Sbjct  576  KIVEFGNHENLVSNPDGAYSALLRLQE  602



>ref|XP_010538383.1| PREDICTED: ABC transporter B family member 2-like [Tarenaya hassleriana]
Length=1256

 Score =   426 bits (1094),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 215/278 (77%), Positives = 247/278 (89%), Gaps = 4/278 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIK-VEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPG  719
             QMVASVFE+LDRKT+++ D GEEL   VEGTIEL+ V FSYPSRPD  IF+DFN+RVR G
Sbjct  975   QMVASVFELLDRKTQVVGDAGEELTGGVEGTIELKGVHFSYPSRPDVVIFRDFNLRVRSG  1034

Query  718   KSMALVGQSGSGKS---SVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEP  548
             KSMALVGQSG   S   +VISLI RFY+PISG V++DG DIK L+LKSLRKHIGLVQQEP
Sbjct  1035  KSMALVGQSGGSGSGKSTVISLIERFYEPISGGVLLDGNDIKKLRLKSLRKHIGLVQQEP  1094

Query  547   ALFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQ  368
             ALF T+IYENILYGKEG++ESEV EAAKLANA SFIS+LPEGY+TKVGERGVQLSGGQ+Q
Sbjct  1095  ALFGTTIYENILYGKEGSSESEVKEAAKLANADSFISSLPEGYNTKVGERGVQLSGGQRQ  1154

Query  367   RVAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQ  188
             R+AIARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+VVVAHRLSTIKN+D 
Sbjct  1155  RIAIARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVVVAHRLSTIKNSDT  1214

Query  187   ICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             I V+QDGKIIEQG+HS L++N++G Y KLI+LQQ   +
Sbjct  1215  ISVIQDGKIIEQGSHSALLDNKNGPYSKLISLQQQDHR  1252


 Score =   336 bits (862),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G  L+KV+G I  +DV FSYPSRPD  IF   N+ +  GK +A
Sbjct  345  IFQMIERNTLSKTASKSGRTLMKVDGYIHFKDVTFSYPSRPDVIIFDKLNLHIPAGKIVA  404

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+PISG V++DG  ++ L LK LR  IGLV QEPALFAT+I
Sbjct  405  LVGGSGSGKSTVISLIERFYEPISGGVLLDGNVVRELDLKWLRNQIGLVNQEPALFATTI  464

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A SFI+ LP+G+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  465  RENILYGKDDATVEEITRAAKLSEALSFINNLPDGFETQVGERGIQLSGGQKQRIAISRA  524

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP +LLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  525  IVKNPSVLLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADIIAVVQEG  584

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E G+H  LI N +GAY  L++LQ+
Sbjct  585  KIVETGSHDELISNPNGAYSSLLHLQE  611



>emb|CDX92739.1| BnaC07g39970D [Brassica napus]
Length=1241

 Score =   422 bits (1086),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/271 (72%), Positives = 236/271 (87%), Gaps = 0/271 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM+AS+FE+LDRK++++ +  EEL  VEGTIEL+ ++FSYPSRP   IFKDF++ VR G+
Sbjct  961   QMIASIFEILDRKSQLVGETSEELTNVEGTIELKGIQFSYPSRPHVVIFKDFDLIVRSGQ  1020

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSVISLILRFYDP +G +MI+GKDIK + LK+LRKHIGLVQQEPALFA
Sbjct  1021  SMALVGQSGSGKSSVISLILRFYDPTAGTIMIEGKDIKKVDLKALRKHIGLVQQEPALFA  1080

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYG E A+ SEVIE+A  ANAHSFI++LPEGY+TKVGERGVQ+SGGQ+QR+AI
Sbjct  1081  TTIYENILYGNEEASHSEVIESAMFANAHSFITSLPEGYNTKVGERGVQMSGGQRQRIAI  1140

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA+L+NPEILLLDEATSALD  SER+VQQALDRLM +RT+VV+AHRLSTIKNAD I VL
Sbjct  1141  ARAILRNPEILLLDEATSALDTVSERVVQQALDRLMTNRTTVVIAHRLSTIKNADTISVL  1200

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
               GKI++QG+H  L+ N+ G Y+ L NLQQ 
Sbjct  1201  HGGKIVQQGSHRWLVLNKVGPYFNLFNLQQQ  1231


 Score =   336 bits (862),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  A  G +L KV+G I+  DV FSYPSRPD  IF   N+ +  GK +A
Sbjct  336  IFQMIERDTAAKTSAKFGRKLRKVDGHIQFTDVTFSYPSRPDVLIFDKLNLAIPAGKMVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P SG V++DG DI+ L +K LR HIGLV QEPALFAT+I
Sbjct  396  LVGGSGSGKSTVISLIERFYEPTSGAVLLDGNDIRELDIKWLRGHIGLVSQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK+ AT+ E+  AAKL+ A SFI+ LPEG+ T+VGERG+QLSGGQKQR+AI+RA
Sbjct  456  RENIMYGKDDATDEEIGRAAKLSEAFSFINNLPEGFETQVGERGIQLSGGQKQRIAISRA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD E E+ VQ+AL+R+M  +T+VVVAHRLST++NAD I V+ +G
Sbjct  516  ILKNPSILLLDEATSALDAELEKSVQEALERVMVGKTTVVVAHRLSTVRNADIIAVVHEG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KIIE G H  LI N DGAY  L+ LQ+
Sbjct  576  KIIEFGNHENLISNPDGAYSALLRLQE  602



>ref|NP_001130840.1| uncharacterized protein LOC100191944 [Zea mays]
 gb|ACF79208.1| unknown [Zea mays]
Length=708

 Score =   406 bits (1044),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/266 (75%), Positives = 242/266 (91%), Gaps = 0/266 (0%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            QM +SVFE+LDRKT++  D GE++ +VEG IELR +EF YPSRPD  +FK  ++ ++ GK
Sbjct  425  QMASSVFEILDRKTDVRIDTGEDIKRVEGLIELRGIEFRYPSRPDVTVFKGLDLLMKAGK  484

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            SMALVG SGSGKS+V+SLILRFYDPI+G+V+IDGKD+K LKLK LRKHIGLVQQEPALFA
Sbjct  485  SMALVGMSGSGKSTVLSLILRFYDPIAGRVLIDGKDVKKLKLKCLRKHIGLVQQEPALFA  544

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            T+IY+NILYGK+GATE+EV+EAAKLANAHSFIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  545  TTIYDNILYGKDGATEAEVVEAAKLANAHSFISSLPEGYKTKVGERGVQLSGGQKQRIAI  604

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARA++K+P ILLLDEATSALDVESER+VQQAL+R+M++RT+V+VAHRLST+KNAD I VL
Sbjct  605  ARAIVKDPAILLLDEATSALDVESERVVQQALNRVMRNRTTVMVAHRLSTVKNADVISVL  664

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLI  98
            QDGKIIEQG H  LIE+++GAY+KL+
Sbjct  665  QDGKIIEQGAHQHLIEDKNGAYHKLV  690


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  250  MKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            M  RT+VV+AHRLSTI+NAD I V+  G+I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  1    MVGRTTVVIAHRLSTIRNADTIAVVDGGRIVETGTHEQLMANPYSAYSSLIQLQEAAQ  58



>ref|XP_002452712.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
 gb|EES05688.1| hypothetical protein SORBIDRAFT_04g031170 [Sorghum bicolor]
Length=1260

 Score =   416 bits (1069),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 208/268 (78%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM +SVFE+LDRKT++  D GE++ KVEG IELR VEF YP+RPD  +FK  ++ ++ GK
Sbjct  981   QMASSVFEILDRKTDVRIDTGEDIKKVEGLIELRGVEFRYPARPDVTVFKGLDLLMKAGK  1040

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+G+V+IDGKD+K LKLKSLRKHIGLVQQEPALFA
Sbjct  1041  SMALVGMSGSGKSTVLSLILRFYDPIAGRVLIDGKDVKKLKLKSLRKHIGLVQQEPALFA  1100

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IY+NILYGK+GATE+EV+EAAKLANAHSFIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  1101  TTIYDNILYGKDGATEAEVVEAAKLANAHSFISSLPEGYKTKVGERGVQLSGGQKQRIAI  1160

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+MK+RT+V+VAHRLSTIKNAD I VL
Sbjct  1161  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMKNRTTVMVAHRLSTIKNADVISVL  1220

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINL  92
             QDGKIIEQG H  LIEN++GAY+KL+NL
Sbjct  1221  QDGKIIEQGAHQHLIENKNGAYHKLVNL  1248


 Score =   323 bits (828),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/270 (60%), Positives = 204/270 (76%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G  L  V+G I+ R+V FSYPSRPD  I   F++    GK +A
Sbjct  346  IFQMIERSTVNKASSKTGRTLPAVDGHIQFRNVHFSYPSRPDVVILDRFSLDFPAGKIVA  405

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P+SG +++DG DIK L +K LR+ IGLV QEPALFATSI
Sbjct  406  LVGGSGSGKSTVVSLIERFYEPLSGSILLDGHDIKELDVKWLRRQIGLVNQEPALFATSI  465

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A +FI+ LP+ Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  466  RENILYGKGDATMEEINHAAKLSEAITFINHLPDRYETQVGERGIQLSGGQKQRIAISRA  525

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  526  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDGG  585

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  586  RIVETGTHEQLMANPCSAYSSLIQLQEAAQ  615



>gb|ABG75919.1| MDR-like ABC transporter [Ginkgo biloba]
Length=1279

 Score =   416 bits (1069),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 210/274 (77%), Positives = 250/274 (91%), Gaps = 3/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + VASVFE++DR+TEI  D   GEEL +VEG IEL+ V+FSYPSRPD  IFKDFN+RVR 
Sbjct  1007  EAVASVFEIIDRRTEIPPDDPTGEELGRVEGVIELKHVDFSYPSRPDVIIFKDFNLRVRA  1066

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S+ALVG SGSGKSS+++LILR+YDP++GKV +DGKDI+ +K +SLRKHIGLVQQEPAL
Sbjct  1067  GRSVALVGSSGSGKSSILALILRYYDPMAGKVTVDGKDIRKVKARSLRKHIGLVQQEPAL  1126

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FAT+IYENI+YG+EGATE+EVIEAAKLANAHSFIS+LP+GY T+VGERGVQLSGGQKQRV
Sbjct  1127  FATTIYENIMYGREGATEAEVIEAAKLANAHSFISSLPDGYQTEVGERGVQLSGGQKQRV  1186

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESERIVQQALDRLMK+RT+V++AHRLSTI+NAD I 
Sbjct  1187  AIARAVLKDPAILLLDEATSALDAESERIVQQALDRLMKNRTTVMIAHRLSTIQNADVIS  1246

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             VLQDGK+ EQGTHS+L+ ++DGAY KLI+LQQ+Q
Sbjct  1247  VLQDGKVAEQGTHSSLL-SKDGAYTKLISLQQNQ  1279


 Score =   348 bits (894),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/271 (63%), Positives = 218/271 (80%), Gaps = 2/271 (1%)
 Frame = -2

Query  883  SVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            S+F++++R + I +    G +L KVEG IELR+V FSYPSRPD  IF++ + R+  GK +
Sbjct  370  SIFQMINRNSAISSGSRTGNKLAKVEGNIELRNVYFSYPSRPDVVIFQNLSFRIPAGKVV  429

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A+VG SGSGKS+VISLI RFYDP+SG+VM+DG +I++L+LK LR  IGLV QEPALFATS
Sbjct  430  AIVGGSGSGKSTVISLIERFYDPVSGEVMLDGHNIRSLELKWLRGQIGLVNQEPALFATS  489

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  A+  E+++AAKL++A+ FI+ LP+ Y T+VGERGVQLSGGQKQR+AI+R
Sbjct  490  IRENILYGKNDASTEEIVQAAKLSDAYLFINNLPDRYETQVGERGVQLSGGQKQRIAISR  549

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLST+KNAD I V+Q+
Sbjct  550  AILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVKNADIIAVVQN  609

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            GKI+E G H  LI    GAY  L+ LQ+ +Q
Sbjct  610  GKIVECGDHEDLIRREGGAYAALVKLQETRQ  640



>ref|XP_004953524.1| PREDICTED: ABC transporter B family member 2-like [Setaria italica]
Length=1257

 Score =   413 bits (1062),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 208/266 (78%), Positives = 244/266 (92%), Gaps = 0/266 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMV+SVF++LDRKT++  D GE++ +VEG IELR VEF YP+RPD  +FK  ++ ++ GK
Sbjct  976   QMVSSVFDILDRKTDVRIDTGEDIKRVEGLIELRGVEFRYPARPDVTVFKGLDLLMKAGK  1035

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+G+++IDGKDIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1036  SMALVGMSGSGKSTVLSLILRFYDPIAGRILIDGKDIKKLKLKSLRKHIGLVQQEPALFA  1095

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IYENILYGK+GATE+EVIEAAKLANAHSFIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  1096  TTIYENILYGKDGATEAEVIEAAKLANAHSFISSLPEGYQTKVGERGVQLSGGQKQRIAI  1155

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQALDR+MK+RT+V+VAHRLSTIKNAD I VL
Sbjct  1156  ARAIVKDPAILLLDEATSALDVESERVVQQALDRVMKNRTTVMVAHRLSTIKNADVISVL  1215

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLI  98
             QDGKIIEQG H  LIENR+GAY+KL+
Sbjct  1216  QDGKIIEQGGHQQLIENRNGAYHKLV  1241


 Score =   322 bits (826),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/270 (60%), Positives = 202/270 (75%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T  +  +  G  L  V G I+ R V FSYPSRPD  I   F++    GK +A
Sbjct  341  IFQMIERSTVNKASSKTGRTLPAVNGHIQFRSVHFSYPSRPDVVILDRFSLDFPAGKIVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P+SG +++DG DIK L +K LR+ IGLV QEPALFATSI
Sbjct  401  LVGGSGSGKSTVVSLIERFYEPLSGSILLDGHDIKELDVKWLRRQIGLVNQEPALFATSI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGKE AT  E+  AAKL+ A +FI+ LP  Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  461  RENILYGKEDATMEEINHAAKLSEAITFINHLPGRYETQVGERGIQLSGGQKQRIAISRA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP +LLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  521  ILKNPSVLLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDGG  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  581  RIVETGTHEQLMANPCSAYSSLIQLQEAAQ  610



>ref|XP_008676453.1| PREDICTED: uncharacterized protein LOC100191944 isoform X1 [Zea 
mays]
 gb|ACN33264.1| unknown [Zea mays]
 gb|AFW63454.1| hypothetical protein ZEAMMB73_169648 [Zea mays]
Length=1262

 Score =   405 bits (1041),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 200/266 (75%), Positives = 242/266 (91%), Gaps = 0/266 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QM +SVFE+LDRKT++  D GE++ +VEG IELR +EF YPSRPD  +FK  ++ ++ GK
Sbjct  979   QMASSVFEILDRKTDVRIDTGEDIKRVEGLIELRGIEFRYPSRPDVTVFKGLDLLMKAGK  1038

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVG SGSGKS+V+SLILRFYDPI+G+V+IDGKD+K LKLK LRKHIGLVQQEPALFA
Sbjct  1039  SMALVGMSGSGKSTVLSLILRFYDPIAGRVLIDGKDVKKLKLKCLRKHIGLVQQEPALFA  1098

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             T+IY+NILYGK+GATE+EV+EAAKLANAHSFIS+LPEGY TKVGERGVQLSGGQKQR+AI
Sbjct  1099  TTIYDNILYGKDGATEAEVVEAAKLANAHSFISSLPEGYKTKVGERGVQLSGGQKQRIAI  1158

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARA++K+P ILLLDEATSALDVESER+VQQAL+R+M++RT+V+VAHRLST+KNAD I VL
Sbjct  1159  ARAIVKDPAILLLDEATSALDVESERVVQQALNRVMRNRTTVMVAHRLSTVKNADVISVL  1218

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLI  98
             QDGKIIEQG H  LIE+++GAY+KL+
Sbjct  1219  QDGKIIEQGAHQHLIEDKNGAYHKLV  1244


 Score =   324 bits (830),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 204/270 (76%), Gaps = 2/270 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++R T   A    G  L  V+G I+ R+V+FSYPSRPD  I   F++    GK +A
Sbjct  343  IFQMIERSTVNTASSRTGRTLPVVDGHIQFRNVDFSYPSRPDVVILDRFSLNFPAGKIVA  402

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFY+P+SG +++DG DIK L +K LR+ IGLV QEPALFATSI
Sbjct  403  LVGGSGSGKSTVVSLIERFYEPLSGSILLDGHDIKELDVKWLRRQIGLVNQEPALFATSI  462

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  E+  AAKL+ A +FI+ LP+ Y T+VGERG+QLSGGQKQR+AI+RA
Sbjct  463  RENILYGKGDATAEEINHAAKLSEAITFINHLPDRYETQVGERGIQLSGGQKQRIAISRA  522

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VV+AHRLSTI+NAD I V+  G
Sbjct  523  ILKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVIAHRLSTIRNADTIAVVDGG  582

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            +I+E GTH  L+ N   AY  LI LQ+  Q
Sbjct  583  RIVETGTHEQLMANPYSAYSSLIQLQEAAQ  612



>ref|XP_001757525.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
 gb|EDQ77582.1| ATP-binding cassette transporter, subfamily B, member 18, group 
MDR/PGP protein PpABCB18 [Physcomitrella patens]
Length=1251

 Score =   398 bits (1022),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 232/272 (85%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             +ASVFE+LDRKT I  D  +GEE+ +V+G IEL+ V F+YP RPD  IF +F+++V+ G+
Sbjct  970   LASVFEILDRKTAIDPDSPLGEEVTRVQGEIELKHVSFAYPQRPDIHIFTNFDLKVKKGR  1029

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVGQSGSGKSSVI+LI RFYDP+SG V +DG DI+ ++LKSLR+HIGLV QEP+LFA
Sbjct  1030  SLALVGQSGSGKSSVIALIQRFYDPLSGAVFVDGIDIRKMRLKSLRRHIGLVSQEPSLFA  1089

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SIYENILYGKEGA+ESEVIEAAK ANAHSFIS LP GY T+VGERG+QLSGGQKQRVAI
Sbjct  1090  CSIYENILYGKEGASESEVIEAAKTANAHSFISGLPNGYQTEVGERGMQLSGGQKQRVAI  1149

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD +SE++VQ+ALDR+M  RT+VV+AHRLSTI+N + I V+
Sbjct  1150  ARAVLKDPSILLLDEATSALDSQSEKLVQEALDRMMYRRTTVVIAHRLSTIRNVNAIAVI  1209

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             + GK++EQGTHS L+ N DGAY +L+ LQ  Q
Sbjct  1210  KAGKVVEQGTHSALMANADGAYTQLVKLQHRQ  1241


 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 206/254 (81%), Gaps = 1/254 (0%)
 Frame = -2

Query  835  GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISLIL  656
            G  L +V G I+L++V FSYPSRPD  IF++  + +  GKS ALVG SGSGKS+VI+LI 
Sbjct  344  GSILCQVRGQIQLKNVAFSYPSRPDVQIFQNLCLTIPAGKSAALVGGSGSGKSTVIALIE  403

Query  655  RFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESEVI  476
            RFYDP SG+V++DG +IKNL+L+ LR+ IGLV QEPALFATSI ENILYGK+GAT  E+ 
Sbjct  404  RFYDPSSGEVLLDGFNIKNLELQWLREQIGLVNQEPALFATSILENILYGKDGATIQEIQ  463

Query  475  EAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSAL  296
            +AAK ANAH+FI +LP GY T+VGE+GVQLSGGQKQRVAIARA+LKNP ILLLDEATSAL
Sbjct  464  DAAKAANAHAFIDSLPNGYDTQVGEKGVQLSGGQKQRVAIARAMLKNPSILLLDEATSAL  523

Query  295  DVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDG  116
            D  SE IVQ+ALDRLM  RT+VVVAHRLSTIKNAD I VLQ G ++E GTH  L+ ++DG
Sbjct  524  DSGSESIVQEALDRLMLGRTTVVVAHRLSTIKNADMIAVLQQGVVVETGTHGELL-SQDG  582

Query  115  AYYKLINLQQHQQQ  74
            AY +L+ +Q+   Q
Sbjct  583  AYAQLVKMQEATGQ  596



>ref|XP_004167222.1| PREDICTED: ABC transporter B family member 19-like, partial [Cucumis 
sativus]
Length=402

 Score =   375 bits (962),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 224/273 (82%), Gaps = 3/273 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R G+
Sbjct  130  IGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVDFAYPSRPDVMVFKDLNLRIRAGQ  189

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SGSGKSSVI+LI RFYDP++GKVMIDGKDI+ L L+SLR  IGLVQQEPALFA
Sbjct  190  SQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDIRRLNLQSLRLKIGLVQQEPALFA  249

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             SI++NI YGK+GATESEVIEAA+ AN H F+S LP+GY+T VGERGVQLSGGQKQR+AI
Sbjct  250  ASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPDGYNTPVGERGVQLSGGQKQRIAI  309

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI++ D I V+
Sbjct  310  ARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRSVDSIGVV  369

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            QDG+I+EQG+H+ L+   +GAY +L+ L QHQ 
Sbjct  370  QDGRIVEQGSHNELLSRAEGAYSRLLQL-QHQH  401



>dbj|BAF01897.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=600

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
            + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  326  EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMVFRDFNLRIRA  385

Query  721  GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
            G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  386  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  445

Query  541  FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
            FA +I++NI YGK+GATESEVI+AA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  446  FAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  505

Query  361  AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
            AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  506  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  565

Query  181  VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  566  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  599



>gb|KJB21123.1| hypothetical protein B456_003G183800 [Gossypium raimondii]
Length=1219

 Score =   393 bits (1010),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/267 (78%), Positives = 228/267 (85%), Gaps = 30/267 (11%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             QMVASVFE++DRKT+++ D GEEL  VEG                              K
Sbjct  974   QMVASVFEIMDRKTQVVGDAGEELTNVEG------------------------------K  1003

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             SMALVGQSGSGKSSV++LILRFYDP SGKVMIDG+DIK LKLKSLRKHIGLVQQEPALFA
Sbjct  1004  SMALVGQSGSGKSSVLALILRFYDPTSGKVMIDGRDIKKLKLKSLRKHIGLVQQEPALFA  1063

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYENILYGKEGA+ESEVIEAAKLANAHSFIS+LPEGYSTKVGERGVQLSGGQKQRVAI
Sbjct  1064  TSIYENILYGKEGASESEVIEAAKLANAHSFISSLPEGYSTKVGERGVQLSGGQKQRVAI  1123

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNPEILLLDEATSALDVESER+VQQALDRLM++RT+V+VAHRLSTIKNAD+I V+
Sbjct  1124  ARAVLKNPEILLLDEATSALDVESERVVQQALDRLMRNRTTVMVAHRLSTIKNADRISVI  1183

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLIN  95
             Q G+IIEQGTHS+LIENR+G Y+KLIN
Sbjct  1184  QGGRIIEQGTHSSLIENRNGPYFKLIN  1210


 Score =   336 bits (861),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 212/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKT--EILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +FE+++R T  +  +  G +L KVEG IEL++V FSYPSRPD  IF  F++ +  GK +A
Sbjct  342  IFEMIERNTVSKTSSKTGRKLSKVEGNIELKNVSFSYPSRPDVVIFDRFSLNIPAGKIVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+VISLI RFY+P++G++++DG +IK+L LK LR+ IGLV QEPALFAT+I
Sbjct  402  LVGGSGSGKSTVISLIERFYEPLAGEILLDGNNIKDLDLKWLRQQIGLVNQEPALFATTI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK+ AT  E+  AAKL+ A +FI+ LP+ + T+VGERG+QLSGGQKQR+AI+RA
Sbjct  462  RENILYGKDDATLDEITRAAKLSEAIAFINNLPDRFETQVGERGIQLSGGQKQRIAISRA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD ESE+ VQ+ALDR+M  RT+VVVAHRLSTI+NAD I V+Q G
Sbjct  522  IVKNPSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTIRNADVIAVVQSG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            KI+E GTH  LI N +  Y  L+ LQ+
Sbjct  582  KIVETGTHDELISNPNSTYSSLVQLQE  608



>ref|XP_007032499.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
 gb|EOY03425.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
Length=1213

 Score =   388 bits (997),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 226/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T+I  D   GE +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  939   EAVGSVFSILDRSTKIDPDDPEGEPVESIRGEIELRHVDFAYPSRPDVSVFKDLNLRIRA  998

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G++ ALVG SGSGKSSVI+LI RFYDPI+GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  999   GQNQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1058

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1059  FAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1118

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1119  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1178

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ LI   +GAY +L+ LQ H 
Sbjct  1179  VVQDGRIVEQGSHAELISRAEGAYSRLLQLQHHH  1212


 Score =   332 bits (852),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  298  LMEIIKQKPSIIQDHSDGKVLPEVNGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  357

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  358  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNMDIKTLQLKWLRDQIGLVNQEPALFATTI  417

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  418  LENILYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  477

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  478  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  537

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  538  QVVETGTHEELIA-KAGAYASLIRFQE  563



>gb|KHG20565.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   389 bits (998),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  975   EAVGSVFSILDRSTRIDPDDPEAEPVETIRGEIELRHVDFAYPSRPDVSVFKDFNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNITYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHH  1248


 Score =   319 bits (817),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF +F++    GK++A
Sbjct  335  LMEIINQKPSIIQDHLDGKVLEEVNGNIEFKEVTFSYPSRPDVIIFSNFSIFFPAGKTLA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAH FI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPEATMDEVEAAACAANAHCFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGAYASLIRFQE  600



>ref|XP_007032497.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
 gb|EOY03423.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
Length=1256

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 226/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T+I  D   GE +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTKIDPDDPEGEPVESIRGEIELRHVDFAYPSRPDVSVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G++ ALVG SGSGKSSVI+LI RFYDPI+GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQNQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ LI   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHAELISRAEGAYSRLLQLQHHH  1248


 Score =   332 bits (851),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEIIKQKPSIIQDHSDGKVLPEVNGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNMDIKTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGAYASLIRFQE  600



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score =   388 bits (996),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T +  D   G+ +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRVDPDDPEGDPVESIRGDIELRHVDFAYPSRPDVSVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDTIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H+
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHR  1248


 Score =   330 bits (845),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF +    GK++A
Sbjct  335  LMEIIKQKPTIVQDTLDGKCLSEVSGNIEFKNVTFSYPSRPDVIIFRDFCIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   +NAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATCASNAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI ++ GAY  LI  Q+
Sbjct  575  QVVETGTHEELI-SKAGAYASLIRFQE  600



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score =   387 bits (995),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T +  D   G+ +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRVDPDDPEGDPVESIRGDIELRHVDFAYPSRPDVSVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDTIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H+
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHR  1248


 Score =   328 bits (842),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF +    GK++A
Sbjct  335  LMEIIKQKPTIVQDTLDGKCLSEVSGNIEFKNVTFSYPSRPDVIIFRDFCIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   +NAH+FI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATCASNAHNFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI ++ GAY  LI  Q+
Sbjct  575  QVVETGTHEELI-SKAGAYASLIRFQE  600



>ref|XP_006603863.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Glycine max]
Length=1098

 Score =   384 bits (987),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D  +      + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  824   EAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELRHVDFAYPSRPDVMVFKDFNLRIRA  883

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI+GKVM+DGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  884   GQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKLNLKSLRLKIGLVQQEPAL  943

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  944   FAASIFENIAYGKEGATEAEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  1003

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1004  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1063

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H 
Sbjct  1064  VVQDGRIVEQGSHSELVSRHEGAYSRLLQLQHHH  1097


 Score =   330 bits (846),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  184  LMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVA  243

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  244  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  303

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  304  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  363

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  364  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  423

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E G H  LI  + G Y  LI  Q+
Sbjct  424  QVVETGAHEELIA-KAGTYASLIRFQE  449



>ref|XP_011008935.1| PREDICTED: ABC transporter B family member 19 [Populus euphratica]
Length=1251

 Score =   387 bits (994),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 225/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +L+R T+I  D    E +  + G IELR V+F+YPSRPD P+FKD N+R+R 
Sbjct  977   EAVGSVFSILERSTKIDPDDSEAEPVESLRGEIELRHVDFAYPSRPDVPVFKDLNLRIRA  1036

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SG GKSSVISLI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1037  GQSQALVGASGCGKSSVISLIERFYDPMAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1096

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGK+GATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1097  FAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYETPVGERGVQLSGGQKQRI  1156

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1157  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1216

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   DGAY++L+ LQ H 
Sbjct  1217  VVQDGRIVEQGSHSELVSRPDGAYFRLLQLQHHH  1250


 Score =   324 bits (830),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 201/267 (75%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ ++  I  D   G+ + +V G IE + V FSYPSRPD  IF+DF++    GK++A
Sbjct  337  LMEIIKQRPSITQDAADGKCMPEVNGNIEFKSVTFSYPSRPDVIIFRDFSIFFPAGKTVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDSVDIKTLQLRWLRDQIGLVNQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI YGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  457  LENIRYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  517  MLKNPKILLLDEATSALDASSESIVQEALDRLMIGRTTVVVAHRLSTIRNVDTIAVIQQG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             ++E GTH  LI  + GAY  LI  Q+
Sbjct  577  LVVETGTHEELIA-KAGAYASLIRFQE  602



>ref|XP_002981381.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
 gb|EFJ17569.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
Length=1239

 Score =   387 bits (993),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q + SVF +LDRKTEI  D    E +  ++G IELR V+F YP+RP+  IFK+ N++V  
Sbjct  962   QALKSVFAILDRKTEINPDDPSAETVKNMKGEIELRSVDFYYPTRPEVTIFKNLNLKVHI  1021

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S+A+VG SGSGKSSVISL+ RFYDP++GKV++DGKDI+ L L+S R+ +GLVQQEPAL
Sbjct  1022  GQSLAIVGASGSGKSSVISLVERFYDPVAGKVLVDGKDIRLLNLRSYRRFVGLVQQEPAL  1081

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FATSI ENI YGKE ATESE+IEAA  ANAH+FISALP+GY T VGERG QLSGGQKQRV
Sbjct  1082  FATSIQENIRYGKEDATESEIIEAATAANAHNFISALPDGYKTSVGERGAQLSGGQKQRV  1141

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP ILLLDEATSALD ESE IVQ+ALDRLMK RT++VVAHRLSTI+NAD+I 
Sbjct  1142  AIARAVLKNPTILLLDEATSALDAESEHIVQEALDRLMKGRTTIVVAHRLSTIRNADKIA  1201

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG I+EQG+H  L+   DGAY  LI LQQ  
Sbjct  1202  VIQDGTIVEQGSHWELVAKADGAYSHLIKLQQQH  1235


 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -2

Query  835  GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISLIL  656
            GE L  VEG ++L+DV FSYPSRPD  +F+ F++ +   K +A+VG SGSGKS+V+SLI 
Sbjct  338  GETLSIVEGRVDLQDVHFSYPSRPDIKVFEGFSLSIPAAKCVAIVGGSGSGKSTVVSLIE  397

Query  655  RFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESEVI  476
            RFYDP SG++++DG DI+ L LK LR  IGLV QEPALFAT+I  NILYGK  AT  E+ 
Sbjct  398  RFYDPSSGRILVDGHDIRTLDLKWLRSQIGLVNQEPALFATTIRNNILYGKPSATREEIE  457

Query  475  EAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSAL  296
            +AAK ANAHSFIS LP+GY T+ GERGVQLSGGQKQR+AIARA+LKNP ILL DEATSAL
Sbjct  458  DAAKAANAHSFISQLPDGYETQAGERGVQLSGGQKQRIAIARAILKNPSILLFDEATSAL  517

Query  295  DVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRD-  119
            D ESE +VQ ALD+LM   T+V++AHRLST++NAD I V+Q+GKI+E GTH  L    D 
Sbjct  518  DAESEHVVQDALDKLMHGHTTVIIAHRLSTVQNADTIAVVQEGKIVELGTHDELSSRGDG  577

Query  118  GAYYKLINLQQHQQQC  71
            GAY  L++LQ   ++ 
Sbjct  578  GAYATLVHLQNMAREV  593



>ref|XP_002323847.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEF03980.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1251

 Score =   387 bits (993),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 225/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +L+R T+I  D    E +  + G IELR V+F+YPSRPD P+FKD N+R+R 
Sbjct  977   EAVGSVFSILERSTKIDPDDSEAEPVESLRGEIELRHVDFAYPSRPDVPVFKDLNLRIRA  1036

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SG GKSSVISLI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1037  GQSQALVGASGCGKSSVISLIERFYDPMAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1096

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGK+GATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1097  FAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1156

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1157  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1216

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   DGAY++L+ LQ H 
Sbjct  1217  VVQDGRIVEQGSHSELVSRPDGAYFRLLQLQHHH  1250


 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 201/267 (75%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ ++  I  D   G+ L +V G IE + V FSYPSRPD  IF+DF++    GK++A
Sbjct  337  LMEIIKQRPSITQDAVDGKCLAEVNGNIEFKSVTFSYPSRPDVIIFRDFSIFFPAGKTVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI YGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  457  LENIRYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  517  MLKNPKILLLDEATSALDASSESIVQEALDRLMIGRTTVVVAHRLSTIRNVDTIAVIQQG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             ++E GTH  LI  + GAY  LI  Q+
Sbjct  577  LVVETGTHEELIA-KAGAYASLIRFQE  602



>ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1259

 Score =   387 bits (993),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+FSYPSRPD P+FKD N+R+R 
Sbjct  985   EAVGSVFSILDRSTRIDPDDPEAEPVESIRGEIELRHVDFSYPSRPDVPVFKDLNLRIRA  1044

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SG GKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  +GLVQQEPAL
Sbjct  1045  GQSQALVGASGCGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKVGLVQQEPAL  1104

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI+YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1105  FAASIFDNIVYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1164

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1165  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1224

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ L+   DGAY +L+ LQ H 
Sbjct  1225  VVQDGRIVEQGSHAELVSRGDGAYSRLLQLQHHH  1258


 Score =   321 bits (822),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L ++ G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  345  LMEIIKQKPTIIQDPSDGKCLPEINGNIEFKDVTFSYPSRPDVIIFRDFSIFFPAGKTVA  404

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  405  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  464

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  465  LENILYGKPDATMDEVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  524

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  525  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  584

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI ++  AY  LI  Q+
Sbjct  585  QVVETGTHEELI-SKGAAYASLIRFQE  610



>ref|XP_010937072.1| PREDICTED: ABC transporter B family member 19 [Elaeis guineensis]
Length=1253

 Score =   386 bits (992),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+R T I  D    E +  + G IELR V+F+YPSRPD PIFKDFN+R+R G+
Sbjct  981   IRSVFSILNRATRIDPDDPEAEPVESIRGEIELRHVDFAYPSRPDVPIFKDFNLRIRAGQ  1040

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPALFA
Sbjct  1041  SQALVGASGSGKSTVIGLIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFA  1100

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI+ENI YGK+GATE EVIEAA+ AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1101  ASIFENIAYGKDGATEEEVIEAARAANVHGFVSALPEGYKTAVGERGVQLSGGQKQRIAI  1160

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+RLM+ RT+++VAHRLSTI+  D I V+
Sbjct  1161  ARAVLKDPAVLLLDEATSALDAESECVLQEALERLMRGRTTILVAHRLSTIRGVDSIAVV  1220

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+EQG+HS L+   DGAY +L+ LQ H 
Sbjct  1221  QDGRIVEQGSHSELVARADGAYSRLLQLQHHH  1252


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/268 (63%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I  D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK+ A
Sbjct  337  LMEIIRQKPSITQDSSDGKCLAEVHGNIEFKDVTFSYPSRPDVIIFRDFSLFFPAGKTAA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR+ IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLREQIGLVNQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFIS LP GY T+ GERGVQLSGGQKQR+AIARA
Sbjct  457  LENILYGKPDATIAEVEAAASAANAHSFISLLPNGYDTQAGERGVQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTIKN D I V+Q G
Sbjct  517  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIKNVDMIAVIQQG  576

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  577  QVVETGTHEELLAKGSSGAYASLIRFQE  604



>gb|KJB33610.1| hypothetical protein B456_006G021600 [Gossypium raimondii]
Length=1150

 Score =   384 bits (986),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  876   EAVGSVFSILDRSTRIDPDDPEAEPVETIRGEIELRHVDFAYPSRPDVSVFKDLNLRIRA  935

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMI+GKDI+ L LKSLR  IGLVQQEPAL
Sbjct  936   GQSQALVGASGSGKSSVIALIERFYDPTAGKVMINGKDIRRLNLKSLRLKIGLVQQEPAL  995

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  996   FAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1055

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1056  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1115

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1116  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHH  1149


 Score =   320 bits (820),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF +F++    GK++A
Sbjct  236  LMEIINQKPSIIQDHLDGKVLEEVNGNIEFKEVTFSYPSRPDVIIFSNFSIFFPAGKTIA  295

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  296  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  355

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  356  LENILYGKPEATMDEVEAAACAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  415

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  416  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  475

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  476  QVVETGTHEELIA-KAGAYASLIRFQE  501



>ref|XP_002969904.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29028.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1239

 Score =   385 bits (990),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q + SVF +LDRKTEI  D    E +  ++G IELR V+F YP+RP+  IFK+ N++V  
Sbjct  962   QALKSVFAILDRKTEINPDDPSAETVKNMKGEIELRSVDFYYPTRPEVTIFKNLNLKVHI  1021

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S+A+VG SGSGKSSVISL+ RFYDP++GKV++DGKDI+ L L+S R+ +GLVQQEPAL
Sbjct  1022  GQSLAIVGASGSGKSSVISLVERFYDPVAGKVLVDGKDIRLLNLRSYRRFVGLVQQEPAL  1081

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FATSI ENI YGKE ATESE+IEAA  ANAH+FISALP+GY T VGERG QLSGGQKQRV
Sbjct  1082  FATSIQENIRYGKEDATESEIIEAATAANAHNFISALPDGYKTSVGERGAQLSGGQKQRV  1141

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP ILLLDEATSALD ESE IVQ+ALDRLM+ RT++VVAHRLSTI+NAD+I 
Sbjct  1142  AIARAVLKNPTILLLDEATSALDAESEHIVQEALDRLMRGRTTIVVAHRLSTIRNADKIA  1201

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG I+EQG+H  L+   DGAY  LI LQQ  
Sbjct  1202  VIQDGTIVEQGSHWELVAKADGAYSHLIKLQQQH  1235


 Score =   334 bits (857),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 197/256 (77%), Gaps = 1/256 (0%)
 Frame = -2

Query  835  GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISLIL  656
            GE L  VEG ++L+DV FSYPSRPD  +F+ F++ +   K +A+VG SGSGKS+V+SLI 
Sbjct  338  GETLSIVEGHVDLQDVHFSYPSRPDIKVFEGFSLSIPAAKCVAIVGGSGSGKSTVVSLIE  397

Query  655  RFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESEVI  476
            RFYDP SG++++DG DI+ L LK LR  IGLV QEPALFAT+I  NILYGK  AT  E+ 
Sbjct  398  RFYDPTSGRILVDGHDIRTLDLKWLRSQIGLVNQEPALFATTIRNNILYGKPSATREEIE  457

Query  475  EAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSAL  296
            +AAK ANAHSFIS LP GY T+ GERGVQLSGGQKQR+AIARA+LKNP ILL DEATSAL
Sbjct  458  DAAKAANAHSFISQLPHGYETQAGERGVQLSGGQKQRIAIARAILKNPSILLFDEATSAL  517

Query  295  DVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRD-  119
            D ESE +VQ ALD+LM   T+V++AHRLSTI+NAD I V+Q+GKI+E GTH  L    D 
Sbjct  518  DAESEHVVQDALDKLMHGHTTVIIAHRLSTIQNADTIAVVQEGKIVELGTHDELSSRGDG  577

Query  118  GAYYKLINLQQHQQQC  71
            GAY  L++LQ   ++ 
Sbjct  578  GAYATLVHLQNMAREV  593



>ref|XP_008230752.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
 ref|XP_008230753.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
Length=1249

 Score =   385 bits (990),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D  E  I   + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  975   EAVGSVFSILDRQTRIDPDDPEAEIVETIRGEIELRHVDFAYPSRPDIMVFKDFNLRIRT  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E G+HS L+   DGAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEHGSHSELVSRPDGAYSRLLQLQHHH  1248


 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L  V G IE ++V FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEIIKQKPTIIQDPLDGKCLSDVNGNIEFKEVTFSYPSRPDVIIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V+ID  DI+ L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIRTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT ++V  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMADVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGAYASLIRFQE  600



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score =   385 bits (990),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEE--LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T +  D  E   +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRVDPDDPEADPVESIRGDIELRHVDFAYPSRPDVSVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDTIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H+
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHR  1248


 Score =   332 bits (852),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DFN+    GK++A
Sbjct  335  LMEIIRQKPTIVQDTLDGKCLSEVSGNIEFKNVTFSYPSRPDVIIFRDFNIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   +NAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATCASNAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI ++ GAY  LI  Q+
Sbjct  575  QVVETGTHEELI-SKAGAYASLIRFQE  600



>gb|KHN45492.1| ABC transporter B family member 19 [Glycine soja]
Length=1214

 Score =   384 bits (987),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D  +      + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  940   EAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELRHVDFAYPSRPDVMVFKDFNLRIRA  999

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI+GKVM+DGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1000  GQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKLNLKSLRLKIGLVQQEPAL  1059

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1060  FAASIFENIAYGKEGATEAEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  1119

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1120  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1179

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H 
Sbjct  1180  VVQDGRIVEQGSHSELVSRHEGAYSRLLQLQHHH  1213


 Score =   330 bits (846),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  300  LMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVA  359

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  360  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  419

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  420  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  479

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  480  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  539

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E G H  LI  + G Y  LI  Q+
Sbjct  540  QVVETGAHEELIA-KAGTYASLIRFQE  565



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score =   385 bits (988),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      V G IE R V+F+YPSRPD  +FKDFN+R+R 
Sbjct  976   EAVGSVFSVLDRQTRIDPDDPDADPVETVRGEIEFRHVDFAYPSRPDVMVFKDFNVRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP++GKVMIDGKDI+ L LKSLR  I LVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPVAGKVMIDGKDIRRLNLKSLRLKIALVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I+ENI YGKEGATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FAANIFENIAYGKEGATESEVIEAARAANAHGFISGLPEGYKTMVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+   +I 
Sbjct  1156  AIARAVLKNPRVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVHKIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E+G+HS LI   DGAY +L+ LQ H+
Sbjct  1216  VVQDGRIVEEGSHSELISRPDGAYSRLLQLQSHR  1249


 Score =   315 bits (806),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 208/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRP   IF++F++ +  GK++A
Sbjct  336  LMEIINQKPSIIQDPLDGKCLDEVRGNIEFKDVTFSYPSRPAVIIFRNFSIFLPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G++++DG DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNDGQILLDGVDIKTLQLKFLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A  +EV  AA  ANAHSFI+ LP+GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDAKMAEVEAAASAANAHSFITLLPDGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTIKN D I V+Q G
Sbjct  516  MLKDPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIKNVDSIVVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E G H  LI  + GAY  LI  Q+
Sbjct  576  QVVETGNHEELIA-KAGAYASLIRFQE  601



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   384 bits (987),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 224/273 (82%), Gaps = 2/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF +LDRKTEI  D    E +  + G IE + V FSYPSRPD  IF D N++VR G 
Sbjct  969   VGSVFAILDRKTEIDPDEPDSEVITHIRGDIEFKRVNFSYPSRPDVAIFYDLNLKVRAGS  1028

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVG SGSGKSSV++LI RFYDP +GKV+IDG DI+ + LKSLR HIGLVQQEPALFA
Sbjct  1029  SLALVGASGSGKSSVVALIQRFYDPSAGKVLIDGMDIRRINLKSLRLHIGLVQQEPALFA  1088

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYEN+ YG++GATESEV+EAAK  NAHSFIS+LP+GY T+VGERG QLSGGQKQRVAI
Sbjct  1089  TSIYENVAYGRDGATESEVVEAAKAGNAHSFISSLPDGYQTQVGERGTQLSGGQKQRVAI  1148

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALD +SE++VQ+ALDRLM+ RT+V+VAHRLSTI+NA  I V+
Sbjct  1149  ARAVLKNPAILLLDEATSALDAQSEKVVQEALDRLMRGRTTVLVAHRLSTIQNAGVIAVV  1208

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             + G+I+EQG+H  L+   DGAY +L+ LQQ ++
Sbjct  1209  EGGRIVEQGSHRELMAKGDGAYARLVRLQQMKE  1241


 Score =   267 bits (683),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 188/269 (70%), Gaps = 5/269 (2%)
 Frame = -2

Query  883  SVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            ++ E++ RK  I  +   G+ +  V+G IE  D+ FSYPSRPD  IF+   +++  GK++
Sbjct  337  NILEMIKRKPAINPNTSDGKTISNVQGNIEFVDIHFSYPSRPDVTIFQKLCLKIPQGKTV  396

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A+VG SGSGKS+VI+LI RFYDP+   V       +++  +   +     +    +  T+
Sbjct  397  AIVGGSGSGKSTVIALIERFYDPMHNLVRFSRH--QDVAAQMATESNWSCESRAGIICTT  454

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENIL GK  A++ E+ EAA +A AH+FI  LP+GY T+VGE+GVQLSGGQKQRVAI R
Sbjct  455  IRENILLGKPDASDDEIFEAATVAGAHAFIQQLPDGYETQVGEKGVQLSGGQKQRVAITR  514

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A++KNP ILLLDEATSALD  SE+ VQ+ALD LM  RT+VVVAHRLST++NAD I V+Q 
Sbjct  515  AMVKNPSILLLDEATSALDAASEQSVQEALDTLMIGRTTVVVAHRLSTVQNADIIAVVQG  574

Query  169  GKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            GKI+E GTHS L+ +   GAY +L+ LQ+
Sbjct  575  GKIVETGTHSALMAKGESGAYCELVRLQE  603



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   384 bits (987),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMVFRDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   DGAY +L+ LQ H+
Sbjct  1218  VIQDGRIVEQGSHSELVSRPDGAYSRLLQLQTHR  1251


 Score =   323 bits (829),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  338  LMEIINQKPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP SG++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KSGAYASLIRFQE  603



>gb|AIU41631.1| ABC transporter family protein [Hevea brasiliensis]
Length=1259

 Score =   384 bits (987),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I +D    E +  V G IELR V+F+YPSR D P+FKD N+R+R 
Sbjct  985   EAVGSVFSILDRSTRIDSDDPEAEPVEAVHGEIELRHVDFAYPSRSDVPVFKDLNLRIRA  1044

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SG GKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1045  GQSQALVGASGCGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1104

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGK+GATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1105  FAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1164

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1165  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1224

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   DGAY +L+ LQ HQ
Sbjct  1225  VVQDGRIVEQGSHSELISRVDGAYSRLLQLQHHQ  1258


 Score =   315 bits (806),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 203/267 (76%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L  V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  345  LMEIIKQKPSIIQDPSDGKCLPGVNGNIEFKDVTFSYPSRPDVMIFRDFSIFFPAGKTVA  404

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  D+K L+L+ LR  IGLV QEPALFAT+I
Sbjct  405  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDLKTLQLRWLRDQIGLVNQEPALFATTI  464

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT   V  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  465  LENILYGKPDATMDGVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  524

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT++VVAHRLSTI+N D I V+Q G
Sbjct  525  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTIVVAHRLSTIRNVDTIAVIQQG  584

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  +  AY  LI  Q+
Sbjct  585  QVVETGTHEELIA-KGRAYASLIRFQE  610



>ref|XP_001774240.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
 gb|EDQ61016.1| ATP-binding cassette transporter, subfamily B, member 24, group 
MDR protein PpABCB24 [Physcomitrella patens]
Length=1236

 Score =   384 bits (986),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 227/276 (82%), Gaps = 6/276 (2%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q + S+F++LDRKTEI  +  +GE+L +V+G IELR V FSYPSR + PIF+DFN+RVR 
Sbjct  955   QSLLSIFQILDRKTEIDPEQSIGEQLQEVKGEIELRHVVFSYPSRNEVPIFEDFNLRVRA  1014

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S+A+VG SG GKSSVISLILRFYDP+SG+V+IDGKDI+ L L+SLRKH+GLVQQEPAL
Sbjct  1015  GSSLAIVGASGVGKSSVISLILRFYDPLSGRVLIDGKDIRRLHLRSLRKHMGLVQQEPAL  1074

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FATSIYENI YGKE ATESE+IEAAK+ANAH+FISALP+GY T VGERG QLS GQKQRV
Sbjct  1075  FATSIYENIRYGKEDATESEIIEAAKVANAHTFISALPKGYRTLVGERGAQLSAGQKQRV  1134

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVL++P ILLLDEATS+LD +SE +VQ ALD++M  RT+VV+AHRLSTI+NAD I 
Sbjct  1135  AIARAVLRSPAILLLDEATSSLDAQSEMVVQDALDQVMVGRTTVVIAHRLSTIQNADSIA  1194

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQQ  74
             VLQDG + EQG+H  LI      Y  L+    HQQ 
Sbjct  1195  VLQDGMVTEQGSHQDLINMPTSTYAHLV----HQQN  1226


 Score =   314 bits (805),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 199/250 (80%), Gaps = 1/250 (0%)
 Frame = -2

Query  835  GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISLIL  656
            G +L  V G IELRDV FSYP+RPDTP+F++FN+ ++  KS+A+VG SG GKS+++SLI 
Sbjct  349  GMQLALVVGNIELRDVGFSYPTRPDTPVFQNFNLTIQAAKSVAIVGSSGCGKSTLVSLIE  408

Query  655  RFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESEVI  476
            RFYDP SG+V++DG ++K L LK LR+ IGLV QEPALFATSI EN+LYGKE AT  E+I
Sbjct  409  RFYDPTSGEVLLDGNNLKILDLKWLRRQIGLVNQEPALFATSIRENLLYGKEDATIDEII  468

Query  475  EAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSAL  296
             A   A AHSFI+  P GY T+VGERGVQLSGG++QR+AIARA+L +P+IL+LDEATSAL
Sbjct  469  AATTAAFAHSFINRFPHGYDTQVGERGVQLSGGERQRLAIARAMLTDPKILILDEATSAL  528

Query  295  DVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRD-  119
            D  SE+IV +ALD LM  RT+VV+AHRLST++NAD I V+Q G+I+E G+H  L+   + 
Sbjct  529  DSCSEQIVCKALDSLMVGRTTVVIAHRLSTVRNADTIAVMQHGQIVESGSHEMLMAKEEP  588

Query  118  GAYYKLINLQ  89
            GAY  LI++Q
Sbjct  589  GAYAALIHMQ  598



>gb|KJB11390.1| hypothetical protein B456_001G256100 [Gossypium raimondii]
Length=1249

 Score =   384 bits (986),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRIDPDDPEAEPVESIRGEIELRHVDFAYPSRPDVIVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELIAQPEGAYSRLLQLQHHH  1248


 Score =   322 bits (825),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I  D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK+MA
Sbjct  335  LMEIIKQKPSITEDHLDGKVLPEVNGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTMA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+S++ RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSMVERFYDPNEGQVLLDNVDIKTLQLKWLRSQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAH+FI+ LP GYST+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMDEVEAAASAANAHNFITLLPNGYSTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI ++ GAY  LI  Q+
Sbjct  575  QVVEIGTHEELI-SKAGAYASLIRFQE  600



>ref|XP_003554410.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
Length=1250

 Score =   384 bits (986),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D  +      + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  976   EAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELRHVDFAYPSRPDVMVFKDFNLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI+GKVM+DGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASIFENIAYGKEGATEAEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEQGSHSELVSRHEGAYSRLLQLQHHH  1249


 Score =   330 bits (845),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  336  LMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E G H  LI  + G Y  LI  Q+
Sbjct  576  QVVETGAHEELIA-KAGTYASLIRFQE  601



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   384 bits (985),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 224/273 (82%), Gaps = 2/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF +LDRKTEI  D    E +  + G IE + V FSYPSRPD  IF D N++VR G 
Sbjct  958   VGSVFAILDRKTEIDPDEPDSEIITHIRGDIEFKRVNFSYPSRPDVTIFYDLNLKVRAGS  1017

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S+ALVG SGSGKSSV++LI RFYDP +GKV+IDG DI+ + LKSLR HIGLVQQEPALFA
Sbjct  1018  SLALVGASGSGKSSVVALIQRFYDPSAGKVLIDGMDIRRINLKSLRLHIGLVQQEPALFA  1077

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSIYEN+ YG++GATESEV+EAAK  NAHSFIS+LP+GY T+VGERG QLSGGQKQRVAI
Sbjct  1078  TSIYENVAYGRDGATESEVVEAAKAGNAHSFISSLPDGYQTQVGERGTQLSGGQKQRVAI  1137

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALD +SE++VQ+ALDRLM+ RT+V+VAHRLSTI+NA  I V+
Sbjct  1138  ARAVLKNPAILLLDEATSALDAQSEKVVQEALDRLMRGRTTVLVAHRLSTIQNAGVIAVV  1197

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             + G+I+EQG+H  L+   DGAY +L+ LQQ ++
Sbjct  1198  EGGRIVEQGSHRELMAKGDGAYARLVRLQQMKE  1230


 Score =   322 bits (826),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 206/269 (77%), Gaps = 3/269 (1%)
 Frame = -2

Query  883  SVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            ++ E++ RK  I  +   G+ +  V+G IE  D+ FSYPSRPD  IF+   +++  GK++
Sbjct  337  NILEMIKRKPAINPNTSDGKTISNVQGNIEFVDIHFSYPSRPDVTIFQKLCLKIPQGKTV  396

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A+VG SGSGKS+VI+LI RFYDP+SG +++D  DIK L+LK LR  IGLV QEPALFAT+
Sbjct  397  AIVGGSGSGKSTVIALIERFYDPMSGIILLDSHDIKTLQLKWLRSQIGLVNQEPALFATT  456

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENIL GK  A++ E+ EAA +A AH+FI  LP+GY T+VGE+GVQLSGGQKQRVAI R
Sbjct  457  IRENILLGKPDASDDEIFEAATVAGAHAFIQQLPDGYETQVGEKGVQLSGGQKQRVAITR  516

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A++KNP ILLLDEATSALD  SE+ VQ+ALD LM  RT+VVVAHRLST++NAD I V+Q 
Sbjct  517  AMVKNPSILLLDEATSALDAASEQSVQEALDTLMVGRTTVVVAHRLSTVQNADIIAVVQG  576

Query  169  GKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            GKI+E GTHS L+ +   GAY +L+ LQ+
Sbjct  577  GKIVETGTHSALMAKGESGAYCELVRLQE  605



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score =   384 bits (985),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E++  V G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  976   EAVGSVFSILDRSTRIDPDDPDAEQVESVRGEIELRHVDFAYPSRPDVMVFKDFSLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDGKDIRKLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI ENI YGKEGATE+EVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASILENIAYGKEGATEAEVIEAARSANVHAFVSGLPEGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHH  1249


 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 202/267 (76%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L +V G IE +DV FSYPSRPD  IF+ F++    GK++A
Sbjct  336  LMEIIRQKPTIVEDLLDGKTLAEVNGNIEFKDVTFSYPSRPDVIIFRKFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATIDEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDAGSESIVQEALDRLMIGRTTVVVAHRLSTIRNVDTIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             ++E GTH  L   + G Y  LI  Q+
Sbjct  576  LVVETGTHEELFA-KGGTYASLIRFQE  601



>gb|KJB33609.1| hypothetical protein B456_006G021600 [Gossypium raimondii]
Length=1249

 Score =   384 bits (985),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRIDPDDPEAEPVETIRGEIELRHVDFAYPSRPDVSVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMI+GKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTAGKVMINGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHH  1248


 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF +F++    GK++A
Sbjct  335  LMEIINQKPSIIQDHLDGKVLEEVNGNIEFKEVTFSYPSRPDVIIFSNFSIFFPAGKTIA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPEATMDEVEAAACAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGAYASLIRFQE  600



>ref|XP_004304313.1| PREDICTED: ABC transporter B family member 19 [Fragaria vesca 
subsp. vesca]
Length=1250

 Score =   383 bits (984),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 226/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGE-ELIK-VEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D  E E+++ + G IELR V+F+YPSRPD  IFKDFN+R+R 
Sbjct  976   EAVGSVFSILDRQTRIDPDDPEAEVVETIRGEIELRHVDFAYPSRPDIMIFKDFNLRIRT  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKS+VI+LI RFYDPI GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSTVIALIERFYDPIVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASIFDNIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E G+HS L+   DGAY +L+ LQ H+
Sbjct  1216  VVQDGRIVEHGSHSELVSRPDGAYSRLLQLQNHR  1249


 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 208/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IEL++V FSYPSRPD  IF++F++    GK++A
Sbjct  336  LMEIIKQKPTIIQDQLDGKCLSEVNGNIELKEVTFSYPSRPDVIIFRNFSIFFPAGKTIA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++DG DI+ L+LK LR  +GLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNHGQVLLDGVDIRTLQLKWLRDQMGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKADATMDEVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKDPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELIA-KAGAYSSLIRFQE  601



>ref|XP_006593671.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Glycine max]
Length=1091

 Score =   380 bits (977),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D  +      + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  817   EAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELRHVDFAYPSRPDVMVFKDLNLRIRA  876

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI+GKVM+DGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  877   GQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKLNLKSLRLKIGLVQQEPAL  936

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  937   FAASIFENIAYGKEGATEAEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  996

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  997   AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1056

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H 
Sbjct  1057  VVQDGRIVEQGSHSELVSRPEGAYSRLLQLQHHH  1090


 Score =   331 bits (849),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  177  LMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVA  236

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  237  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  296

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  297  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  356

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  357  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  416

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + G Y  LI  Q+
Sbjct  417  QVVETGTHEELIA-KAGTYASLIRFQE  442



>ref|XP_007217651.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
 gb|EMJ18850.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
Length=1249

 Score =   383 bits (983),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LD +T I  D  E  I   + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  975   EAVGSVFSILDSQTRIDPDDPEAEIVETIRGEIELRHVDFAYPSRPDIMVFKDFNLRIRT  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E G+HS L+   DGAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEHGSHSELVSRPDGAYSRLLQLQHHH  1248


 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L  V G IE ++V FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEIIKQKPTIIQDPLDGKCLSDVNGNIEFKEVTFSYPSRPDVIIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V+ID  DI+ L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIRTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT ++V  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMADVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGAYASLIRFQE  600



>gb|KHG22495.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   382 bits (982),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRIDPDDPEAEPIESIRGEIELRHVDFAYPSRPDVIVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKV+IDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTAGKVVIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+N D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRNVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELIARPEGAYSRLLQLQHHH  1248


 Score =   321 bits (822),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I  D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK+MA
Sbjct  335  LMEIIKQKPSITEDHLDGKVLPEVNGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTMA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+S++ RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSMVERFYDPNEGQVLLDNVDIKILQLKWLRSQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMDEVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI ++ GAY  LI  Q+
Sbjct  575  QVVEIGTHEELI-SKAGAYASLIRFQE  600



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   382 bits (982),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMVFRDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1218  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1251


 Score =   321 bits (822),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGQCLEQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKKLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KSGAYASLIRFQE  603



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score =   382 bits (981),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D  +      + G IE R V+F+YPSRPD  +FKDFN+R+R 
Sbjct  982   EAVGSVFSILDRQTRIDPDDPDADPVETIRGEIEFRHVDFAYPSRPDVMVFKDFNLRIRA  1041

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1042  GQSQALVGASGSGKSSVIALIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1101

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATE+EVIEAA+ ANAH FIS LP+GY T VGERGVQLSGGQKQR+
Sbjct  1102  FAATIFDNIAYGKDGATEAEVIEAARAANAHGFISGLPDGYKTPVGERGVQLSGGQKQRI  1161

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1162  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1221

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1222  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQNHR  1255


 Score =   314 bits (805),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 208/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  342  LMEIINQRPSIIQDPLDGKCLDEVRGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  401

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  402  VVGGSGSGKSTVVSLIERFYDPNNGQILLDSVDIKTLQLKFLRDQIGLVNQEPALFATTI  461

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  462  LENILYGKPDATMAEVEAAASAANAHSFITLLPNGYNTQVGERGIQLSGGQKQRIAIARA  521

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRL TI+N D I V+Q G
Sbjct  522  MLKDPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLCTIRNVDSIAVIQQG  581

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  582  QVVETGTHEELIA-KAGAYASLIRFQE  607



>gb|KEH24996.1| ABC transporter B family protein [Medicago truncatula]
Length=1250

 Score =   382 bits (981),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  V G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  976   EAVGSVFSILDRSTRIDPDDPDAEMVESVRGEIELRHVDFAYPSRPDMMVFKDFSLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP+ GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPLVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA+SI++NI YGKEGATE+EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FASSIFDNIAYGKEGATEAEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHH  1249


 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 202/267 (76%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  336  LMEIIKQKPTIVEDLSDGKCLAEVNGNIEFKDVSFSYPSRPDVMIFQNFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATMDEVESATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q  
Sbjct  516  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQR  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             ++E GTH  L   + G Y  LI  Q+
Sbjct  576  VVVETGTHEELFA-KGGTYASLIRFQE  601



>ref|XP_002973102.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ25476.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1214

 Score =   381 bits (978),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/270 (70%), Positives = 223/270 (83%), Gaps = 2/270 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGE--ELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q V SV E++D +TEI  D GE  E+  V G +ELR V FSYP+RPD  IF+D ++RVR 
Sbjct  932   QAVGSVMELIDYQTEIDPDDGEAKEISHVRGDVELRRVCFSYPTRPDVTIFRDLSLRVRA  991

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             GKS+ALVG SGSGKSSVI LI RFYDP SG V++DGKD+  LKL+SLR+HIGLVQQEPAL
Sbjct  992   GKSLALVGPSGSGKSSVIGLISRFYDPSSGAVLVDGKDVSKLKLRSLRQHIGLVQQEPAL  1051

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F T+I+ENI YGK  ATESEV+EAAK ANAHSFIS+LP GY T  GERGVQLSGGQKQR+
Sbjct  1052  FDTTIFENIRYGKPEATESEVVEAAKAANAHSFISSLPNGYQTVAGERGVQLSGGQKQRI  1111

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAV+KNP ILLLDEATSALD +SE++VQQALDR+MK R+ +VVAHRLSTI+NA+ I 
Sbjct  1112  AIARAVIKNPAILLLDEATSALDAQSEKVVQQALDRVMKGRSCLVVAHRLSTIQNANVIA  1171

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINL  92
             +LQDG+IIEQG+HS L+    GAY KL++L
Sbjct  1172  LLQDGQIIEQGSHSELVRKIGGAYAKLVSL  1201


 Score =   309 bits (792),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 197/253 (78%), Gaps = 2/253 (1%)
 Frame = -2

Query  883  SVFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            ++ E+++RK  I   A  G++L  V G IE   V FSYPSRPD  IF+D ++ +  GK++
Sbjct  302  TILEMINRKPSINLQALEGKKLDNVHGNIEFDKVCFSYPSRPDVVIFQDLSLSIPAGKTV  361

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A+VG SGSGKS++ISLI RFYDP SG+V++DG  I+ L+LK LR  IGLV QEPALFATS
Sbjct  362  AVVGSSGSGKSTIISLIERFYDPQSGRVLLDGIPIQELQLKWLRGRIGLVSQEPALFATS  421

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENIL+GKE A++ E+  AA+ ++AH+F+  LP GY T+VGE+G+QLSGGQKQR+AIAR
Sbjct  422  IRENILFGKEDASDGEIEAAARTSDAHTFVKQLPSGYDTQVGEKGIQLSGGQKQRIAIAR  481

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A++K+P ILLLDEATSALD  SE  VQ+AL+RLM  RT+VVVAHRLSTI+NAD I V+  
Sbjct  482  AMVKDPAILLLDEATSALDASSESAVQEALERLMVGRTTVVVAHRLSTIRNADTIAVVHQ  541

Query  169  GKIIEQGTHSTLI  131
            GK++E GTH  L+
Sbjct  542  GKVVESGTHDELL  554



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   382 bits (980),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  980   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDIMVFRDFNLRIRA  1039

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1040  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1099

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESE+IEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1100  FAATIFDNIAYGKDGATESEIIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1159

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1160  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1219

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1220  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1253


 Score =   321 bits (823),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  340  LLEIINQRPTIIQDPLDGKCLEQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  399

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  400  VVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  459

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  460  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  519

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  520  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  579

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  580  QVVETGTHEELIA-KSGAYASLIRFQE  605



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   382 bits (980),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  981   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDIMVFRDFNLRIRA  1040

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1041  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1100

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESE+IEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1101  FAATIFDNIAYGKDGATESEIIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1160

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1161  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1220

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1221  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1254


 Score =   315 bits (808),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  341  LLEIINQRPTIIQDPLDGKCLEQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  401  VVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  AN+HSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  461  LENILYGKPDATMVEVEAAASAANSHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  521  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  581  QVVETGTHEELIA-KSGAYASLIRFQE  606



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score =   382 bits (980),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGE-ELIK-VEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D  E E+++ V G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  976   EAVGSVFSILDRQTRIDPDDPEAEVVESVRGEIELRHVDFAYPSRPDIMVFKDFSLRIRT  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI+LI RFYDP+ GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GHSQALVGASGSGKSSVIALIERFYDPLVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPRILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E G+HS L+   DGAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEHGSHSELVSRPDGAYSRLLQLQNHH  1249


 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L  V G IE ++V FSYPSRPD  IF++F++    GK++A
Sbjct  336  LMEIIKQKPTIVQDPLEGKCLSDVSGNIEFKEVTFSYPSRPDVIIFRNFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V+ID  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  +V  AA  ANAHSFI+ LP+GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATMEDVEVAASSANAHSFITLLPKGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+V+VAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVIVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELIA-KAGAYASLIRFQE  601



>gb|AAP72956.1| putative MDR-like P-glycoprotein [Lactuca sativa]
Length=1251

 Score =   381 bits (979),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + + SVF +LDR+T I  D  +  +   V G IELR V+FSYPSRPD P+FKDF++R+R 
Sbjct  977   EAIGSVFSILDRQTRIDPDDPDSDVVDTVRGEIELRHVDFSYPSRPDVPVFKDFSLRIRS  1036

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1037  GQSQALVGPSGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1096

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I ENI YGK GATE+EVI+AA  AN H+F+S LPEGY+T VGERGVQLSGGQKQR+
Sbjct  1097  FAATIMENIAYGKAGATEAEVIQAATAANVHTFVSGLPEGYNTPVGERGVQLSGGQKQRI  1156

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP ILLLDEATSALD ESE ++Q AL+RLM+ RT+V++AHRLSTI+  D I 
Sbjct  1157  AIARAVLKNPAILLLDEATSALDAESECVLQDALERLMRGRTTVLIAHRLSTIRGVDSIG  1216

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H  LI   +GAY +L+ LQQH+
Sbjct  1217  VVQDGRIVEQGSHGELISRPEGAYSRLLQLQQHR  1250


 Score =   333 bits (854),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IFK+F++    GK++A
Sbjct  337  LLEIIKQKPTIVQDSTDGKCLTEVNGNIEFKEVSFSYPSRPDVLIFKEFSIFFPAGKTVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G++++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVSLIERFYDPNQGQILLDDVDIKTLQLKWLRDQIGLVNQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT SEV  A   ANAHSFI+ LP  Y+T+VGERG+QLSGGQKQR+AIARA
Sbjct  457  LENILYGKPNATTSEVEAATSAANAHSFITLLPNSYNTQVGERGIQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VV+AHRLSTI+N D I V+Q G
Sbjct  517  MLKNPKILLLDEATSALDSASENIVQEALDRLMVGRTTVVIAHRLSTIRNVDSIAVIQQG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +IIE GTH  LI +R GAY  LI  Q+
Sbjct  577  QIIETGTHEELI-SRPGAYSSLIRFQE  602



>ref|XP_008379345.1| PREDICTED: ABC transporter B family member 19 [Malus domestica]
Length=1250

 Score =   381 bits (978),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 225/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGE-ELIK-VEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T+I  D  E E+++ V G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  976   EAVGSVFSILDRQTKIDPDDPEAEVVESVRGEIELRHVDFAYPSRPDVMVFKDFSLRIRT  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPXVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA+SI+ENI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FASSIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPRILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E G+HS L    DGAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEHGSHSELASRPDGAYTRLLQLQNHH  1249


 Score =   331 bits (848),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L  V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LMEIIKQKPTIVQDPLDGKCLSDVSGNIEFKEVTFSYPSRPDVIIFRDFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V+ID  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  +V  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATMEDVEVAASSANAHSFITLLPXGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELIA-KAGAYASLIRFQE  601



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   381 bits (979),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMVFRDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVI+AA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1218  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1251


 Score =   322 bits (826),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP SG++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KSGAYASLIRFQE  603



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score =   381 bits (978),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T+I  D  +      + G I+ R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  977   EAVGSVFSVLDRQTKIDPDDADADPVETIRGDIDFRHVDFAYPSRPDVMVFRDFNLRIRA  1036

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1037  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1096

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1097  FAATIFDNIAYGKDGATESEVIEAARSANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1156

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1157  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1216

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1217  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1250


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V+G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  337  LMEIINQRPTIIQDPLDGKCLDQVQGNIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR  IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVSLIERFYDPSNGQILLDGVEIKTLQLKFLRDQIGLVNQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  457  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  517  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  576

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  L+  + GAY  LI  Q+
Sbjct  577  QVVETGTHEELVA-KAGAYASLIRFQE  602



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score =   381 bits (978),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G I+ R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  981   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRHVDFAYPSRPDVMVFRDFNLRIRA  1040

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1041  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1100

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1101  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1160

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1161  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1220

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1221  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1254


 Score =   318 bits (816),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  341  LMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  400

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  401  VVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  460

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  461  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  520

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  521  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  580

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  581  QVVETGTHEELIA-KSGAYASLIRFQE  606



>gb|KDP45498.1| hypothetical protein JCGZ_09747 [Jatropha curcas]
Length=1253

 Score =   381 bits (978),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  V G IELR V+F+YPSRPD P+FKD N+R+R 
Sbjct  979   EAVGSVFSILDRSTRIDPDDPEAEPVESVRGEIELRHVDFAYPSRPDVPVFKDLNLRIRA  1038

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SG GKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1039  GQSQALVGASGCGKSSVIALIERFYDPSAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1098

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I +NI YGK+GATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1099  FAANILDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1158

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1159  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1218

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ LI   DGAY +L+ LQ H 
Sbjct  1219  VVQDGRIVEQGSHAELISRADGAYSRLLQLQHHH  1252


 Score =   330 bits (846),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  339  LMEVIKQKPTIVQDPSDGKCLPEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVA  398

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  399  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  458

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  459  LENILYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  518

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  519  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  578

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  579  QVVETGTHEELIA-KGGAYSSLIRFQE  604



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score =   381 bits (978),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G I+ R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  979   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRHVDFAYPSRPDVMVFRDFNLRIRA  1038

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP+ GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1039  GHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1098

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1099  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1158

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1159  AIARAVLKNPTVLLLDEATSALDAESECMLQEALERLMRGRTTVVVAHRLSTIRGVDSIG  1218

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1219  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1252


 Score =   313 bits (802),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 209/268 (78%), Gaps = 4/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGKCLDQVRGDIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPI-SGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            +VG SGSGKS+V+SLI RFYDP  +G++++DG +IK L+LK LR+ IGLV QEPALFAT+
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNAGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATT  457

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIAR
Sbjct  458  ILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYETQVGERGVQLSGGQKQRIAIAR  517

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q 
Sbjct  518  AMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQ  577

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            G+++E GTH  LI  + GAY  LI  Q+
Sbjct  578  GQVVETGTHEELIA-KAGAYASLIRFQE  604



>ref|XP_003543769.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
 gb|KHN13230.1| ABC transporter B family member 19 [Glycine soja]
Length=1249

 Score =   380 bits (977),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D  +      + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELRHVDFAYPSRPDVMVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI+GKVM+DGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELVSRPEGAYSRLLQLQHHH  1248


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + G Y  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGTYASLIRFQE  600



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score =   380 bits (977),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F DFN+R+R 
Sbjct  971   EAVGSVFSVLDRQTRIDPDDADADPAETIRGDIEFRHVDFAYPSRPDVMVFTDFNLRIRA  1030

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1031  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1090

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1091  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1150

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1151  AIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1210

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG HS L+   +GAY +L+ LQ H+
Sbjct  1211  VIQDGRIVEQGRHSELVSRPEGAYSRLLQLQTHR  1244


 Score =   314 bits (804),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 208/268 (78%), Gaps = 4/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  338  LMEIINQRPTIVQDPLDGKCLEQVHGNIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPI-SGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            +VG SGSGKS+V+SLI RFYDP  +GK+++DG +IK L+LK LR+ IGLV QEPALFAT+
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNAGKILLDGVEIKTLQLKFLREQIGLVNQEPALFATT  457

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIAR
Sbjct  458  ILENILYGKPNATLDEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIAR  517

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q 
Sbjct  518  AMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQ  577

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            G+++E GTH  LI  + G Y  LI  Q+
Sbjct  578  GQVVETGTHEELIA-KSGPYASLIRFQE  604



>ref|XP_002976764.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
 gb|EFJ22433.1| hypothetical protein SELMODRAFT_105467 [Selaginella moellendorffii]
Length=1290

 Score =   381 bits (978),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/270 (70%), Positives = 223/270 (83%), Gaps = 2/270 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGE--ELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q V SV E++D +TEI  D GE  E+  V G +ELR V FSYP+RPD  IF+D ++RVR 
Sbjct  1008  QAVGSVMELIDYQTEIDPDDGEAKEISHVRGDVELRRVCFSYPTRPDVTIFRDLSLRVRA  1067

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             GKS+ALVG SGSGKSSVI LI RFYDP SG V++DGKD+  LKL+SLR+HIGLVQQEPAL
Sbjct  1068  GKSLALVGPSGSGKSSVIGLISRFYDPSSGAVLVDGKDVSKLKLRSLRQHIGLVQQEPAL  1127

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F T+I+ENI YGK  ATESEV+EAAK ANAHSFIS+LP GY T  GERGVQLSGGQKQR+
Sbjct  1128  FDTTIFENIRYGKPEATESEVVEAAKAANAHSFISSLPNGYQTVAGERGVQLSGGQKQRI  1187

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAV+KNP ILLLDEATSALD +SE++VQQALDR+MK R+ +VVAHRLSTI+NA+ I 
Sbjct  1188  AIARAVIKNPAILLLDEATSALDAQSEKVVQQALDRVMKGRSCLVVAHRLSTIQNANVIA  1247

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINL  92
             +LQDG+IIEQG+HS L+    GAY KL++L
Sbjct  1248  LLQDGQIIEQGSHSELVRKIGGAYAKLVSL  1277


 Score =   309 bits (792),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 202/266 (76%), Gaps = 3/266 (1%)
 Frame = -2

Query  883  SVFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            ++ E+++RK  I   A  G++L  V G IE   V FSYPSRPD  IF+D ++ +  GK++
Sbjct  377  TILEMINRKPSINLQALEGKKLDNVHGNIEFDKVCFSYPSRPDVVIFQDLSLSIPAGKTV  436

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A+VG SGSGKS++ISLI RFYDP SG+V++DG  I+ L+LK LR  IGLV QEPALFATS
Sbjct  437  AVVGSSGSGKSTIISLIERFYDPQSGRVLLDGIPIQELQLKWLRGRIGLVSQEPALFATS  496

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENIL+GKE A++ E+  AA+ ++AH+F+  LP GY T+VGE+G+QLSGGQKQR+AIAR
Sbjct  497  IRENILFGKEDASDGEIEAAARTSDAHTFVKQLPSGYDTQVGEKGIQLSGGQKQRIAIAR  556

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A++K+P ILLLDEATSALD  SE  VQ+AL+RLM  RT+VVVAHRLSTI+NAD I V+  
Sbjct  557  AMVKDPAILLLDEATSALDASSESAVQEALERLMVGRTTVVVAHRLSTIRNADTIAVVHQ  616

Query  169  GKIIEQGTHSTLIENRDGAYYKLINL  92
            GK++E GTH  L+   +  Y  L+ L
Sbjct  617  GKVVESGTHDELLAKAE-FYAALVRL  641



>gb|EYU34087.1| hypothetical protein MIMGU_mgv1a000781mg [Erythranthe guttata]
Length=988

 Score =   375 bits (963),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/275 (67%), Positives = 223/275 (81%), Gaps = 3/275 (1%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
            + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  713  EAVGSVFSILDRPTRIDPDDTEAETVESIRGEIELRHVDFAYPSRPDVMVFKDFSLRIRA  772

Query  721  GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
            G S ALVG SGSGKSSVI+LI RFYDP+SGKVM+DGKDI+ L LKSLR+ IGLVQQEPAL
Sbjct  773  GHSQALVGASGSGKSSVIALIERFYDPLSGKVMVDGKDIRRLNLKSLRRRIGLVQQEPAL  832

Query  541  FATSIYENILYGKEGA-TESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQR  365
            FA SI+ENI YGK+GA TE+EVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR
Sbjct  833  FAASIFENIAYGKDGAATEAEVIEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQR  892

Query  364  VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
            +AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+    I
Sbjct  893  IAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVHSI  952

Query  184  CVLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ LI   + AY KL+ LQ H+
Sbjct  953  GVVQDGRIVEQGSHNELIGRPESAYSKLLQLQHHR  987


 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D    + L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  73   LMEIIKQKPTIVQDDLDSKCLTEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVA  132

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G++++D  DIK L+L+ LR  +GLV QEPALFAT+I
Sbjct  133  VVGGSGSGKSTVVSLIERFYDPNQGEILLDNVDIKTLQLRWLRSQMGLVNQEPALFATTI  192

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT SEV  A+  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  193  LENILYGKPDATMSEVEAASSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  252

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  253  MLKDPKILLLDEATSALDAGSESIVQEALDRLMIGRTTVVVAHRLSTIRNVDSIAVIQQG  312

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  +  AY  LI  Q+
Sbjct  313  QVVETGTHEELIA-KAAAYANLIRFQE  338



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score =   380 bits (976),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F DFN+R+R 
Sbjct  979   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMLFTDFNLRIRA  1038

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1039  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1098

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1099  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1158

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1159  AIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1218

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG HS L+   +GAY +L+ LQ H+
Sbjct  1219  VIQDGRIVEQGRHSELVSRPEGAYSRLLQLQTHR  1252


 Score =   313 bits (803),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 208/268 (78%), Gaps = 4/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  338  LMEIINQRPTIVQDPLDGKCLEQVHGNIEFKDVTFSYPSRPDVIIFRNFSIVFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPI-SGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            +VG SGSGKS+V+SLI RFYDP  +GK+++DG +IK L+LK LR+ IGLV QEPALFAT+
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNAGKILLDGVEIKTLQLKFLREQIGLVNQEPALFATT  457

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIAR
Sbjct  458  ILENILYGKPNATLDEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIAR  517

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q 
Sbjct  518  AMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQ  577

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            G+++E GTH  LI  + G Y  LI  Q+
Sbjct  578  GQVVETGTHEELIA-KSGPYASLIRFQE  604



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G I+ R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  963   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRHVDFAYPSRPDVMVFRDFNLRIRA  1022

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP+ GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1023  GHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1082

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEV+EAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1083  FAATIFDNIAYGKDGATESEVMEAARSANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1142

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1143  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDSIG  1202

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1203  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1236


 Score =   313 bits (802),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 209/268 (78%), Gaps = 4/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGKCLDQVRGDIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPI-SGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            +VG SGSGKS+V+SLI RFYDP  +G++++DG +IK L+LK LR+ IGLV QEPALFAT+
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNAGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATT  457

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIAR
Sbjct  458  ILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIAR  517

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q 
Sbjct  518  AMLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQ  577

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            G+++E GTH  LI  + GAY  LI  Q+
Sbjct  578  GQVVETGTHEELIA-KAGAYASLIRFQE  604



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  980   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDIMVFRDFNLRIRA  1039

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1040  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1099

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESE+IEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1100  FAATIFDNIAYGKDGATESEIIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1159

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1160  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1219

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+Q+G+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1220  VIQEGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1253


 Score =   315 bits (808),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  340  LLEIINQRPTIIQDPLDGKCLEQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  399

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  400  VVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  459

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  AN+HSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  460  LENILYGKPDATMVEVEAAASAANSHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  519

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  520  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  579

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  580  QVVETGTHEELIA-KSGAYASLIRFQE  605



>ref|XP_008784383.1| PREDICTED: ABC transporter B family member 19 [Phoenix dactylifera]
Length=1253

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/272 (67%), Positives = 218/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  + G IELR V+F+YPSRPD PIFKDFN+R+R G+
Sbjct  981   IRSIFSILNRGTRIDPDDPEAEPIDSIRGEIELRHVDFAYPSRPDVPIFKDFNLRIRSGQ  1040

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI LI RFYDP +GKVM+DGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1041  SQALVGASGSGKSTVIGLIERFYDPTAGKVMVDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1100

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI+ENI YGK+ ATE EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1101  ASIFENIAYGKDRATEEEVIEAARAANVHGFVSVLPEGYKTAVGERGVQLSGGQKQRIAI  1160

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1161  ARAVLKNPAVLLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIAVV  1220

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+EQG+H+ L+   DGAY +L+ LQ H 
Sbjct  1221  QDGRIVEQGSHTELVTRADGAYSRLLQLQHHH  1252


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ ++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK+ A
Sbjct  337  LMEIIRQRPSIIQDPSDGKCLPEVHGNIEFKDVTFSYPSRPDVIIFRDFSLFFPAGKTAA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFIS LP GY+T+ GERGVQLSGGQKQR+AIARA
Sbjct  457  LENILYGKPDATIAEVEAAASAANAHSFISLLPNGYNTQAGERGVQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD+ SE IVQ+ALDRLM  RT+VVVAHRLSTIKN D I V+Q G
Sbjct  517  MLKNPKILLLDEATSALDLGSESIVQEALDRLMVGRTTVVVAHRLSTIKNVDMIAVMQQG  576

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  577  QVVETGTHEELLAKGSSGAYASLIRFQE  604



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G I+ R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRHVDFAYPSRPDVMVFRDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP+ GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEV+EAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVMEAARSANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDSIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1218  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1251


 Score =   317 bits (813),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGKCLDQVRGDIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KAGAYASLIRFQE  603



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score =   379 bits (974),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V+SVF +LDR T+I  D    E +  V G IELR V+F+YP+RP+  +FKD N+R+R 
Sbjct  975   EAVSSVFSILDRTTKIDPDEPDAETVESVRGEIELRHVDFAYPTRPEVMVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI LI RFYDP +GKV+IDGKDI+ L +KSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIVLIERFYDPSAGKVLIDGKDIRRLNMKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGK+GATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIQGVDNIA  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   DGAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELVSRADGAYSRLLQLQHHH  1248


 Score =   316 bits (810),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  335  LMEIIRQKPSIIQDPSDGKCLTEVNGNIEFKDVTFSYPSRPDVIIFRDFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DI+ L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIRTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  A+ +EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDASIAEVEAAAAAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + G+Y  LI  Q+
Sbjct  575  QVVETGTHDELIA-KAGSYASLIRFQE  600



>gb|AFW59635.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=737

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + S+F +L+R T I  D    E +  + G IELR V+FSYP+RPD  IFKDFN++++ G+
Sbjct  465  IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFSYPARPDIQIFKDFNLKIQAGR  524

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SGSGKS++I+LI RFYDP  GKV IDGKDI+ L LKSLR+ IGLVQQEP LFA
Sbjct  525  SQALVGASGSGKSTIIALIERFYDPCGGKVAIDGKDIRTLNLKSLRRKIGLVQQEPVLFA  584

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            +SI ENI YGKEGA+E EV+EAAK AN H F+S LP+GY T VGERG+QLSGGQKQR+AI
Sbjct  585  SSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPDGYRTAVGERGMQLSGGQKQRIAI  644

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  645  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  704

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            QDG+++E G+HS L+   +GAY +L+ LQ H+
Sbjct  705  QDGRVVEHGSHSDLLARPEGAYSRLLQLQHHR  736


 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -2

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  1    MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  60

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  61   QVVETGTHDELLAKGTSGAYASLIRFQE  88



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score =   379 bits (973),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G I+ R V+F+YPSRPD  +F DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIKFRHVDFAYPSRPDVMVFTDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVIEAA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG HS L+   +GAY +L+ LQ H+
Sbjct  1218  VIQDGRIVEQGRHSELVSRPEGAYSRLLQLQTHR  1251


 Score =   319 bits (818),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 210/267 (79%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V+G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  338  LMEIINQRPTIVQDPLDGKCLEQVQGNIEFKDVTFSYPSRPDVIIFRNFSIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNNGEILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPNATIDEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KSGAYASLIRFQE  603



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score =   379 bits (973),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  976   EAVGSVFSILDRPTRIDPDEPEAEPVESIRGEIELRHVDFAYPSRPDVMVFKDFSLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI LI RFYDPI+GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIVLIERFYDPIAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGK+GATE+EVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASIFDNIAYGKDGATEAEVIEAARAANVHTFVSGLPEGYKTTVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V++AHRLSTI+  + I 
Sbjct  1156  AIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLIAHRLSTIRGVNSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H  LI   +GAY +L+ LQ H+
Sbjct  1216  VVQDGRIVEQGSHGELISRPEGAYSRLLQLQHHR  1249


 Score =   316 bits (809),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/268 (62%), Positives = 205/268 (76%), Gaps = 4/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEE---LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            + E++ +K  I+ D   +   L  V G IE ++V FSYPSRPD  IF+DF++    GK++
Sbjct  335  LMEIIKQKPTIVQDASSDAKCLADVHGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTV  394

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A+VG SGSGKS+V+SLI RFYDP  G++++D  DIK L+L+ LR  IGLV QEPALFAT+
Sbjct  395  AVVGGSGSGKSTVVSLIERFYDPNQGEILLDNVDIKTLQLRWLRNQIGLVNQEPALFATT  454

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIAR
Sbjct  455  ILENILYGKPDATMAEVEAAASAANAHSFITLLPIGYNTQVGERGVQLSGGQKQRIAIAR  514

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q 
Sbjct  515  AMLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDCIAVIQQ  574

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            G+++E GTH  LI  + GAY  LI  Q+
Sbjct  575  GQVVETGTHEELIA-KAGAYASLIRFQE  601



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score =   379 bits (972),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IE R V+FSYP+RPD  +F+DFN+R+R 
Sbjct  976   EAVGSVFSILDRCTRIDPDDSEAEPVESIRGDIEFRHVDFSYPTRPDVLVFQDFNLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPSAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA+SI++NI+YGKEGATE+EVIEAA+ AN H F+SALPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FASSIFDNIVYGKEGATEAEVIEAARAANVHGFVSALPEGYKTTVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+    I 
Sbjct  1156  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVSSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L  LQ H 
Sbjct  1216  VVQDGRIVEQGSHSELISRPEGAYSRLSQLQLHH  1249


 Score =   313 bits (801),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L ++ G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LMEIIKQKPTIVQDLCDGKCLEEISGNIEFKNVSFSYPSRPDVMIFRDFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DI+ L+L  LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNDGQVLLDNNDIRTLQLTWLRGQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKSDATMAEVEAAASSANAHSFIALLPNGYNTHVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELI-TKAGAYASLIRFQE  601



>ref|XP_010552958.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Tarenaya hassleriana]
Length=1099

 Score =   376 bits (966),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D    + +  + G IE R V+F+YPSRPD  +FKDFN+R+R 
Sbjct  825   EAVGSVFSILDRQTRIEPDDPYADPVETIRGEIEFRHVDFAYPSRPDVMVFKDFNLRIRA  884

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVISLI RFYDP++GKVMIDGKDI+ + L+SLR  IGLVQQEPAL
Sbjct  885   GQSQALVGASGSGKSSVISLIERFYDPVAGKVMIDGKDIRRINLRSLRLKIGLVQQEPAL  944

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I+ NI YGK+ ATE+EVIEAA+ ANAH FIS LP+GY T VGERGVQLSGGQKQR+
Sbjct  945   FAATIFHNIAYGKDSATEAEVIEAARAANAHGFISGLPDGYKTPVGERGVQLSGGQKQRI  1004

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+A++RLM+ RT+VVVAHRLSTI+   +I 
Sbjct  1005  AIARAVLKNPTVLLLDEATSALDAESECVLQEAIERLMRGRTTVVVAHRLSTIRGVHRIG  1064

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +G Y +L+ LQ H+
Sbjct  1065  VIQDGRIVEQGSHSELITRPEGEYSRLLQLQNHR  1098


 Score =   318 bits (815),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 208/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  185  LMEIINQRPSIIQDPFGGKCLDEVHGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  244

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++ +DG DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  245  VVGGSGSGKSTVVSLIERFYDPNNGQIFLDGVDIKILQLKFLRDQIGLVNQEPALFATTI  304

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            +ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  305  FENILYGKPDATMVEVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  364

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRL TI+N D I V+Q G
Sbjct  365  MLKDPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLCTIRNVDSISVIQQG  424

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E G+H  LI  + GAY  LI  Q+
Sbjct  425  QVVETGSHEKLIA-KAGAYASLIRFQE  450



>emb|CDP02220.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =   379 bits (972),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 186/275 (68%), Positives = 220/275 (80%), Gaps = 2/275 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  976   EAVGSVFMILDRSTRIDPDDPDAEPVESIRGEIELRHVDFAYPSRPDVNVFKDLNLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDIK L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPTFGKVMIDGKDIKRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGK+GATESEVIEAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASIFDNIAYGKDGATESEVIEAARAANMHAFVSGLPEGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             V+QDG+I+EQG+H  LI   DGAY +L+ LQ +  
Sbjct  1216  VVQDGRIVEQGSHGELISRPDGAYSRLLQLQHNHN  1250


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  IL D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LMEIMKQKPTILQDPSDGKCLAEVNGNIEFKNVTFSYPSRPDVMIFRDFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G++++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQILLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSF++ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  456  LENILYGKPEATMAEVEAAATAANAHSFVTLLPNGYNTQVGERGIQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  L+  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELVA-KAGAYASLIRFQE  601



>ref|XP_001751653.1| ATP-binding cassette transporter, subfamily B, member 15, group 
MDR/PGP protein PpABCB15 [Physcomitrella patens]
 gb|EDQ83970.1| ATP-binding cassette transporter, subfamily B, member 15, group 
MDR/PGP protein PpABCB15 [Physcomitrella patens]
Length=1264

 Score =   378 bits (971),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 230/275 (84%), Gaps = 2/275 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q + S+F +LDR+TEI  +    E++++V G I L+ V F+YPSR DT IFKDF+++V  
Sbjct  990   QALKSIFCILDRETEIDPENSTAEDVLEVRGDISLKHVHFTYPSRSDTIIFKDFSLKVHA  1049

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S+ALVG SGSGKSSVI+LI RFYDP SGKV IDG DIK L+L+SLR+HI LVQQEPAL
Sbjct  1050  GRSLALVGASGSGKSSVIALIARFYDPTSGKVKIDGHDIKKLRLRSLRRHIALVQQEPAL  1109

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FAT+I+ENILYG++GA+++E++EAA+ ANAH+FI  LPEGY+T+VGERGVQLSGGQKQRV
Sbjct  1110  FATTIHENILYGRDGASDAEIVEAAQAANAHNFICCLPEGYNTEVGERGVQLSGGQKQRV  1169

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD  SE IVQ+ALD+LM  RT+V++AHRLST++NAD I 
Sbjct  1170  AIARAVLKDPAILLLDEATSALDSHSEGIVQEALDKLMHGRTTVLIAHRLSTVRNADTIA  1229

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             V++DG+I+E+GTH  L+   DGAY  LINL + ++
Sbjct  1230  VVRDGQIVEKGTHKQLMARTDGAYTNLINLVKSRE  1264


 Score =   339 bits (870),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/272 (63%), Positives = 213/272 (78%), Gaps = 8/272 (3%)
 Frame = -2

Query  883  SVFEVLDRKTEILADV-----GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPG  719
            +V +V++RK   L D      G+ L ++ G IELRD+ FSYPSRP+  IF  FN+ +  G
Sbjct  352  NVMQVIERKR--LRDCRRSTDGKILPQLAGHIELRDISFSYPSRPNVKIFDKFNITIPAG  409

Query  718  KSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALF  539
             ++A+VG SGSGKS++ISLI RFYDP +G+V++DG DIK L+L  LR  IGLV QEP LF
Sbjct  410  TTVAIVGNSGSGKSTIISLIERFYDPTAGEVLVDGHDIKTLRLSWLRGKIGLVNQEPVLF  469

Query  538  ATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVA  359
            ATSI ENILYGKEGA+ +EV   AK +NAHSFI  LP+ Y T+VGERGVQLSGGQKQRVA
Sbjct  470  ATSILENILYGKEGASAAEVTAMAKASNAHSFIDKLPQRYDTQVGERGVQLSGGQKQRVA  529

Query  358  IARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICV  179
            IARA+LKNP ILLLDEATSALD  SE++VQ+ALDRLM  RT+VV+AHRLSTI+NA+ I V
Sbjct  530  IARAMLKNPTILLLDEATSALDAGSEQLVQEALDRLMIGRTTVVIAHRLSTIRNANAIFV  589

Query  178  LQDGKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +Q+G+++E GTH+ L+ E  +GAY KL+ LQQ
Sbjct  590  VQNGRVVESGTHNELLGEGNEGAYAKLVRLQQ  621



>ref|XP_010032346.1| PREDICTED: ABC transporter B family member 19 [Eucalyptus grandis]
 gb|KCW51754.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1249

 Score =   378 bits (970),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D    E++  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  975   EAVGSVFSILDRQTRIDPDDPEAEQVGSLRGEIELRHVDFAYPSRPDVVVFKDLNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI+LI RFYDPI+GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GHSQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I +NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAANILDNIAYGKEGATEAEVIEAARTANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKDPAILLLDEATSALDPESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ L+   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHAELVSRPEGAYSRLLQLQLHH  1248


 Score =   315 bits (806),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I  D   G+ L ++ G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEVIRQKPSIGHDPSNGKTLPEINGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  D+K L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDLKALQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENI+YGK  AT +EV  AA  ANAHSFI+ LP+GYST+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENIIYGKPDATMAEVEAAATAANAHSFITLLPKGYSTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP++LLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKVLLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             ++E GTH  LI  + GAY  LI  Q+
Sbjct  575  LVVETGTHEELIA-KAGAYASLIRFQE  600



>gb|KCW51753.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1250

 Score =   378 bits (970),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D    E++  + G IELR V+F+YPSRPD  +FKD N+R+R 
Sbjct  976   EAVGSVFSILDRQTRIDPDDPEAEQVGSLRGEIELRHVDFAYPSRPDVVVFKDLNLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI+LI RFYDPI+GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GHSQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I +NI YGKEGATE+EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FAANILDNIAYGKEGATEAEVIEAARTANVHGFVSALPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPAILLLDEATSALDPESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ L+   +GAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEQGSHAELVSRPEGAYSRLLQLQLHH  1249


 Score =   310 bits (794),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 206/268 (77%), Gaps = 4/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I  D   G+ L ++ G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEVIRQKPSIGHDPSNGKTLPEINGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  D+K L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDLKALQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYST-KVGERGVQLSGGQKQRVAIAR  350
             ENI+YGK  AT +EV  AA  ANAHSFI+ LP+GYST +VGERGVQLSGGQKQR+AIAR
Sbjct  455  LENIIYGKPDATMAEVEAAATAANAHSFITLLPKGYSTQQVGERGVQLSGGQKQRIAIAR  514

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            A+LKNP++LLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q 
Sbjct  515  AMLKNPKVLLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQ  574

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            G ++E GTH  LI  + GAY  LI  Q+
Sbjct  575  GLVVETGTHEELIA-KAGAYASLIRFQE  601



>gb|AFW58472.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=822

 Score =   369 bits (947),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + SVF VL+ +T I  D    E++  V G I+ R V+F+YP+RPD  +FKD ++R+R G+
Sbjct  550  IRSVFSVLNSRTRIDPDDPDAEQVESVRGEIDFRHVDFAYPTRPDVMVFKDLSLRIRAGQ  609

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SGSGKS+VI+L+ RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  610  SQALVGASGSGKSTVIALVERFYDPLAGKVMIDGKDIRRLNLKSLRLRIGLVQQEPVLFA  669

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            TSI ENI YG++GATE EV+EAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  670  TSILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  729

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  730  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  789

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  790  QDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  821


 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -2

Query  415  TKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRT  236
            T+VG+RG+QLSGGQKQR+AIARA+LKNP++LLLDEATSALD  SE IVQ+ALDRLM  RT
Sbjct  65   TQVGDRGLQLSGGQKQRIAIARAMLKNPKLLLLDEATSALDAGSESIVQEALDRLMVGRT  124

Query  235  SVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +VVVAHRLSTI+  D I V+Q G+++E GTH  L+ +   GAY  LI  Q+
Sbjct  125  TVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQE  175



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score =   377 bits (969),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/274 (66%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T+I  D    E +  + G IELR V+F+YPSRPD  +FKD ++R+R 
Sbjct  975   EAVGSVFSILDRQTKIDPDDPDAEPVESIRGEIELRHVDFAYPSRPDVMVFKDLSLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP+ GKVMIDGKDI+ L LKSLR  +GLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPVVGKVMIDGKDIRRLNLKSLRLKMGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI++NI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFDNIAYGKEGATETEVIEAARAANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDTIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHSELVSRPEGAYSRLLQLQHHH  1248


 Score =   332 bits (852),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEE--LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I  D  +   L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  335  LMEIINQKPSITQDASDAKCLAEVNGNIEFKDVTFSYPSRPDVFIFRNFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KPGAYASLIRFQE  600



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   377 bits (969),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMVFRDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVI+AA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QD +I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1218  VIQDERIVEQGSHSELVSRPEGAYSRLLQLQTHR  1251


 Score =   322 bits (826),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP SG++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KSGAYASLIRFQE  603



>ref|XP_009395922.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1256

 Score =   377 bits (969),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/272 (67%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+R T +  D    E +  V G IELR V+F+YPSRPD PIFKDFN+R+R G+
Sbjct  984   IRSVFAILNRGTRVEPDDPEAEHVDSVRGEIELRHVDFAYPSRPDVPIFKDFNLRIRAGQ  1043

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP +GKV+IDGKDIK L LKSLR  IGLVQQEP LFA
Sbjct  1044  SHALVGASGSGKSTVIALIERFYDPTAGKVLIDGKDIKRLNLKSLRLKIGLVQQEPVLFA  1103

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YGK+GATE EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1104  ASIMENIAYGKDGATEEEVIEAARAANVHGFVSALPDGYKTAVGERGVQLSGGQKQRIAI  1163

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D I V+
Sbjct  1164  ARAVLKDPAVLLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDSIGVV  1223

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             Q+G+I+EQG+HS L+   DGAY +L+ LQ + 
Sbjct  1224  QEGRIVEQGSHSELVARPDGAYSRLLQLQHYH  1255


 Score =   317 bits (812),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  340  LLEIIRQKPSIIQDQSDGKCLEEVHGNIEFKDVTFSYPSRPDVIIFRDFSLFFPAGKTVA  399

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G V++D  DIK L+LK LR+ IGLV QEPALFAT+I
Sbjct  400  VVGGSGSGKSTVVALIERFYDPNQGLVLLDNVDIKTLQLKWLREQIGLVNQEPALFATTI  459

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFIS LP  Y+T+VGERGVQLSGGQKQR+AIARA
Sbjct  460  LENILYGKPDATIGEVEAAASAANAHSFISQLPSAYNTQVGERGVQLSGGQKQRIAIARA  519

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  520  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDMIAVIQQG  579

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E G H  L+ +   GAY  LI  Q+
Sbjct  580  QVVETGAHEDLLAKGSSGAYASLIRFQE  607



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   377 bits (968),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF VLDR+T I  D  +      + G IE R V+F+YPSRPD  +F+DFN+R+R 
Sbjct  978   EAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAYPSRPDVMVFRDFNLRIRA  1037

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI++I RFYD ++GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1038  GHSQALVGASGSGKSSVIAMIERFYDLLAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1097

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I++NI YGK+GATESEVI+AA+ ANAH FIS LPEGY T VGERGVQLSGGQKQR+
Sbjct  1098  FAATIFDNIAYGKDGATESEVIDAARAANAHGFISGLPEGYKTPVGERGVQLSGGQKQRI  1157

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI+  D I 
Sbjct  1158  AIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRGVDCIG  1217

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS L+   +GAY +L+ LQ H+
Sbjct  1218  VIQDGRIVEQGSHSELVSRPEGAYSRLLQLQTHR  1251


 Score =   323 bits (827),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++FN+    GK++A
Sbjct  338  LMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPSGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP SG++++DG +IK L+LK LR+ IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKFLREQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANAHSFI+ LP+GY T+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRL TI+N D I V+Q G
Sbjct  518  MLKDPKILLLDEATSALDASSESIVQEALDRVMVGRTTVVVAHRLCTIRNVDSIAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KSGAYASLIRFQE  603



>ref|XP_003579371.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1266

 Score =   377 bits (967),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/273 (67%), Positives = 220/273 (81%), Gaps = 2/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  V G IELR V+FSYPSRPD  IFKDFN++++ G+
Sbjct  994   IRSIFGILNRATRIEPDDPESERVTTVRGDIELRHVDFSYPSRPDIEIFKDFNLKIQAGR  1053

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1054  SQALVGASGSGKSTVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1113

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +SI ENI YGKEGATE EVIEAAK AN H+F+S LP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1114  SSILENIAYGKEGATEEEVIEAAKTANVHTFVSQLPDGYKTAVGERGVQLSGGQKQRIAI  1173

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1174  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1233

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDG+I+E G HS L+   +GAY +L+ LQQH+ 
Sbjct  1234  QDGRIVEHGGHSELVARPEGAYSRLLQLQQHRN  1266


 Score =   328 bits (840),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  350  LLEVIRQKPSIVNDHKDGKLLAEVHGNIEFKDVIFSYPSRPDVMIFRDFSLFFPAGKTVA  409

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  410  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  469

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  470  LENILYGKPDATIAEVEAAATASNAHSFISLLPNGYNTMVGERGIQLSGGQKQRIAIARA  529

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  530  MLKDPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  589

Query  166  KIIEQGTHSTL-IENRDGAYYKLINLQQ  86
            +++E GTH  L ++   GAY  LI  Q+
Sbjct  590  QVVETGTHDELVVKGSSGAYASLIRFQE  617



>dbj|BAG96130.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score =   372 bits (954),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + SVF +L+ +T I  D    E +  V G I+ R V+F+YPSRPD  +FKDF++R+R G+
Sbjct  717  IRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSRPDVMVFKDFSLRIRAGQ  776

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L ++SLR  IGLVQQEP LFA
Sbjct  777  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVRSLRLKIGLVQQEPVLFA  836

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            TSI+ENI YGK+GATE EVIEAAK+AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  837  TSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  896

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  897  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  956

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  957  QDGRVVEQGSHGELVSRPDGAYSRLLQLQLHH  988


 Score =   324 bits (830),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  73   LLEVIRQRPTIVQDPADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  132

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  133  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  192

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  193  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  252

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  253  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  312

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  313  QVVETGTHDELLAKGSSGAYAALIRFQE  340



>ref|XP_010552950.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Tarenaya hassleriana]
Length=1254

 Score =   376 bits (966),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 222/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D    + +  + G IE R V+F+YPSRPD  +FKDFN+R+R 
Sbjct  980   EAVGSVFSILDRQTRIEPDDPYADPVETIRGEIEFRHVDFAYPSRPDVMVFKDFNLRIRA  1039

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVISLI RFYDP++GKVMIDGKDI+ + L+SLR  IGLVQQEPAL
Sbjct  1040  GQSQALVGASGSGKSSVISLIERFYDPVAGKVMIDGKDIRRINLRSLRLKIGLVQQEPAL  1099

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA +I+ NI YGK+ ATE+EVIEAA+ ANAH FIS LP+GY T VGERGVQLSGGQKQR+
Sbjct  1100  FAATIFHNIAYGKDSATEAEVIEAARAANAHGFISGLPDGYKTPVGERGVQLSGGQKQRI  1159

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE ++Q+A++RLM+ RT+VVVAHRLSTI+   +I 
Sbjct  1160  AIARAVLKNPTVLLLDEATSALDAESECVLQEAIERLMRGRTTVVVAHRLSTIRGVHRIG  1219

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +G Y +L+ LQ H+
Sbjct  1220  VIQDGRIVEQGSHSELITRPEGEYSRLLQLQNHR  1253


 Score =   318 bits (816),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 208/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E+++++  I+ D   G+ L +V G IE +DV FSYPSRPD  IF++F++    GK++A
Sbjct  340  LMEIINQRPSIIQDPFGGKCLDEVHGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVA  399

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G++ +DG DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  400  VVGGSGSGKSTVVSLIERFYDPNNGQIFLDGVDIKILQLKFLRDQIGLVNQEPALFATTI  459

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            +ENILYGK  AT  EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  460  FENILYGKPDATMVEVEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  519

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRL TI+N D I V+Q G
Sbjct  520  MLKDPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLCTIRNVDSISVIQQG  579

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E G+H  LI  + GAY  LI  Q+
Sbjct  580  QVVETGSHEKLIA-KAGAYASLIRFQE  605



>ref|XP_008459308.1| PREDICTED: ABC transporter B family member 19 [Cucumis melo]
Length=1250

 Score =   375 bits (964),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 224/273 (82%), Gaps = 3/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R G+
Sbjct  978   IGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVDFAYPSRPDVMVFKDLNLRIRAGQ  1037

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDP++GKVMIDGKDI+ L L+SLR  IGLVQQEPALFA
Sbjct  1038  SQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDIRRLNLQSLRLKIGLVQQEPALFA  1097

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI++NI YGK+GATESEVIEAA+ AN H F+S LP+GY+T VGERGVQLSGGQKQR+AI
Sbjct  1098  ASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPDGYNTPVGERGVQLSGGQKQRIAI  1157

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI++ D I V+
Sbjct  1158  ARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRSVDSIGVV  1217

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDG+I+EQG+H+ L+   +GAY +L+ L QHQ 
Sbjct  1218  QDGRIVEQGSHNELLSRAEGAYSRLLQL-QHQH  1249


 Score =   320 bits (820),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LMEIIKQKPTIIQDPLDGKCLGEVNGNIEFKDVSFSYPSRPDVMIFRDFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            YENILYGK  AT +EV  AA  ANAHSFI+ LP GY T+VGERG+QLSGGQKQR+AIARA
Sbjct  456  YENILYGKPDATTAEVEAAAAAANAHSFITLLPNGYDTQVGERGLQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHDELI-TKSGAYSSLIRFQE  601



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score =   375 bits (964),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/272 (68%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF VL+ +T I  D   GE + KV G IELR V+F+YPSRPD  +FK+F++R+R G+
Sbjct  994   VRSVFAVLNSRTRIDPDEPEGEPVEKVRGEIELRHVDFAYPSRPDVMVFKEFSLRIRAGQ  1053

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1054  SQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1113

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI ENI YGK+G TE EV+EAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1114  TSILENIGYGKDGVTEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  1173

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE +VQ+AL R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1174  ARAVLKDPAILLLDEATSALDAESECVVQEALGRIMKGRTTVLVAHRLSTIRCVDSIAVV  1233

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1234  QDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  1265


 Score =   310 bits (795),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  +F+DF++    GK+ A
Sbjct  350  LLEVIRQRPTIVQDSTDGRCLDEVHGNIEFKEVSFSYPSRPDVMVFRDFSLFFPAGKTAA  409

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK+L+LK LR  IGLV QEPALFAT+I
Sbjct  410  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNADIKSLQLKWLRDQIGLVNQEPALFATTI  469

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             +NILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  470  IDNILYGKPDATMAEVEAAASAANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  529

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRLSTI++ D I V+Q G
Sbjct  530  MLKNPKILLLDEATSALDAGSESIVQEALDRIMIGRTTVVVAHRLSTIRSVDMIAVIQQG  589

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  590  QVVETGTHDELLAKGSSGAYAALIRFQE  617



>ref|XP_004148691.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1250

 Score =   375 bits (963),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 224/273 (82%), Gaps = 3/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R G+
Sbjct  978   IGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVDFAYPSRPDVMVFKDLNLRIRAGQ  1037

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDP++GKVMIDGKDI+ L L+SLR  IGLVQQEPALFA
Sbjct  1038  SQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDIRRLNLQSLRLKIGLVQQEPALFA  1097

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI++NI YGK+GATESEVIEAA+ AN H F+S LP+GY+T VGERGVQLSGGQKQR+AI
Sbjct  1098  ASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPDGYNTPVGERGVQLSGGQKQRIAI  1157

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI++ D I V+
Sbjct  1158  ARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRSVDSIGVV  1217

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDG+I+EQG+H+ L+   +GAY +L+ L QHQ 
Sbjct  1218  QDGRIVEQGSHNELLSRAEGAYSRLLQL-QHQH  1249


 Score =   320 bits (819),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LMEIIKQKPTIIQDPLDGKCLGEVNGNIEFKDVTFSYPSRPDVMIFRDFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            YENILYGK  AT +EV  AA  ANAHSFI+ LP GY T+VGERG+QLSGGQKQR+AIARA
Sbjct  456  YENILYGKPDATTAEVEAAAAAANAHSFITLLPNGYDTQVGERGLQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHDELI-TKSGAYSSLIRFQE  601



>ref|XP_002283051.2| PREDICTED: ABC transporter B family member 19 [Vitis vinifera]
Length=1250

 Score =   375 bits (963),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 220/274 (80%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T+I  D    E +  + G IELR V+FSYPSR D  +FKD N+R+R 
Sbjct  976   EAVGSVFSILDRSTKIDPDDSDAEPVESIRGEIELRHVDFSYPSRSDITVFKDLNLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKD++ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDVRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI +NI YGK+GATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASILDNIAYGKDGATEAEVIEAARAANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHH  1249


 Score =   313 bits (802),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LMEIIRQKPSIVQDPSDGKCLAEVNGNIEFKDVTFSYPSRPDVIIFRDFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG QLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATAAEVEAAASAANAHSFITLLPNGYNTQVGERGTQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  L   + GAY  LI  Q+
Sbjct  576  QVVETGTHEEL-SAKAGAYASLIRFQE  601



>gb|EPS61919.1| hypothetical protein M569_12874 [Genlisea aurea]
Length=1149

 Score =   373 bits (958),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 216/262 (82%), Gaps = 2/262 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             +ASVF +LDR TEI  D    E +  V G IELR V+F+YPSRPD  +FKD N+R+R G+
Sbjct  872   IASVFTILDRGTEIDPDDPEAEAVESVRGEIELRHVDFAYPSRPDVLVFKDLNLRIRAGQ  931

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDPI+GKVMIDGKDI+ L LKSLR+ IG VQQEPALFA
Sbjct  932   SQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRKLNLKSLRRKIGFVQQEPALFA  991

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              +I++NI YG +GATESEVIEAA+ AN H+F+S+LPEGY T VGERG+QLSGGQKQR+AI
Sbjct  992   ATIFDNIAYGNDGATESEVIEAARSANVHAFVSSLPEGYKTPVGERGIQLSGGQKQRIAI  1051

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1052  ARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDSIGVV  1111

Query  175   QDGKIIEQGTHSTLIENRDGAY  110
             QDG+I EQG+H  L+   DGAY
Sbjct  1112  QDGRIAEQGSHGELVGKADGAY  1133


 Score =   305 bits (781),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 200/267 (75%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D    + L +V+G IE R+V F YPSRPD  +F+DF++    G+++A
Sbjct  230  LMEIINQKPTIVDDPSGAKVLSEVKGNIEFRNVTFGYPSRPDVLVFRDFSITFPAGRTVA  289

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G++++D  +IK L+L+ LR  IGLV QEPALFAT+I
Sbjct  290  VVGGSGSGKSTVVSLIERFYDPNQGEILLDDVNIKTLQLRWLRNQIGLVNQEPALFATTI  349

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  EV  AA  ANA SFI  LP G+ T+VGERGVQLSGGQKQR+AIARA
Sbjct  350  LENILYGKPDATMEEVEAAATAANALSFIGVLPHGFDTQVGERGVQLSGGQKQRIAIARA  409

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            VLKNP +LLLDEATSALD  SE++VQ+ALD LM  RT+VVVAHRLSTI + D + V+Q G
Sbjct  410  VLKNPRVLLLDEATSALDAGSEKLVQEALDSLMIGRTTVVVAHRLSTITSVDSVAVIQQG  469

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  L+    GAY  LI  Q+
Sbjct  470  QVVETGTHEELLAKPAGAYASLIRFQE  496



>ref|XP_003579896.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1263

 Score =   375 bits (962),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/272 (67%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF VL+ +T I  D    E++  V G IELR V+F+YPSRPD  IFKDF++R+R G+
Sbjct  991   IRSVFAVLNSRTRIDPDEPETEQVESVRGEIELRHVDFAYPSRPDVMIFKDFSLRIRAGQ  1050

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1051  SQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1110

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI ENI YGK+GATE EVIEAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1111  TSILENIAYGKDGATEEEVIEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  1170

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1171  ARAVLKDPAVLLLDEATSALDAESECVLQEALGRIMKGRTAVLVAHRLSTIRCVDSIAVV  1230

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1231  QDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  1262


 Score =   311 bits (796),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  347  LLEVIRQRPTIVQDSADGRCLDEVHGNIEFKEVSFSYPSRPDVMIFRDFSLFFPAGKTAA  406

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  407  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  466

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  467  IENILYGKPDATMAEVEAAASAANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  526

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  527  MLKNPKILLLDEATSALDAGSESIVQEALDRIMIGRTTVVVAHRLSTIRCVDMIAVIQQG  586

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  587  QVVETGTHDELLAKGSSGAYAALIRFQE  614



>ref|XP_002992781.1| hypothetical protein SELMODRAFT_236608 [Selaginella moellendorffii]
 gb|EFJ06167.1| hypothetical protein SELMODRAFT_236608 [Selaginella moellendorffii]
Length=1188

 Score =   374 bits (959),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 225/274 (82%), Gaps = 1/274 (0%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV-GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPG  719
             Q + +VFE++DRK +I  +    E+  V+G ++ R VEFSYP+R D  IF+D ++R+R G
Sbjct  908   QALYAVFEIMDRKGQINPNTRAMEISNVKGDVDFRHVEFSYPARKDVVIFRDLSLRIRAG  967

Query  718   KSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALF  539
             KS+ALVG SGSGKSSV++LI RFYDP+SG +MIDGK+I++L L+SLR+HIGLVQQEPALF
Sbjct  968   KSLALVGASGSGKSSVVALIQRFYDPVSGYIMIDGKNIRSLNLQSLRRHIGLVQQEPALF  1027

Query  538   ATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVA  359
             + SIYENILYGKEGA+E+E+++AAK ANAH FIS+LP GY T+VGERGVQLSGGQKQRVA
Sbjct  1028  SCSIYENILYGKEGASEAEIVQAAKTANAHGFISSLPNGYQTQVGERGVQLSGGQKQRVA  1087

Query  358   IARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICV  179
             IARAVLK P ILLLDEATSALD  SE+ VQ+ALDR+M+ RT+++VAHR S I+NAD I V
Sbjct  1088  IARAVLKCPAILLLDEATSALDAHSEKQVQEALDRVMRGRTTLIVAHRFSAIRNADIIAV  1147

Query  178   LQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             +QDG ++EQG+   L+ NR+ AY++L+ L    +
Sbjct  1148  VQDGTVVEQGSPKELLSNRNSAYFQLVKLHARHR  1181


 Score =   317 bits (811),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 204/262 (78%), Gaps = 0/262 (0%)
 Frame = -2

Query  886  ASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +++ +++ R+  +L + G  L +V G IELR++ FSYPSRP++ + KDF++ V  GK++A
Sbjct  289  SNIIQMVKRRPAMLHNQGGRLEEVYGDIELRNICFSYPSRPESLVLKDFSLMVPAGKTIA  348

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            ++G SGSGKS+V+SLI RFYDP+SG V++DG +IK L+L+ LRK IGLV QEP LFAT+I
Sbjct  349  IIGSSGSGKSTVVSLIERFYDPLSGDVLLDGTNIKYLELQWLRKQIGLVSQEPILFATTI  408

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             EN+LY KE AT  E+IE +K +NAH FI   PEGY T+VGERGVQLSGG+KQRVA+ARA
Sbjct  409  RENLLYSKEDATMEELIEVSKASNAHEFIDLFPEGYETQVGERGVQLSGGEKQRVALARA  468

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  S+++VQ ALDR    RT+VV+AH+LSTI++AD I V+  G
Sbjct  469  MLKNPKILLLDEATSALDTGSQQLVQDALDRFRVGRTTVVIAHQLSTIRHADSIAVVHHG  528

Query  166  KIIEQGTHSTLIENRDGAYYKL  101
            +I+E GTH  L+   +  Y+ +
Sbjct  529  RIVEMGTHEELLAKGEKGYWSI  550



>ref|XP_007151220.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
 gb|ESW23214.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
Length=1249

 Score =   374 bits (961),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/274 (66%), Positives = 220/274 (80%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D  +      + G IELR V+F+YPSRPD  +FKD ++R+R 
Sbjct  975   EAVGSVFSILDRSTRIDPDDPDADPVETLRGEIELRHVDFAYPSRPDVMVFKDLSLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI+GKVM+DGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGK+GA+E EVIEAA+ AN H F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKDGASEGEVIEAARAANVHGFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I 
Sbjct  1155  AIARAVLKDPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H+ L+   +GAY +L+ LQ H 
Sbjct  1215  VVQDGRIVEQGSHAELVSRPEGAYSRLLQLQHHH  1248


 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 205/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++++K  I+ D   G+ L  V G IE +DV FSYPSRPD  IF+ F++    GK++A
Sbjct  335  LMEIINQKPTIVEDSSEGKCLADVNGNIEFKDVTFSYPSRPDVFIFRSFSIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK+L+LK LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKSLQLKWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKADATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + G Y  LI  Q+
Sbjct  575  QVVETGTHEELIA-KTGTYASLIRFQE  600



>ref|XP_009415585.1| PREDICTED: ABC transporter B family member 19 [Musa acuminata 
subsp. malaccensis]
Length=1255

 Score =   374 bits (961),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/272 (68%), Positives = 218/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+R T I  D    E +  V G IELR VEF+YPSRPD  IFKDFN+R+R G+
Sbjct  983   IRSVFAILNRGTRIDPDDPEAEPVDSVRGEIELRHVEFAYPSRPDVTIFKDFNLRIRAGQ  1042

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP +GKV+IDGKDIK L LKSLR  IGLVQQEP LFA
Sbjct  1043  SQALVGASGSGKSTVIALIERFYDPTAGKVLIDGKDIKRLNLKSLRLKIGLVQQEPVLFA  1102

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YGK+GATE EVIEAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1103  ASIMENIAYGKDGATEEEVIEAARAANVHGFVSALPDGYKTTVGERGVQLSGGQKQRIAI  1162

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D I V+
Sbjct  1163  ARAVLKDPALLLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDCIGVV  1222

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG++ EQG+HS L+   DGAY +L+ LQ + 
Sbjct  1223  QDGRVAEQGSHSDLVARPDGAYSRLLQLQHYH  1254


 Score =   318 bits (816),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 208/268 (78%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IEL+DV FSYPSRPD  IF+DF++ +  GK++A
Sbjct  339  LLEIIRQKPSIVQDQSDGKCLAEVHGNIELKDVTFSYPSRPDVIIFRDFSLFIPAGKTVA  398

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G +++D  DIK L+LK LR+ IGLV QEPALFAT+I
Sbjct  399  VVGGSGSGKSTVVALIERFYDPNQGLILLDNVDIKTLQLKWLREQIGLVNQEPALFATTI  458

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFIS LP  Y+T+VGERGVQLSGGQKQR+AIARA
Sbjct  459  LENILYGKPDATIAEVEAAASAANAHSFISQLPNAYNTQVGERGVQLSGGQKQRIAIARA  518

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  519  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDMIAVIQQG  578

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  579  QVVETGTHEELLAKGSSGAYASLIRFQE  606



>gb|KGN52452.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1361

 Score =   375 bits (962),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 224/273 (82%), Gaps = 3/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKD N+R+R G+
Sbjct  1089  IGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVDFAYPSRPDVMVFKDLNLRIRAGQ  1148

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDP++GKVMIDGKDI+ L L+SLR  IGLVQQEPALFA
Sbjct  1149  SQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDIRRLNLQSLRLKIGLVQQEPALFA  1208

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI++NI YGK+GATESEVIEAA+ AN H F+S LP+GY+T VGERGVQLSGGQKQR+AI
Sbjct  1209  ASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPDGYNTPVGERGVQLSGGQKQRIAI  1268

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+VVVAHRLSTI++ D I V+
Sbjct  1269  ARAVLKDPTILLLDEATSALDAESECVLQEALERLMRGRTTVVVAHRLSTIRSVDSIGVV  1328

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDG+I+EQG+H+ L+   +GAY +L+ L QHQ 
Sbjct  1329  QDGRIVEQGSHNELLSRAEGAYSRLLQL-QHQH  1360


 Score =   320 bits (819),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  447  LMEIIKQKPTIIQDPLDGKCLGEVNGNIEFKDVTFSYPSRPDVMIFRDFSIFFPAGKTVA  506

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  507  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  566

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            YENILYGK  AT +EV  AA  ANAHSFI+ LP GY T+VGERG+QLSGGQKQR+AIARA
Sbjct  567  YENILYGKPDATTAEVEAAAAAANAHSFITLLPNGYDTQVGERGLQLSGGQKQRIAIARA  626

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  627  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  686

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  687  QVVETGTHDELI-TKSGAYSSLIRFQE  712



>dbj|BAJ96840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1271

 Score =   373 bits (958),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 219/273 (80%), Gaps = 2/273 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  V G IELR V+FSYPSRPD  IFKDFN++++ G+
Sbjct  999   IRSIFGILNRATRIEPDDPEAERVTTVRGDIELRHVDFSYPSRPDIEIFKDFNLKIQAGR  1058

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKVMIDGKDI+ L LKSLR+ IGLVQQEP LFA
Sbjct  1059  SQALVGASGSGKSTVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRRKIGLVQQEPVLFA  1118

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +SI ENI YGKEGATE EVIEAAK AN H+F+S LP+GY T VGERGVQ SGGQKQR+AI
Sbjct  1119  SSILENIAYGKEGATEEEVIEAAKTANVHAFVSQLPDGYRTAVGERGVQPSGGQKQRIAI  1178

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1179  ARAVLKDPAILLLDEATSALDAESESVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1238

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             QDG+++E G HS L+   +GAY +L+ LQ H+ 
Sbjct  1239  QDGRVVEHGGHSELVARPEGAYSRLLQLQNHRN  1271


 Score =   327 bits (838),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++    GK++A
Sbjct  355  LLEVIRQKPSIVHDHKDGKLLAEVHGNIEFKDVTFSYPSRPDAMIFRDFSLFFPAGKTVA  414

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  415  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  474

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  475  IENILYGKPDATIAEVEAAATASNAHSFISLLPNGYNTMVGERGIQLSGGQKQRIAIARA  534

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD +SE IVQ+ALDRLM  RT+V+VAHRL TI+N + I VLQ G
Sbjct  535  MLKDPKILLLDEATSALDADSENIVQEALDRLMVGRTTVIVAHRLCTIRNVNMIAVLQQG  594

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  595  QVVETGTHDELLAKGSSGAYASLIRFQE  622



>gb|EEC77398.1| hypothetical protein OsI_16157 [Oryza sativa Indica Group]
Length=1248

 Score =   372 bits (956),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E +  V G I+ R V+F+YPSRPD  +FKDF++R+R G+
Sbjct  976   IRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSRPDVMVFKDFSLRIRAGQ  1035

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L ++SLR  IGLVQQEP LFA
Sbjct  1036  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVRSLRLKIGLVQQEPVLFA  1095

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI+ENI YGK+GATE EVIEAAK+AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1096  TSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  1155

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1156  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1215

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1216  QDGRVVEQGSHGELVSRPDGAYSRLLQLQLHH  1247


 Score =   316 bits (810),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/274 (60%), Positives = 203/274 (74%), Gaps = 9/274 (3%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  326  LLEVIRQRPTIVQDPADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  385

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  386  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  445

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTK------VGERGVQLSGGQKQR  365
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+ +      VGERG+QLSGGQKQR
Sbjct  446  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYTLRWVLGLLVGERGLQLSGGQKQR  505

Query  364  VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
            +AIARA+LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I
Sbjct  506  IAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMI  565

Query  184  CVLQDGKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             V+Q G+++E GTH  L+ +   GAY  LI  Q+
Sbjct  566  AVIQQGQVVETGTHDELLAKGSSGAYAALIRFQE  599



>ref|XP_008804466.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Phoenix dactylifera]
Length=946

 Score =   367 bits (941),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/271 (65%), Positives = 217/271 (80%), Gaps = 2/271 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILADVGEE--LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + SVF +L+R T I  D  E   +  + G IELR V+F+YPSRPD P+F+DFN+R+  G 
Sbjct  674  IRSVFSILNRLTRIDPDDPEAKPVGSIRGEIELRHVDFAYPSRPDIPVFEDFNLRIHAGL  733

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SG GKS+VI+LI RFYDP +GKVMIDG+DI+ L LKSLR  IGLVQQEP LFA
Sbjct  734  SQALVGASGCGKSTVIALIERFYDPTAGKVMIDGEDIRGLNLKSLRLKIGLVQQEPVLFA  793

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             SI+ENI YGK+GATE EV+EAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  794  ASIFENIAYGKDGATEDEVLEAARAANVHGFVSALPKGYKTPVGERGVQLSGGQKQRIAI  853

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLK+P +LLLDEATSALD ESE ++Q+AL++LM+ RT+V+VAHRLSTI+  D I V+
Sbjct  854  ARAVLKDPAVLLLDEATSALDAESECVLQEALEQLMRGRTTVLVAHRLSTIRGVDSIAVV  913

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
            QDG I+EQG+H+ L+   DGAY +L+ LQ H
Sbjct  914  QDGHIVEQGSHAELVARADGAYVRLLQLQHH  944


 Score =   319 bits (817),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L +V G +E +DV FSYPSRPD  IF+DF++    GK+ A
Sbjct  30   LMEIIQQKPSIIQDLSDGKCLPEVHGNLEFKDVTFSYPSRPDVIIFRDFSLSFPAGKTTA  89

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+ LI RFYDP  G++++D  DIK L+LK LR+ IGLV QEPALFAT+I
Sbjct  90   VVGGSGSGKSTVVVLIERFYDPNQGQILLDNVDIKTLQLKWLREQIGLVSQEPALFATTI  149

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK GAT +EV  AA  ANAH+FIS LP GY+T+ GERGVQLSGGQKQR+AIARA
Sbjct  150  LENILYGKPGATIAEVEAAASAANAHNFISLLPNGYNTQAGERGVQLSGGQKQRIAIARA  209

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  210  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDMIAVIQQG  269

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +I+E GTH  L+ +   GAY  LI  Q+
Sbjct  270  QIVETGTHEELLAKGTSGAYASLIRFQE  297



>emb|CAD59581.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1256

 Score =   372 bits (956),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E +  V G I+ R V+F+YPSRPD  +FKDF++R+R G+
Sbjct  984   IRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSRPDVMVFKDFSLRIRAGQ  1043

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L ++SLR  IGLVQQEP LFA
Sbjct  1044  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVRSLRLKIGLVQQEPVLFA  1103

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI+ENI YGK+GATE EVIEAAK+AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1104  TSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  1163

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1164  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1223

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1224  QDGRVVEQGSHGELVSRPDGAYSRLLQLQLHH  1255


 Score =   325 bits (832),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  340  LLEVIRQRPTIVQDPADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  399

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  400  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  459

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  460  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  519

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  520  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  579

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  580  QVVETGTHDELLAKGSSGAYAALIRFQE  607



>emb|CAD40903.1| OSJNBa0036B21.21 [Oryza sativa Japonica Group]
 emb|CBW45777.1| ORW1943Ba0077G13.5 [Oryza rufipogon]
Length=1252

 Score =   372 bits (956),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E +  V G I+ R V+F+YPSRPD  +FKDF++R+R G+
Sbjct  980   IRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSRPDVMVFKDFSLRIRAGQ  1039

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L ++SLR  IGLVQQEP LFA
Sbjct  1040  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVRSLRLKIGLVQQEPVLFA  1099

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI+ENI YGK+GATE EVIEAAK+AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1100  TSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  1159

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1160  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1219

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1220  QDGRVVEQGSHGELVSRPDGAYSRLLQLQLHH  1251


 Score =   324 bits (831),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  326  LLEVIRQRPTIVQDPADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  385

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  386  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  445

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  446  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  505

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  506  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  565

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  566  QVVETGTHDELLAKGSSGAYAALIRFQE  593



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score =   372 bits (956),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E +  V G I+ R V+F+YPSRPD  +FKDF++R+R G+
Sbjct  987   IRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSRPDVMVFKDFSLRIRAGQ  1046

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L ++SLR  IGLVQQEP LFA
Sbjct  1047  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVRSLRLKIGLVQQEPVLFA  1106

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI+ENI YGK+GATE EVIEAAK+AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1107  TSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  1166

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1167  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1226

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1227  QDGRVVEQGSHGELVSRPDGAYSRLLQLQLHH  1258


 Score =   324 bits (831),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  343  LLEVIRQRPTIVQDPADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  402

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  403  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  462

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  463  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  522

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  523  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  582

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  583  QVVETGTHDELLAKGSSGAYAALIRFQE  610



>gb|EMT32511.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1274

 Score =   372 bits (956),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/274 (66%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V S F VL+ +T I  D    E++ KV G IELR V+FSYPSRPD  +FK+F++R+R 
Sbjct  1000  EAVRSGFAVLNSRTRIDPDGPEAEQVEKVRGEIELRHVDFSYPSRPDVMVFKEFSLRIRA  1059

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEP L
Sbjct  1060  GQSQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPVL  1119

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FATSI ENI YGK+G TE EV+EAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+
Sbjct  1120  FATSILENIAYGKDGVTEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRI  1179

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL R+MK RT+V+VAHRLSTI+  D I 
Sbjct  1180  AIARAVLKDPAILLLDEATSALDAESECVLQEALGRIMKGRTTVLVAHRLSTIRCVDSIA  1239

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1240  VVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  1273


 Score =   311 bits (796),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  +F+DF++    GK+ A
Sbjct  358  LLEVIRQRPTIVQDSTDGRCLDEVHGNIEFKEVSFSYPSRPDVMVFRDFSLFFPAGKTAA  417

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK+L+LK LR  IGLV QEPALFAT+I
Sbjct  418  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNADIKSLQLKWLRDQIGLVNQEPALFATTI  477

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             +NILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  478  IDNILYGKPDATMAEVEAAASAANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  537

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRLSTI++ D I V+Q G
Sbjct  538  MLKNPKILLLDEATSALDAGSESIVQEALDRIMIGRTTVVVAHRLSTIRSVDMIAVIQQG  597

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  598  QVVETGTHDELLAKGSSGAYAALIRFQE  625



>ref|XP_011085762.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1250

 Score =   372 bits (954),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 226/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD P+FKDFN+R+R 
Sbjct  976   EAVGSVFSILDRPTRIDPDDPEAEHVESIRGEIELRHVDFAYPSRPDVPVFKDFNLRIRA  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDPI GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GQSQALVGASGSGKSSVIALIERFYDPIIGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA+SI++NI YGKEGATE+EV+EAA+ AN H+F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FASSIFDNIAYGKEGATEAEVVEAARAANVHTFVSGLPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARA+LK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT++VVAHRLSTI+  D I 
Sbjct  1156  AIARAILKDPSILLLDEATSALDAESECVLQEALERLMRGRTTIVVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+H  LI   DGAY +L+ LQ+H+
Sbjct  1216  VVQDGRIVEQGSHGDLISRPDGAYSRLLQLQRHR  1249


 Score =   316 bits (810),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  336  LIEIIKQKPTIVQDASDGKCLSEVNGNIEFKNVTFSYPSRPDIVIFRDFSIFFPAGKTIA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G++++D  DIK L+L  LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGEILLDNVDIKTLQLNWLRNQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATMAEVEAAANAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LK+P+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I VLQ G
Sbjct  516  MLKDPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVLQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELIA-KAGAYASLIRFQE  601



>ref|XP_004173903.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
1-like, partial [Cucumis sativus]
Length=703

 Score =   358 bits (920),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 210/266 (79%), Gaps = 4/266 (2%)
 Frame = -2

Query  883  SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            SVF +LDRKTEI  D  +      K+ G +EL+ V+FSYP+RPD P+FKD N+R R GK+
Sbjct  438  SVFALLDRKTEIEPDEPDATPVPDKLRGEVELKHVDFSYPTRPDIPVFKDLNLRARAGKT  497

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
            +ALVG SG GKSSVI+L+ RFY+P SG+VMIDGKDI+   LKSLRKHI +V QEP LFA 
Sbjct  498  LALVGPSGCGKSSVIALVQRFYEPTSGRVMIDGKDIRKFNLKSLRKHIAMVPQEPCLFAA  557

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            SIY+NI YG E ATE+E+IEAA LANAH FIS LPEGY T VGERGVQLSGGQKQR+AIA
Sbjct  558  SIYDNIAYGHESATETEIIEAATLANAHKFISGLPEGYKTFVGERGVQLSGGQKQRIAIA  617

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  618  RALIRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  677

Query  172  DGKIIEQGTHSTLIENR-DGAYYKLI  98
            DGK+ EQG+HS L+ N  DG Y ++I
Sbjct  678  DGKVSEQGSHSHLLXNYPDGCYARMI  703


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -2

Query  238  TSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
            T++V+AHRLSTI+ AD + VLQ G + E GTH  L  +  +G Y KLI +Q+   +
Sbjct  1    TTLVIAHRLSTIRKADLVAVLQQGSVSEMGTHDELFAKGENGVYAKLIRMQEMAHE  56



>gb|AFW59636.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=1146

 Score =   368 bits (945),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  + G IELR V+FSYP+RPD  IFKDFN++++ G+
Sbjct  874   IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFSYPARPDIQIFKDFNLKIQAGR  933

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS++I+LI RFYDP  GKV IDGKDI+ L LKSLR+ IGLVQQEP LFA
Sbjct  934   SQALVGASGSGKSTIIALIERFYDPCGGKVAIDGKDIRTLNLKSLRRKIGLVQQEPVLFA  993

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +SI ENI YGKEGA+E EV+EAAK AN H F+S LP+GY T VGERG+QLSGGQKQR+AI
Sbjct  994   SSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPDGYRTAVGERGMQLSGGQKQRIAI  1053

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1054  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1113

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++E G+HS L+   +GAY +L+ LQ H+
Sbjct  1114  QDGRVVEHGSHSDLLARPEGAYSRLLQLQHHR  1145


 Score =   327 bits (838),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  230  LLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDFSLFFPAGKTVA  289

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  290  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  349

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  350  LENILYGKPDATIAEVEAATTASNAHSFISLLPNGYNTMVGERGIQLSGGQKQRIAIARA  409

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  410  MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  469

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  470  QVVETGTHDELLAKGTSGAYASLIRFQE  497



>tpg|DAA35747.1| TPA: hypothetical protein ZEAMMB73_634725 [Zea mays]
Length=989

 Score =   365 bits (936),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 218/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + S+F +L+R T I  D    E +  + G IELR V+FSYP+RPD  IFKDFN++++ G+
Sbjct  717  IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFSYPARPDIQIFKDFNLKIQAGR  776

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  777  SQALVGASGSGKSTVIALIERFYDPCGGKVAIDGKDIRTLNLKSLRLKIGLVQQEPVLFA  836

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            +SI ENI YGKEGA+E EV+EAAK AN H F+S LP+GY T VGE+G+QLSGGQKQR+AI
Sbjct  837  SSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPDGYRTAVGEQGMQLSGGQKQRIAI  896

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  897  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  956

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            QDG+++E G+HS L+   +GAY +L+ LQ H+
Sbjct  957  QDGRVVEHGSHSDLLARPEGAYLRLLQLQHHR  988


 Score =   327 bits (839),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  73   LLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDFSLFFPAGKTVA  132

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR+ IGLV QEPALFAT+I
Sbjct  133  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLREQIGLVNQEPALFATTI  192

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T  GERG+QLSGGQKQR+AIARA
Sbjct  193  LENILYGKPDATIAEVEAAATASNAHSFISLLPNGYNTMAGERGIQLSGGQKQRIAIARA  252

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  253  MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  312

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  LI +   GAY  L+  Q+
Sbjct  313  QVVETGTHDELIAKGTSGAYASLVRFQE  340



>gb|KDO72552.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=987

 Score =   365 bits (936),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            V SVF  LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDFN+R+R G+
Sbjct  715  VGSVFSTLDRSTRIDPDDPDAEPVETIRGEIELRHVDFAYPSRPDVVVFKDFNLRIRAGQ  774

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPALFA
Sbjct  775  SQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFA  834

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             SI++NI YGKEGATE+EV+EAA+ AN H F+SALP  Y T VGERGVQLSGGQKQR+AI
Sbjct  835  ASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYKTPVGERGVQLSGGQKQRIAI  894

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARAVLKNP ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I V+
Sbjct  895  ARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIGVV  954

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
            QDG+I+EQG+HS L+   DGAY +L+ LQ H 
Sbjct  955  QDGRIVEQGSHSELVSRPDGAYSRLLQLQHHH  986


 Score =   318 bits (814),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  73   LMEIIKQKPSIIQDPTNGRCLDEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVA  132

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  133  VVGGSGSGKSTVVSLIERFYDPNAGHVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  192

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GYST+VGERGVQLSGGQKQR+AIARA
Sbjct  193  LENILYGKPEATMAEVEAAASAANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARA  252

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D + V+Q G
Sbjct  253  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTVAVIQQG  312

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  313  QVVETGTHEELIA-KAGAYASLIRFQE  338



>ref|XP_004975845.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1258

 Score =   369 bits (947),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E++  V G I+ R V+F+YP+RPD  +FKDF++R+R G+
Sbjct  986   IRSVFAILNSRTRIDPDEPDTEQVESVRGEIDFRHVDFAYPTRPDVMVFKDFSLRIRAGQ  1045

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDG+DI+ L LKSLR  IGLVQQEP LFA
Sbjct  1046  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGRDIRRLNLKSLRLKIGLVQQEPVLFA  1105

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI ENI YGK+GATE EV+EAAK AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1106  TSILENIAYGKDGATEEEVVEAAKAANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  1165

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1166  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1225

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1226  QDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  1257


 Score =   325 bits (832),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 203/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  344  LLEVIRQRPTIVQDTADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  403

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  404  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  463

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  464  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTHVGERGLQLSGGQKQRIAIARA  523

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  524  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  583

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  584  QVVETGTHDELLAKGSSGAYAALIRFQE  611



>ref|XP_002447959.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
 gb|EES12287.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
Length=1262

 Score =   369 bits (946),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/272 (64%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E++  V G I+ R V+F+YP+RPD  +FKDF++R+R G+
Sbjct  990   IRSVFAILNSRTRIDPDDPDAEQVESVRGEIDFRHVDFAYPTRPDVMVFKDFSLRIRAGQ  1049

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVM+DGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1050  SQALVGASGSGKSTVIALIERFYDPLAGKVMVDGKDIRRLNLKSLRLRIGLVQQEPVLFA  1109

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YG++GATE EV+EAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1110  ASILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  1169

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1170  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDNIAVV  1229

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1230  QDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  1261


 Score =   325 bits (832),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  348  LLEVIRQRPTIVQDTADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  407

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR+ IGLV QEPALFAT+I
Sbjct  408  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLREQIGLVNQEPALFATTI  467

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  468  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTHVGERGLQLSGGQKQRIAIARA  527

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP++LLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  528  MLKNPKLLLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  587

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  588  QVVETGTHDELLAKGSSGAYAALIRFQE  615



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score =   369 bits (946),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF VL+ +T I  D    E++  V G I+ R V+F+YP+RPD  +FKD ++R+R G+
Sbjct  992   IRSVFSVLNSRTRIDPDDPDAEQVESVRGEIDFRHVDFAYPTRPDVMVFKDLSLRIRAGQ  1051

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+L+ RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1052  SQALVGASGSGKSTVIALVERFYDPLAGKVMIDGKDIRRLNLKSLRLRIGLVQQEPVLFA  1111

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI ENI YG++GATE EV+EAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1112  TSILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  1171

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1172  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1231

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1232  QDGRVVEQGSHGDLVSRPDGAYSRLLQLQLHH  1263


 Score =   322 bits (826),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 203/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  350  LLEVIRQRPTIVQDTADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  409

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  410  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  469

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T VG+RG+QLSGGQKQR+AIARA
Sbjct  470  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTHVGDRGLQLSGGQKQRIAIARA  529

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP++LLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  530  MLKNPKLLLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  589

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  590  QVVETGTHDELLAKGSSGAYAALIRFQE  617



>ref|XP_002448624.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
 gb|EES12952.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
Length=1266

 Score =   368 bits (945),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 217/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  + G IELR V+FSYP+RPD  IFKDFN+++  G+
Sbjct  994   IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFSYPARPDIQIFKDFNLKIHAGR  1053

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1054  SQALVGASGSGKSTVIALIERFYDPCGGKVAIDGKDIRTLNLKSLRLKIGLVQQEPVLFA  1113

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +SI ENI YGKEGATE EVIEAAK AN H F+S LP+GY T VGERG+QLSGGQKQR+AI
Sbjct  1114  SSILENIAYGKEGATEEEVIEAAKTANVHGFVSQLPDGYKTAVGERGMQLSGGQKQRIAI  1173

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1174  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1233

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+E G+H+ L+   +GAY +L+ LQ H+
Sbjct  1234  QDGRIVEHGSHNDLLARPEGAYSRLLQLQHHR  1265


 Score =   327 bits (837),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  350  LLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDFSLFFPAGKTVA  409

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  410  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  469

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  +NAH FIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  470  LENILYGKPDATIAEVEAAATASNAHGFISLLPNGYNTMVGERGIQLSGGQKQRIAIARA  529

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  530  MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  589

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  L+  Q+
Sbjct  590  QVVETGTHDELLAKGTSGAYASLVRFQE  617



>ref|XP_008663648.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 gb|AFW59637.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=1266

 Score =   368 bits (945),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  + G IELR V+FSYP+RPD  IFKDFN++++ G+
Sbjct  994   IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFSYPARPDIQIFKDFNLKIQAGR  1053

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS++I+LI RFYDP  GKV IDGKDI+ L LKSLR+ IGLVQQEP LFA
Sbjct  1054  SQALVGASGSGKSTIIALIERFYDPCGGKVAIDGKDIRTLNLKSLRRKIGLVQQEPVLFA  1113

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +SI ENI YGKEGA+E EV+EAAK AN H F+S LP+GY T VGERG+QLSGGQKQR+AI
Sbjct  1114  SSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPDGYRTAVGERGMQLSGGQKQRIAI  1173

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1174  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1233

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++E G+HS L+   +GAY +L+ LQ H+
Sbjct  1234  QDGRVVEHGSHSDLLARPEGAYSRLLQLQHHR  1265


 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  350  LLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDFSLFFPAGKTVA  409

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  410  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  469

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  470  LENILYGKPDATIAEVEAATTASNAHSFISLLPNGYNTMVGERGIQLSGGQKQRIAIARA  529

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  530  MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  589

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  590  QVVETGTHDELLAKGTSGAYASLIRFQE  617



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score =   368 bits (944),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+ +T I  D    E +  V G I+ R V+F+YPSRPD  +FKDF++R+R G+
Sbjct  983   IRSVFAILNYRTRIDPDEPDTEPVESVRGDIDFRHVDFAYPSRPDVMVFKDFSLRIRAGQ  1042

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L ++ LR  IGLVQQEP LFA
Sbjct  1043  SQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVRQLRLKIGLVQQEPVLFA  1102

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI ENI YGK+GATE EV+EAAK+AN H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1103  TSIMENIAYGKDGATEEEVVEAAKVANMHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  1162

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL+R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1163  ARAVLKDPAVLLLDEATSALDAESECVLQEALERIMKGRTAVLVAHRLSTIRGVDSIAVV  1222

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++EQG+H  L+   DGAY +L+ LQ H 
Sbjct  1223  QDGRVVEQGSHGELVSRPDGAYSRLLQLQLHH  1254


 Score =   324 bits (831),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 204/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK+ A
Sbjct  339  LLEVIRQRPTIVQDPADGRCLDEVHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAA  398

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  399  VVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTI  458

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  459  LENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  518

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+  D I V+Q G
Sbjct  519  MLKNPKILLLDEATSALDAGSENIVQEALDRLMVGRTTVVVAHRLSTIRCVDMIAVIQQG  578

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  579  QVVETGTHDELLAKGSSGAYAALIRFQE  606



>ref|XP_010684039.1| PREDICTED: ABC transporter B family member 1 [Beta vulgaris subsp. 
vulgaris]
Length=1339

 Score =   369 bits (947),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/270 (66%), Positives = 218/270 (81%), Gaps = 4/270 (1%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTEI  D  +      ++ G +EL+ V+FSYP+RPD  +F+D N+R R GK+
Sbjct  1043  SVFQLLDRKTEIEPDDSDATPVPERLRGEVELKHVDFSYPTRPDISVFQDLNLRARAGKT  1102

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVISL+LRFYDP SG+VMIDGKDI+   LKSLR+HIGLV QEP LFAT
Sbjct  1103  LALVGPSGCGKSSVISLVLRFYDPSSGRVMIDGKDIRKYNLKSLRQHIGLVPQEPCLFAT  1162

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IY+NI YG E ATE+E+IEAA LANAH FISA+PEGY T+VGERGVQ+SGGQKQR+A+A
Sbjct  1163  TIYDNIKYGNENATETEIIEAATLANAHKFISAMPEGYKTQVGERGVQMSGGQKQRIALA  1222

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA +K  EI+LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1223  RAFVKKAEIMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1282

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ  86
             DGK+ EQG+HS LI+N  DG Y ++I LQ+
Sbjct  1283  DGKVAEQGSHSHLIKNYPDGCYARMIQLQR  1312


 Score =   327 bits (838),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F V+D K  I  +   G EL  V G IEL++VEF+YPSRPD  I  +F + V  GK++A
Sbjct  390  IFMVIDHKPSIDRNKISGTELESVTGQIELKNVEFAYPSRPDVKILHNFTLTVPAGKTIA  449

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDPI G++++DG DIK LKL+ LR+ IGLV QEPALFATSI
Sbjct  450  LVGSSGSGKSTVVSLIERFYDPIEGQLLLDGHDIKTLKLRWLRQQIGLVSQEPALFATSI  509

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A+  EV EAA++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  510  KENILLGRPDASLVEVEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARA  569

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  570  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  629

Query  166  KIIEQGTHSTLIENRDGAYY-KLINLQQ  86
             + E GTH  L+   + + Y KLI +Q+
Sbjct  630  SVSEIGTHDELMAKGESSVYSKLIRMQE  657



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score =   368 bits (944),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEE--LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T +  D  E   +  + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  975   EAVGSVFSILDRSTRVDPDDTEADPVESIRGDIELRHVDFAYPSRPDVSVFKDFNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EV+EAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVVEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI++ D I 
Sbjct  1155  AIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRHVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H+
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHR  1248


 Score =   331 bits (849),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L +V G IE ++V FSYPSRPD  IF+DF +    GK++A
Sbjct  335  LMEIIKQKPTIVQDLADGKCLSEVNGNIEFKNVTFSYPSRPDVIIFRDFCIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KGGAYSSLIRFQE  600



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score =   368 bits (944),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 186/274 (68%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEE--LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR T +  D  E   +  + G IELR V+F+YPSRPD  +FKDFN+R+R 
Sbjct  975   EAVGSVFSILDRSTRVDPDDTEADPVESIRGDIELRHVDFAYPSRPDVSVFKDFNLRIRA  1034

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S ALVG SGSGKSSVI+LI RFYDP  GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1035  GQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1094

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EV+EAA+ AN H+F+S LPEGY T VGERGVQLSGGQKQR+
Sbjct  1095  FAASIFENIAYGKEGATEAEVVEAARAANVHTFVSGLPEGYKTPVGERGVQLSGGQKQRI  1154

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI++ D I 
Sbjct  1155  AIARAVLKDPSILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRHVDSIG  1214

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+EQG+HS LI   +GAY +L+ LQ H+
Sbjct  1215  VVQDGRIVEQGSHSELISRPEGAYSRLLQLQHHR  1248


 Score =   331 bits (848),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L +V G IE ++V FSYPSRPD  IF+DF +    GK++A
Sbjct  335  LMEIIKQKPTIVQDLADGKCLSEVNGNIEFKNVTFSYPSRPDVIIFRDFCIFFPAGKTVA  394

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  395  VVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  454

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  A   ANAHSFI+ LP GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  455  LENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARA  514

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  515  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDSIAVIQQG  574

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  575  QVVETGTHEELIA-KAGAYSSLIRFQE  600



>ref|XP_010939542.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Elaeis guineensis]
Length=1253

 Score =   367 bits (943),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 216/272 (79%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+R T I  D    E +  + G IELR ++F+YPSRPD PIF DFN+R+  G 
Sbjct  981   IRSVFSILNRVTRIDPDDPEAEPVGSIHGEIELRHIDFAYPSRPDVPIFNDFNLRIHAGH  1040

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS++I+LI RFYDP +GKVM+DGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1041  SQALVGASGSGKSTIIALIERFYDPTAGKVMMDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1100

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI+ENI YGK+GATE EV EA++ A+ H F+SALPEGY T VGERGVQLSGGQKQR+AI
Sbjct  1101  ASIFENIAYGKDGATEDEVXEASRAASVHGFVSALPEGYKTPVGERGVQLSGGQKQRIAI  1160

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEA SALDVESE ++Q+AL++LM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1161  ARAVLKDPAVLLLDEAMSALDVESECVLQEALEQLMRGRTTVLVAHRLSTIRGVDSIAVV  1220

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG I+EQG+H+ L+   DGAY +L+ LQ H 
Sbjct  1221  QDGHIVEQGSHAELVARPDGAYARLLQLQHHH  1252


 Score =   313 bits (803),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 205/268 (76%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V+G +E +DV FSYPSRPD  IF+DF++    GK+ A
Sbjct  337  LMEIIQQKPSIIQDPSDGKCLPEVQGNLEFKDVTFSYPSRPDVIIFRDFSLFFPAGKTAA  396

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+ LI RFYDP  G++++D  D K L+LK LR+ IGLV QEPALFAT+I
Sbjct  397  VVGGSGSGKSTVVVLIERFYDPNQGQILLDNVDTKTLQLKWLREQIGLVSQEPALFATTI  456

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAH+FIS LP GY+T+ GERGVQLSGGQKQR+AIARA
Sbjct  457  LENILYGKPDATIAEVEAAASAANAHNFISLLPNGYNTQAGERGVQLSGGQKQRIAIARA  516

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  517  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDMIAVMQQG  576

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +I+E GTH  L+ +   GAY  LI  Q+
Sbjct  577  QIVETGTHEELLAKGSSGAYASLIRFQE  604



>ref|XP_008804465.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Phoenix dactylifera]
Length=1275

 Score =   367 bits (943),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/271 (65%), Positives = 217/271 (80%), Gaps = 2/271 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADVGEE--LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + SVF +L+R T I  D  E   +  + G IELR V+F+YPSRPD P+F+DFN+R+  G 
Sbjct  1003  IRSVFSILNRLTRIDPDDPEAKPVGSIRGEIELRHVDFAYPSRPDIPVFEDFNLRIHAGL  1062

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SG GKS+VI+LI RFYDP +GKVMIDG+DI+ L LKSLR  IGLVQQEP LFA
Sbjct  1063  SQALVGASGCGKSTVIALIERFYDPTAGKVMIDGEDIRGLNLKSLRLKIGLVQQEPVLFA  1122

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI+ENI YGK+GATE EV+EAA+ AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1123  ASIFENIAYGKDGATEDEVLEAARAANVHGFVSALPKGYKTPVGERGVQLSGGQKQRIAI  1182

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P +LLLDEATSALD ESE ++Q+AL++LM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1183  ARAVLKDPAVLLLDEATSALDAESECVLQEALEQLMRGRTTVLVAHRLSTIRGVDSIAVV  1242

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
             QDG I+EQG+H+ L+   DGAY +L+ LQ H
Sbjct  1243  QDGHIVEQGSHAELVARADGAYVRLLQLQHH  1273


 Score =   319 bits (818),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D+  G+ L +V G +E +DV FSYPSRPD  IF+DF++    GK+ A
Sbjct  359  LMEIIQQKPSIIQDLSDGKCLPEVHGNLEFKDVTFSYPSRPDVIIFRDFSLSFPAGKTTA  418

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+ LI RFYDP  G++++D  DIK L+LK LR+ IGLV QEPALFAT+I
Sbjct  419  VVGGSGSGKSTVVVLIERFYDPNQGQILLDNVDIKTLQLKWLREQIGLVSQEPALFATTI  478

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK GAT +EV  AA  ANAH+FIS LP GY+T+ GERGVQLSGGQKQR+AIARA
Sbjct  479  LENILYGKPGATIAEVEAAASAANAHNFISLLPNGYNTQAGERGVQLSGGQKQRIAIARA  538

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  539  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDMIAVIQQG  598

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +I+E GTH  L+ +   GAY  LI  Q+
Sbjct  599  QIVETGTHEELLAKGTSGAYASLIRFQE  626



>dbj|BAF02132.1| putative ABC transporter [Arabidopsis thaliana]
Length=804

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 219/279 (78%), Gaps = 6/279 (2%)
 Frame = -2

Query  895  QMVASVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVR  725
            Q + SVFE+LDRKTEI  D  +      ++ G +EL+ ++FSYPSRPD  IF+D ++R R
Sbjct  509  QAMRSVFELLDRKTEIEPDDPDTTPVPDRLRGEVELKHIDFSYPSRPDIQIFRDLSLRAR  568

Query  724  PGKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPA  545
             GK++ALVG SG GKSSVISLI RFY+P SG+VMIDGKDI+   LK++RKHI +V QEP 
Sbjct  569  AGKTLALVGPSGCGKSSVISLIQRFYEPSSGRVMIDGKDIRKYNLKAIRKHIAIVPQEPC  628

Query  544  LFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQR  365
            LF T+IYENI YG E ATE+E+I+AA LA+AH FISALPEGY T VGERGVQLSGGQKQR
Sbjct  629  LFGTTIYENIAYGHECATEAEIIQAATLASAHKFISALPEGYKTYVGERGVQLSGGQKQR  688

Query  364  VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
            +AIARA+++  EI+LLDEATSALD ESER VQ+ALD+    RTS+VVAHRLSTI+NA  I
Sbjct  689  IAIARALVRKAEIMLLDEATSALDAESERSVQEALDQACSGRTSIVVAHRLSTIRNAHVI  748

Query  184  CVLQDGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             V+ DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  749  AVIDDGKVAEQGSHSHLLKNHPDGIYARMIQLQRFTHTQ  787


 Score =   170 bits (430),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -2

Query  460  ANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESE  281
            ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP ILLLDEATSALD ESE
Sbjct  1    ANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESE  60

Query  280  RIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLI-ENRDGAYYK  104
            ++VQ+ALDR M  RT++++AHRLSTI+ AD + VLQ G + E GTH  L  +  +G Y K
Sbjct  61   KLVQEALDRFMIGRTTLIIAHRLSTIRKADLVAVLQQGSVSEIGTHDELFSKGENGVYAK  120

Query  103  LINLQQ  86
            LI +Q+
Sbjct  121  LIKMQE  126



>ref|XP_010266821.1| PREDICTED: ABC transporter B family member 13-like [Nelumbo nucifera]
Length=1248

 Score =   367 bits (941),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 216/271 (80%), Gaps = 2/271 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q + SVF +L R+T I A+    E + +V G IE R+V F YP+RPD  +  DFN++V  
Sbjct  972   QALGSVFNILQRETAIDANSSTSEAVTQVNGLIEFRNVSFKYPTRPDILVLDDFNLQVPS  1031

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S+ALVGQSGSGKSSVISLILRFYDPISG ++IDG+DI+ L LK LR  +GLVQQEPAL
Sbjct  1032  GCSLALVGQSGSGKSSVISLILRFYDPISGVILIDGRDIRGLNLKGLRMKMGLVQQEPAL  1091

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F+T+IYENI YGKE A+E E++ AAK ANAH FIS +P+GY T VGERG+QLSGGQKQRV
Sbjct  1092  FSTTIYENIKYGKENASEIEIMNAAKAANAHGFISRMPDGYQTHVGERGIQLSGGQKQRV  1151

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARA+LK+P ILLLDEATSALD  SER+VQ+ALDRLM+ RT+++VAHRLSTI NAD I 
Sbjct  1152  AIARAILKDPAILLLDEATSALDTASERVVQEALDRLMEGRTTILVAHRLSTIHNADNIA  1211

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQ  89
             VL+ GK++E G+H TLI   D  Y +LIN+Q
Sbjct  1212  VLKHGKVVETGSHETLILRPDSVYAQLINIQ  1242


 Score =   317 bits (813),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 200/253 (79%), Gaps = 2/253 (1%)
 Frame = -2

Query  841  DVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISL  662
            D G  L  V G IE  +V FSYPSRP+  +F+D +  +  G++ ALVGQSGSGKS++IS+
Sbjct  361  DNGIILPDVSGKIEFSEVSFSYPSRPN-KVFEDLSFTIHAGQNFALVGQSGSGKSTIISM  419

Query  661  ILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESE  482
            + RFYDP SGK+++DG D+K+L+LK LRK +GLV QEPALFA SI  NI+YGK  A   +
Sbjct  420  MERFYDPTSGKILLDGHDLKSLQLKWLRKQMGLVNQEPALFAMSIAGNIMYGKVDAEMEQ  479

Query  481  VIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATS  302
            +IEA+K ANAHSFI  LP+GY T+VGE G QLSGGQKQR++IARAVL+NP+ILLLDEATS
Sbjct  480  IIEASKAANAHSFIQGLPDGYHTQVGEGGAQLSGGQKQRISIARAVLRNPKILLLDEATS  539

Query  301  ALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLI-EN  125
            ALD ESE IVQQAL+++M  RT+++VAHRLSTI++ ++I VL++GKI+E GTH  L+ + 
Sbjct  540  ALDTESELIVQQALNKIMSERTTIIVAHRLSTIRDVNKIIVLKNGKIVESGTHIELMSKG  599

Query  124  RDGAYYKLINLQQ  86
             DG Y  L+NLQ+
Sbjct  600  ADGEYANLVNLQK  612



>gb|EAZ32166.1| hypothetical protein OsJ_16371 [Oryza sativa Japonica Group]
Length=1213

 Score =   366 bits (939),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 215/271 (79%), Gaps = 2/271 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  V G IELR V+F+YP+RPD  IFKDFN++++ G+
Sbjct  942   IRSIFGILNRATRIEPDDPESERVTNVRGDIELRHVDFAYPARPDIQIFKDFNLKIQAGR  1001

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LK+LR  IGLVQQEP LFA
Sbjct  1002  SQALVGASGSGKSTVIALIERFYDPTGGKVTIDGKDIRRLNLKALRLKIGLVQQEPVLFA  1061

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YGK+GATE EVI+AAK AN H F+S LP GY T VGERGVQLSGGQKQR+AI
Sbjct  1062  ASILENIAYGKDGATEEEVIQAAKTANVHGFVSQLPNGYKTAVGERGVQLSGGQKQRIAI  1121

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1122  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1181

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
             QDG+I+E G+HS L+   +GAY +L+ LQ H
Sbjct  1182  QDGRIVEHGSHSDLVSRPEGAYSRLLQLQHH  1212


 Score =   331 bits (849),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/272 (61%), Positives = 207/272 (76%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++     K++A
Sbjct  298  LLEVIRQKPSIVHDHKDGKLLAEVHGNIEFKDVTFSYPSRPDVMIFRDFSLFFPAAKTVA  357

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  358  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  417

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            +ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  418  HENILYGKPDATMAEVEAAATASNAHSFISTLPNGYNTMVGERGIQLSGGQKQRIAIARA  477

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  478  MLKNPKILLLDEATSALDAGSENIVQEALDRLMTGRTTVVVAHRLSTIRNVNMIAVIQQG  537

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
            +++E GTH  L+ +   GAY  LI  Q+  Q 
Sbjct  538  QVVETGTHDELLAKGSSGAYASLIRFQEMAQN  569



>emb|CAD59582.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 emb|CAD41854.2| OSJNBb0079B02.13 [Oryza sativa Japonica Group]
 emb|CAE05967.2| OSJNBa0063C18.8 [Oryza sativa Japonica Group]
Length=1268

 Score =   366 bits (939),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 215/271 (79%), Gaps = 2/271 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  V G IELR V+F+YP+RPD  IFKDFN++++ G+
Sbjct  997   IRSIFGILNRATRIEPDDPESERVTNVRGDIELRHVDFAYPARPDIQIFKDFNLKIQAGR  1056

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LK+LR  IGLVQQEP LFA
Sbjct  1057  SQALVGASGSGKSTVIALIERFYDPTGGKVTIDGKDIRRLNLKALRLKIGLVQQEPVLFA  1116

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YGK+GATE EVI+AAK AN H F+S LP GY T VGERGVQLSGGQKQR+AI
Sbjct  1117  ASILENIAYGKDGATEEEVIQAAKTANVHGFVSQLPNGYKTAVGERGVQLSGGQKQRIAI  1176

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1177  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1236

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
             QDG+I+E G+HS L+   +GAY +L+ LQ H
Sbjct  1237  QDGRIVEHGSHSDLVSRPEGAYSRLLQLQHH  1267


 Score =   332 bits (850),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/272 (61%), Positives = 207/272 (76%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++     K++A
Sbjct  353  LLEVIRQKPSIVHDHKDGKLLAEVHGNIEFKDVTFSYPSRPDVMIFRDFSLFFPAAKTVA  412

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  413  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  472

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            +ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  473  HENILYGKPDATMAEVEAAATASNAHSFISTLPNGYNTMVGERGIQLSGGQKQRIAIARA  532

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  533  MLKNPKILLLDEATSALDAGSENIVQEALDRLMTGRTTVVVAHRLSTIRNVNMIAVIQQG  592

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
            +++E GTH  L+ +   GAY  LI  Q+  Q 
Sbjct  593  QVVETGTHDELLAKGSSGAYASLIRFQEMAQN  624



>ref|XP_006431131.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
 gb|ESR44371.1| hypothetical protein CICLE_v10010931mg [Citrus clementina]
Length=1252

 Score =   365 bits (938),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 220/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF +LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDFN+R+R G+
Sbjct  980   VGSVFSILDRSTRIDPDDPDAEPVETIRGEIELRHVDFAYPSRPDVVVFKDFNLRIRAGQ  1039

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPALFA
Sbjct  1040  SQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFA  1099

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI++NI YGKEGATE+EV+EAA+ AN H F+SALP  Y T VGERGVQLSGGQKQR+AI
Sbjct  1100  ASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYKTPVGERGVQLSGGQKQRIAI  1159

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1160  ARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIGVV  1219

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+EQG+HS L+   DGAY +L+ LQ H 
Sbjct  1220  QDGRIVEQGSHSELVSRPDGAYSRLLQLQHHH  1251


 Score =   319 bits (817),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  338  LMEIIKQKPSIIQDPTNGRCLDEVNGNIEFKNVTFSYPSRPDVIIFRDFSIYFPAGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNAGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GYST+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPEATMAEVEAAASAANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D + V+Q G
Sbjct  518  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTVAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KAGAYASLIRFQE  603



>ref|XP_008369562.1| PREDICTED: ABC transporter B family member 1-like [Malus domestica]
Length=1346

 Score =   367 bits (941),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 220/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVFE+LDRKTEI  D  +  +   ++ G IEL+ V+F+YP+RPD PIF+D ++R R GK+
Sbjct  1049  SVFELLDRKTEIEPDDPDATVVTDRLRGEIELKHVDFTYPTRPDVPIFRDLSLRARAGKT  1108

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+V+IDGKDI+   LKSLR+HI LV QEP LFAT
Sbjct  1109  LALVGPSGCGKSSVIALIQRFYDPTSGRVLIDGKDIRKYNLKSLRRHIALVPQEPCLFAT  1168

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1169  TIYENIAYGHEPATEAEIIEAANLANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1228

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESER +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1229  RALLRKAEVMLLDEATSALDAESERSIQEALERACSGKTTIVVAHRLSTIRNAHVIAVID  1288

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1289  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1323


 Score =   324 bits (830),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 206/266 (77%), Gaps = 5/266 (2%)
 Frame = -2

Query  868  LDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSG  689
            +DR +E     G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++ALVG SG
Sbjct  406  MDRNSE----AGVELESVTGLVELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSG  461

Query  688  SGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILY  509
            SGKS+V+SLI RFYDP SG+V++DG DIK LKLK LR+ IGLV QEPALFAT+I ENIL 
Sbjct  462  SGKSTVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILL  521

Query  508  GKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPE  329
            G+  A + E+ EAA++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP 
Sbjct  522  GRPDADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPA  581

Query  328  ILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQG  149
            ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G + E G
Sbjct  582  ILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIG  641

Query  148  THSTL-IENRDGAYYKLINLQQHQQQ  74
            TH  L ++  +G Y KLI +Q+   +
Sbjct  642  THDELFLKGENGVYAKLIRMQEMAHE  667



>emb|CAC09461.2| H0423H10.7 [Oryza sativa Indica Group]
 gb|EAY95758.1| hypothetical protein OsI_17633 [Oryza sativa Indica Group]
Length=1269

 Score =   366 bits (939),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 215/271 (79%), Gaps = 2/271 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  V G IELR V+F+YP+RPD  IFKDFN++++ G+
Sbjct  998   IRSIFGILNRATRIEPDDPESERVTNVRGDIELRHVDFAYPARPDIQIFKDFNLKIQAGR  1057

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LK+LR  IGLVQQEP LFA
Sbjct  1058  SQALVGASGSGKSTVIALIERFYDPTGGKVTIDGKDIRRLNLKALRLKIGLVQQEPVLFA  1117

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YGK+GATE EVI+AAK AN H F+S LP GY T VGERGVQLSGGQKQR+AI
Sbjct  1118  ASILENIAYGKDGATEEEVIQAAKTANVHGFVSQLPNGYKTAVGERGVQLSGGQKQRIAI  1177

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1178  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1237

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQH  83
             QDG+I+E G+HS L+   +GAY +L+ LQ H
Sbjct  1238  QDGRIVEHGSHSDLVSRPEGAYSRLLQLQHH  1268


 Score =   332 bits (850),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/272 (61%), Positives = 207/272 (76%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE +DV FSYPSRPD  IF+DF++     K++A
Sbjct  354  LLEVIRQKPSIIHDHKDGKLLAEVHGNIEFKDVTFSYPSRPDVMIFRDFSLFFPAAKTVA  413

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  414  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  473

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
            +ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T VGERG+QLSGGQKQR+AIARA
Sbjct  474  HENILYGKPDATMAEVEAAATASNAHSFISTLPNGYNTMVGERGIQLSGGQKQRIAIARA  533

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  534  MLKNPKILLLDEATSALDAGSENIVQEALDRLMTGRTTVVVAHRLSTIRNVNMIAVIQQG  593

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
            +++E GTH  L+ +   GAY  LI  Q+  Q 
Sbjct  594  QVVETGTHDELLAKGSSGAYASLIRFQEMAQN  625



>ref|XP_004977001.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1264

 Score =   365 bits (938),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 216/272 (79%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  + G IELR V+F+YP+RPD  IFKDFN+++  G+
Sbjct  992   IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFAYPARPDIQIFKDFNLKIHAGR  1051

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1052  SQALVGASGSGKSTVIALIERFYDPTGGKVSIDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1111

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI ENI YGK+GATE EVIEAAK AN H F+S LP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1112  ASILENIAYGKDGATEEEVIEAAKTANVHGFVSQLPDGYKTAVGERGVQLSGGQKQRIAI  1171

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1172  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1231

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+E G+H+ L+   +GAY +L+ LQ H+
Sbjct  1232  QDGRIVEHGSHNELLTRPEGAYSRLLQLQHHR  1263


 Score =   316 bits (810),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  348  LLEIIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVMIFRDFSLFFPAGKTVA  407

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  408  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  467

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T VGERG QLSGGQKQR+AIARA
Sbjct  468  LENILYGKPDATVAEVEAAATASNAHSFISLLPNGYNTMVGERGTQLSGGQKQRIAIARA  527

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  528  MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  587

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  L+  Q+
Sbjct  588  QVVETGTHDELLAKGSTGAYASLVRFQE  615



>ref|XP_007204682.1| hypothetical protein PRUPE_ppa000269mg [Prunus persica]
 gb|EMJ05881.1| hypothetical protein PRUPE_ppa000269mg [Prunus persica]
Length=1371

 Score =   367 bits (941),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 220/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTEI  D  +  +   ++ G +EL+ V+FSYP+RPD P+F+D ++R R GK+
Sbjct  1074  SVFDLLDRKTEIEPDDPDATVVPDRLRGEVELKHVDFSYPTRPDVPVFRDLSLRARAGKT  1133

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+VM+DGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1134  LALVGPSGCGKSSVIALIQRFYDPTSGRVMVDGKDIRKYNLKSLRRHIAVVPQEPCLFAT  1193

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA +ANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1194  TIYENIAYGHESATEAEIIEAANMANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1253

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESER +Q+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1254  RALLRKAELMLLDEATSALDAESERSIQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1313

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1314  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1348


 Score =   323 bits (827),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 210/272 (77%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F+++D K  +   ++ G EL  V G +EL++V+F+YPSR D  I  +F++ V  GK++A
Sbjct  421  IFKIIDHKPGMDRNSEAGLELESVTGLVELKNVDFAYPSRQDVRILNNFSLNVPAGKTIA  480

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP SG+V++DG DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  481  LVGSSGSGKSTVVSLIERFYDPSSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTI  540

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + E+ EAA++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  541  KENILLGRPDADQVEIEEAARVANAHSFIVKLPDGFDTQVGERGLQLSGGQKQRIAIARA  600

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  601  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  660

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
             + E G H  LI +  +G Y KLI +Q+   +
Sbjct  661  TVSEIGAHDELISKGENGVYAKLIRMQEMAHE  692



>ref|XP_008668793.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 tpg|DAA35746.1| TPA: hypothetical protein ZEAMMB73_634725 [Zea mays]
Length=1266

 Score =   365 bits (937),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 218/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             + S+F +L+R T I  D    E +  + G IELR V+FSYP+RPD  IFKDFN++++ G+
Sbjct  994   IRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVDFSYPARPDIQIFKDFNLKIQAGR  1053

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP  GKV IDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  1054  SQALVGASGSGKSTVIALIERFYDPCGGKVAIDGKDIRTLNLKSLRLKIGLVQQEPVLFA  1113

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +SI ENI YGKEGA+E EV+EAAK AN H F+S LP+GY T VGE+G+QLSGGQKQR+AI
Sbjct  1114  SSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPDGYRTAVGEQGMQLSGGQKQRIAI  1173

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D+I V+
Sbjct  1174  ARAVLKDPAILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDRIAVV  1233

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+++E G+HS L+   +GAY +L+ LQ H+
Sbjct  1234  QDGRVVEHGSHSDLLARPEGAYLRLLQLQHHR  1265


 Score =   328 bits (841),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ +K  I+ D   G+ L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  350  LLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDFSLFFPAGKTVA  409

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V++LI RFYDP  G+V++D  DIK L+L+ LR+ IGLV QEPALFAT+I
Sbjct  410  VVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLREQIGLVNQEPALFATTI  469

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  +NAHSFIS LP GY+T  GERG+QLSGGQKQR+AIARA
Sbjct  470  LENILYGKPDATIAEVEAAATASNAHSFISLLPNGYNTMAGERGIQLSGGQKQRIAIARA  529

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD +SE IVQ+ALDRLM  RT+VVVAHRLSTI+N + I V+Q G
Sbjct  530  MLKNPKILLLDEATSALDADSESIVQEALDRLMVGRTTVVVAHRLSTIRNVNMIAVIQQG  589

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  LI +   GAY  L+  Q+
Sbjct  590  QVVETGTHDELIAKGTSGAYASLVRFQE  617



>ref|XP_001779184.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
 gb|EDQ56030.1| ATP-binding cassette transporter, subfamily B, member 16, group 
MDR/PGP protein PpABCB16 [Physcomitrella patens]
Length=1284

 Score =   365 bits (938),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI--KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q +ASVF +LDR TEI AD     +   V G IE++ V F+YP+RPD  IFKD N++VR 
Sbjct  1011  QALASVFALLDRPTEIDADDPNAQVVETVSGNIEIKHVAFTYPNRPDVQIFKDLNLKVRA  1070

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             GKS+ALVG SGSGKSSVI+L+ RFYDP SG++ IDG DIK L LKSLR+ + LV QEPAL
Sbjct  1071  GKSLALVGASGSGKSSVIALLERFYDPTSGRIFIDGTDIKKLNLKSLRRRMALVSQEPAL  1130

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FAT+IYENILYG+E ATE EV  AA  ANAH+FIS LP  Y+T+VGERG+QLSGGQKQRV
Sbjct  1131  FATTIYENILYGRESATEQEVHAAAMAANAHNFISGLPNSYNTQVGERGIQLSGGQKQRV  1190

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE+IVQ+ALDRLM+ RTSVVVAHRL+TI+NAD I 
Sbjct  1191  AIARAVLKDPAILLLDEATSALDAESEQIVQEALDRLMQRRTSVVVAHRLTTIRNADSIA  1250

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG ++E+GTH+ L+  +DGAY  L+ LQQ  
Sbjct  1251  VIQDGTVVEEGTHNDLVAKKDGAYAGLVRLQQRH  1284


 Score =   337 bits (865),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/270 (61%), Positives = 213/270 (79%), Gaps = 3/270 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D++  I  +    +EL  V G IE R+V+FSYPSRPD  IF++F++ +   K++A
Sbjct  379  IFTMIDQQPTINVESPGAKELSSVHGRIEFRNVQFSYPSRPDVVIFRNFSLDIPASKTVA  438

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++DG +IK+L LK LR  IGLV QEPALFATSI
Sbjct  439  IVGGSGSGKSTVVSLIERFYDPNEGEVLLDGTNIKSLNLKWLRGQIGLVNQEPALFATSI  498

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK GA++ E+ EA K ANAH+FIS  P GY+T+VGERG+Q+SGGQKQR+AIARA
Sbjct  499  KENILYGKPGASDKEIEEACKSANAHTFISQFPGGYNTQVGERGIQMSGGQKQRIAIARA  558

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD  SE+IVQ+ALD +M  RT+VVVAHRLSTI+ AD I V+Q+G
Sbjct  559  ILKNPVILLLDEATSALDASSEQIVQKALDTVMIGRTTVVVAHRLSTIQQADTIAVVQEG  618

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
             I+E G H+TL+E +DGAY  L+ LQ+  Q
Sbjct  619  VIVEMGNHATLLE-KDGAYTSLVRLQEMAQ  647



>ref|XP_009339155.1| PREDICTED: ABC transporter B family member 1 [Pyrus x bretschneideri]
Length=1345

 Score =   366 bits (939),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 220/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVFE+LDRKTEI  D  +  +   ++ G IEL+ V+F+YP+RPD P+F+D ++R R GK+
Sbjct  1048  SVFELLDRKTEIEPDDPDATVVTDRLRGEIELKHVDFTYPTRPDVPVFRDLSLRARAGKT  1107

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+V+IDGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1108  LALVGPSGCGKSSVIALIQRFYDPTSGRVLIDGKDIRKYNLKSLRRHIAVVPQEPCLFAT  1167

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1168  TIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1227

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESER +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1228  RALLRKAEVMLLDEATSALDAESERSIQEALERACSGKTTIVVAHRLSTIRNAHVIAVID  1287

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1288  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1322


 Score =   322 bits (826),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 204/266 (77%), Gaps = 5/266 (2%)
 Frame = -2

Query  868  LDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSG  689
            +DR +E     G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++ALVG SG
Sbjct  405  MDRNSE----AGVELESVTGLVELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSG  460

Query  688  SGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILY  509
            SGKS+V+SLI RFYDP SG+V++DG DIK L LK LR+ IGLV QEPALFAT+I ENIL 
Sbjct  461  SGKSTVVSLIERFYDPSSGQVLLDGHDIKTLNLKWLRQQIGLVSQEPALFATTIKENILL  520

Query  508  GKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPE  329
            G+  A + E+ EAA++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP 
Sbjct  521  GRPDADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPA  580

Query  328  ILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQG  149
            ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G + E G
Sbjct  581  ILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIG  640

Query  148  THSTLI-ENRDGAYYKLINLQQHQQQ  74
            TH  L  +  +G Y KLI +Q+   +
Sbjct  641  THDELFSKGENGVYAKLIRMQEMAHE  666



>ref|XP_008387548.1| PREDICTED: ABC transporter B family member 1 [Malus domestica]
Length=1354

 Score =   366 bits (939),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 219/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVFE+LDRKTEI  D  +  +   ++ G IEL+ V+F+YPSRPD PIF+D ++R R GK+
Sbjct  1057  SVFELLDRKTEIEPDDPDATVVPDRLRGEIELKHVDFTYPSRPDVPIFRDLSLRARAGKT  1116

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+VMIDGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1117  LALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKSLRRHIAVVPQEPCLFAT  1176

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1177  TIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1236

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESE  +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1237  RALLRKAEVMLLDEATSALDAESESSIQEALERACSGKTTIVVAHRLSTIRNAHVIAVID  1296

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1297  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1331


 Score =   321 bits (823),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 205/266 (77%), Gaps = 5/266 (2%)
 Frame = -2

Query  868  LDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSG  689
            +DR +E     G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++ALVG SG
Sbjct  414  MDRNSE----AGIELESVTGLVELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSG  469

Query  688  SGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILY  509
            SGKS+V+SLI RFYDP SG+V++DG DI+ LKLK LR+ IGLV QEPALFAT+I ENIL 
Sbjct  470  SGKSTVVSLIERFYDPSSGQVLLDGHDIRTLKLKWLRQQIGLVSQEPALFATTIKENILL  529

Query  508  GKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPE  329
            G+  A + E+ EA+++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP 
Sbjct  530  GRPDADQVEIEEASRVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPA  589

Query  328  ILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQG  149
            ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G + E G
Sbjct  590  ILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIG  649

Query  148  THSTLI-ENRDGAYYKLINLQQHQQQ  74
            TH  L  +  +G Y KLI +Q+   +
Sbjct  650  THDELFSKGENGVYAKLIRMQEMAHE  675



>ref|XP_006482578.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1252

 Score =   365 bits (936),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF  LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDFN+R+R G+
Sbjct  980   VGSVFSTLDRSTRIDPDDPDAEPVETIRGEIELRHVDFAYPSRPDVVVFKDFNLRIRAGQ  1039

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPALFA
Sbjct  1040  SQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFA  1099

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI++NI YGKEGATE+EV+EAA+ AN H F+SALP  Y T VGERGVQLSGGQKQR+AI
Sbjct  1100  ASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYKTPVGERGVQLSGGQKQRIAI  1159

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1160  ARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIGVV  1219

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+EQG+HS L+   DGAY +L+ LQ H 
Sbjct  1220  QDGRIVEQGSHSELVSRPDGAYSRLLQLQHHH  1251


 Score =   318 bits (816),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  338  LMEIIKQKPSIIQDPTNGRCLDEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNAGHVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GYST+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPEATMAEVEAAASAANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D + V+Q G
Sbjct  518  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTVAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            ++IE GTH  LI  + GAY  LI  Q+
Sbjct  578  QVIETGTHEELIA-KAGAYASLIRFQE  603



>gb|KDO72551.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=1252

 Score =   365 bits (936),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF  LDR T I  D    E +  + G IELR V+F+YPSRPD  +FKDFN+R+R G+
Sbjct  980   VGSVFSTLDRSTRIDPDDPDAEPVETIRGEIELRHVDFAYPSRPDVVVFKDFNLRIRAGQ  1039

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKSSVI+LI RFYDP +GKVMIDGKDI+ L LKSLR  IGLVQQEPALFA
Sbjct  1040  SQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFA  1099

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
              SI++NI YGKEGATE+EV+EAA+ AN H F+SALP  Y T VGERGVQLSGGQKQR+AI
Sbjct  1100  ASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYKTPVGERGVQLSGGQKQRIAI  1159

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLKNP ILLLDEATSALD ESE ++Q+AL+RLM+ RT+V+VAHRLSTI+  D I V+
Sbjct  1160  ARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIGVV  1219

Query  175   QDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             QDG+I+EQG+HS L+   DGAY +L+ LQ H 
Sbjct  1220  QDGRIVEQGSHSELVSRPDGAYSRLLQLQHHH  1251


 Score =   318 bits (814),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G  L +V G IE ++V FSYPSRPD  IF+DF++    GK++A
Sbjct  338  LMEIIKQKPSIIQDPTNGRCLDEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVA  397

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP +G V++D  DIK L+L+ LR  IGLV QEPALFAT+I
Sbjct  398  VVGGSGSGKSTVVSLIERFYDPNAGHVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTI  457

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT +EV  AA  ANAHSFI+ LP GYST+VGERGVQLSGGQKQR+AIARA
Sbjct  458  LENILYGKPEATMAEVEAAASAANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARA  517

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+VVVAHRLSTI+N D + V+Q G
Sbjct  518  MLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTVAVIQQG  577

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  578  QVVETGTHEELIA-KAGAYASLIRFQE  603



>ref|XP_009339152.1| PREDICTED: ABC transporter B family member 1-like [Pyrus x bretschneideri]
Length=1345

 Score =   366 bits (939),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 220/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVFE+LDRKTEI  D  +  +   ++ G IEL+ V+F+YP+RPD P+F+D ++R R GK+
Sbjct  1048  SVFELLDRKTEIEPDDPDATVVTDRLRGEIELKHVDFTYPTRPDVPVFRDLSLRARAGKT  1107

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+V+IDGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1108  LALVGPSGCGKSSVIALIQRFYDPTSGRVLIDGKDIRKYNLKSLRRHIAVVPQEPCLFAT  1167

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1168  TIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1227

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESER +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1228  RALLRKAEVMLLDEATSALDAESERSIQEALERACSGKTTIVVAHRLSTIRNAHVIAVID  1287

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1288  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1322


 Score =   322 bits (825),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 204/266 (77%), Gaps = 5/266 (2%)
 Frame = -2

Query  868  LDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSG  689
            +DR +E     G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++ALVG SG
Sbjct  405  MDRNSE----AGVELESVTGLVELKNVDFSYPSRQDVRILNNFSLNVPAGKTIALVGSSG  460

Query  688  SGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILY  509
            SGKS+V+SLI RFYDP SG+V++DG DIK L LK LR+ IGLV QEPALFAT+I ENIL 
Sbjct  461  SGKSTVVSLIERFYDPSSGQVLLDGHDIKTLNLKWLRQQIGLVSQEPALFATTIKENILL  520

Query  508  GKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPE  329
            G+  A + E+ EAA++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP 
Sbjct  521  GRPDADQVEIEEAARVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPA  580

Query  328  ILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQG  149
            ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G + E G
Sbjct  581  ILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIG  640

Query  148  THSTLI-ENRDGAYYKLINLQQHQQQ  74
            TH  L  +  +G Y KLI +Q+   +
Sbjct  641  THDELFSKGENGVYAKLIRMQEMAHE  666



>ref|XP_008341564.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Malus domestica]
Length=1250

 Score =   364 bits (935),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGE-ELIK-VEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             + V SVF +LDR+T I  D  E E+++ V G IELR V+F+YPSRPD  +FKDF++R+R 
Sbjct  976   EAVGSVFSILDRQTRIDPDDPEAEVVESVRGEIELRHVDFAYPSRPDIMVFKDFSLRIRT  1035

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G S ALVG SGSGKSSVI+LI RFYDP+ GKVMIDGKDI+ L LKSLR  IGLVQQEPAL
Sbjct  1036  GHSQALVGXSGSGKSSVIALIERFYDPLVGKVMIDGKDIRRLNLKSLRLKIGLVQQEPAL  1095

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             FA SI+ENI YGKEGATE+EVIEAA+ AN H F+S LP+GY T VGERGVQLSGGQKQR+
Sbjct  1096  FAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPVGERGVQLSGGQKQRI  1155

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLK+P ILLLDEATSALD ESE ++Q+AL+RLMK RT+V+VAHRLSTI+  D I 
Sbjct  1156  AIARAVLKDPRILLLDEATSALDAESECVLQEALERLMKGRTTVLVAHRLSTIRGVDSIG  1215

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQHQ  80
             V+QDG+I+E G+HS L+   DGAY +L+ LQ H 
Sbjct  1216  VVQDGRIVEHGSHSELVSRPDGAYSRLLQLQNHH  1249


 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 206/267 (77%), Gaps = 3/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + E++ +K  I+ D   G+ L  V G IE ++V FSYPSRPD  IF++F++    GK++A
Sbjct  336  LMEIIKQKPTIVQDPLEGKCLSDVSGNIEFKEVTFSYPSRPDVIIFRNFSIFFPAGKTVA  395

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V+ID  DIK L+LK LR  IGLV QEPALFAT+I
Sbjct  396  VVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQLKWLRDQIGLVNQEPALFATTI  455

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYGK  AT  +V  AA  ANAHSFI+ LP+GY+T+VGERGVQLSGGQKQR+AIARA
Sbjct  456  LENILYGKPDATMEDVEVAASSANAHSFITLLPKGYNTQVGERGVQLSGGQKQRIAIARA  515

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDRLM  RT+V+VAHRLSTI+N D I V+Q G
Sbjct  516  MLKNPKILLLDEATSALDASSESIVQEALDRLMVGRTTVIVAHRLSTIRNVDSIAVIQQG  575

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +++E GTH  LI  + GAY  LI  Q+
Sbjct  576  QVVETGTHEELIA-KAGAYASLIRFQE  601



>ref|XP_002994484.1| hypothetical protein SELMODRAFT_138662 [Selaginella moellendorffii]
 gb|EFJ04453.1| hypothetical protein SELMODRAFT_138662 [Selaginella moellendorffii]
Length=1224

 Score =   364 bits (934),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/267 (68%), Positives = 221/267 (83%), Gaps = 3/267 (1%)
 Frame = -2

Query  883   SVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
             SVFE+LDR TE+  D    ++LIK+ G IELRD+ F+YPSRP+  IF   N+++R G+S+
Sbjct  956   SVFELLDRATEMDLDGPTSQKLIKLRGDIELRDIHFAYPSRPEVAIFAGLNLKIRAGRSL  1015

Query  709   ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
             ALVG SGSGKSSVI+L+ RFYDP  G V++DG+D+K L +K+ R+H+GLVQQEPALF TS
Sbjct  1016  ALVGPSGSGKSSVIALVERFYDPFKGMVLVDGRDVKKLNVKAYRRHVGLVQQEPALFGTS  1075

Query  529   IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
             I ENI YGKE A+E+E++ AAK ANAH FIS+LP+GY+T VGERGVQLSGGQKQRVAIAR
Sbjct  1076  ICENIAYGKESASEAEIVAAAKAANAHEFISSLPDGYATNVGERGVQLSGGQKQRVAIAR  1135

Query  349   AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
             AVLKNP ILLLDEATSALD ESER VQ+AL+RLM+ RT+VVVAHRLSTI +ADQI VL D
Sbjct  1136  AVLKNPAILLLDEATSALDAESERTVQEALERLMEERTTVVVAHRLSTICSADQIAVLHD  1195

Query  169   GKIIEQGTHSTLIENRDGAYYKLINLQ  89
             G+I+EQG HS L+  R GAY +LI LQ
Sbjct  1196  GEIVEQGRHSELVAKR-GAYAQLIKLQ  1221


 Score =   266 bits (680),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 181/269 (67%), Gaps = 30/269 (11%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEE----LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            + E LD K  I  +  E     L  V G +EL  V F+YPSRPD                
Sbjct  345  ILETLDNKNTI-TNCEESTEFCLQHVRGELELNKVTFNYPSRPD----------------  387

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
                      +S++ISLI RFYDP SG++++DG + K+L+LK LR  IGLV QEPALFAT
Sbjct  388  ---------ARSTIISLIERFYDPSSGEILLDGYNTKSLQLKWLRSQIGLVNQEPALFAT  438

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            +I +NILYGK+ A   E+  AA+ +NAH FI+ LP+GY T+VG RG+QLSGGQKQR+AIA
Sbjct  439  TIAQNILYGKDDANMEEIKLAARTSNAHDFINQLPQGYETQVGSRGLQLSGGQKQRIAIA  498

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA+++NP ILLLDEATSALD ESE +VQ A+D++M +RT+V++AHRL T+K  D I VLQ
Sbjct  499  RALVRNPAILLLDEATSALDAESENVVQDAVDKIMVARTTVIIAHRLCTLKGTDSIAVLQ  558

Query  172  DGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            +G+++E G+H  LI +    Y  L+ L++
Sbjct  559  NGRLVETGSHQQLIADEKSLYSGLVRLEE  587



>ref|XP_009377013.1| PREDICTED: ABC transporter B family member 1 [Pyrus x bretschneideri]
Length=1353

 Score =   365 bits (938),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 219/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVFE+LDRKTEI  D  +  +   ++ G IEL+ V+F+YP+RPD PIF+D ++R R GK+
Sbjct  1056  SVFELLDRKTEIEPDDPDATVVPDRLRGEIELKHVDFTYPTRPDVPIFRDLSLRARAGKT  1115

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+VMIDGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1116  LALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKSLRRHIAVVPQEPCLFAT  1175

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1176  TIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1235

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESE  +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1236  RALLRKAEVMLLDEATSALDAESESSIQEALERACSGKTTIVVAHRLSTIRNAHVIAVID  1295

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1296  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1330


 Score =   322 bits (825),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 205/266 (77%), Gaps = 5/266 (2%)
 Frame = -2

Query  868  LDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSG  689
            +DR +E     G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++ALVG SG
Sbjct  413  MDRYSE----AGMELESVTGLVELKNVDFSYPSRQDDRILNNFSLNVPAGKTIALVGSSG  468

Query  688  SGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILY  509
            SGKS+V+SLI RFYDP SG+V++DG DIK LKLK LR+ IGLV QEPALFAT+I ENIL 
Sbjct  469  SGKSTVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILL  528

Query  508  GKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPE  329
            G+  A + E+ EA+++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP 
Sbjct  529  GRPDADQVEIEEASRVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPA  588

Query  328  ILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQG  149
            ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G + E G
Sbjct  589  ILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIG  648

Query  148  THSTLI-ENRDGAYYKLINLQQHQQQ  74
            TH  L  +  +G Y KLI +Q+   +
Sbjct  649  THDELFSKGENGVYAKLIRMQEMAHE  674



>ref|XP_009376834.1| PREDICTED: ABC transporter B family member 1-like [Pyrus x bretschneideri]
Length=1353

 Score =   365 bits (938),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 219/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVFE+LDRKTEI  D  +  +   ++ G IEL+ V+F+YP+RPD PIF+D ++R R GK+
Sbjct  1056  SVFELLDRKTEIEPDDPDATVVPDRLRGEIELKHVDFTYPTRPDVPIFRDLSLRARAGKT  1115

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFYDP SG+VMIDGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1116  LALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKSLRRHIAVVPQEPCLFAT  1175

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FISALPEGY T VGERGVQLSGGQKQRVAIA
Sbjct  1176  TIYENIAYGHESATEAEIIEAANLANAHKFISALPEGYKTFVGERGVQLSGGQKQRVAIA  1235

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+L+  E++LLDEATSALD ESE  +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1236  RALLRKAEVMLLDEATSALDAESESSIQEALERACSGKTTIVVAHRLSTIRNAHVIAVID  1295

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1296  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHTQ  1330


 Score =   322 bits (826),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = -2

Query  868  LDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSG  689
            +DR +E     G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++ALVG SG
Sbjct  413  MDRNSE----AGMELESVTGLVELKNVDFSYPSRQDDRILNNFSLNVPAGKTIALVGSSG  468

Query  688  SGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILY  509
            SGKS+V+SLI RFYDP SG+V++DG DIK LKLK LR+ IGLV QEPALFAT+I ENIL 
Sbjct  469  SGKSTVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTIKENILL  528

Query  508  GKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPE  329
            G+  A + E+ EA+++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA+LKNP 
Sbjct  529  GRPDADQVEIEEASRVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPA  588

Query  328  ILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQG  149
            ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G + E G
Sbjct  589  ILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQGSVSEIG  648

Query  148  THSTLI-ENRDGAYYKLINLQQ  86
            TH  L  +  +G Y KLI +Q+
Sbjct  649  THDELFSKGENGVYAKLIRMQE  670



>ref|XP_001759716.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
 gb|EDQ75628.1| ATP-binding cassette transporter, subfamily B, member 26, group 
MDR/PGP protein PpABCB26 [Physcomitrella patens]
Length=1301

 Score =   364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/272 (67%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q ++SVF VLDR TEI AD    E +  V G I L+DV F+YP+RPD  IFKD N+ VR 
Sbjct  1026  QALSSVFYVLDRNTEIDADDPKAEVVQTVRGEIRLKDVTFAYPTRPDAVIFKDLNLMVRA  1085

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             GKS+ALVG SGSGKS+VI+L+ RFYDP+SG+V++DG+DI+ L LKSLR+ I LV QEP L
Sbjct  1086  GKSLALVGSSGSGKSTVIALLERFYDPLSGRVLVDGEDIRKLNLKSLRRRIALVSQEPTL  1145

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F T+IYENI YG+EGATE EV  AA  ANAH+FI+ALP+GY+T  GERGVQLSGGQKQR+
Sbjct  1146  FDTTIYENIAYGREGATEQEVQAAAMAANAHNFITALPDGYNTSAGERGVQLSGGQKQRI  1205

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARAVLKNP +LLLDEATSALD ESE+IVQ+ALDRL+K RTSV+VAHRLSTI+NA  I 
Sbjct  1206  AIARAVLKNPAVLLLDEATSALDAESEKIVQEALDRLLKGRTSVLVAHRLSTIRNAHTIA  1265

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             V+QDG ++E+G+H+TL+   DGAY  L+ LQ 
Sbjct  1266  VIQDGAVVEEGSHNTLLAIPDGAYANLVRLQN  1297


 Score =   340 bits (872),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 212/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  880  VFEVLDRKTEIL--ADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F++++++++I    D   +L  V+G IEL+ +EFSYPSRPD PIF+DF++ +  G ++A
Sbjct  397  IFKLIEQQSKIGVDTDTATKLASVQGLIELKHIEFSYPSRPDIPIFRDFSLTIPAGSTVA  456

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+VISLI RFY+P +G+V++DG +IK++ LK LR  IGLV QEPALFATSI
Sbjct  457  IVGGSGSGKSTVISLIERFYEPSAGEVLLDGVNIKHIDLKWLRSQIGLVNQEPALFATSI  516

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENILYG   AT+ EV +A + ANAHSFIS  P+GY+T+VGE GVQ+SGGQKQRVAIARA
Sbjct  517  KENILYGNPNATDQEVEDACRAANAHSFISKFPQGYNTQVGEHGVQMSGGQKQRVAIARA  576

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            ++KNP ILLLDEATSALD  SE+IVQ ALD +M  RT+VVVAHRLSTI+NAD I V+Q+G
Sbjct  577  IVKNPSILLLDEATSALDASSEQIVQAALDNVMVGRTTVVVAHRLSTIRNADAIAVVQNG  636

Query  166  KIIEQGTHSTLIENRDGAYYKLINLQQ  86
             I+E G H T+I   +GAY  L+ LQ+
Sbjct  637  VIVEMGDHETMITQENGAYAALVRLQE  663



>ref|XP_002969903.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29027.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1222

 Score =   362 bits (929),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 183/267 (69%), Positives = 220/267 (82%), Gaps = 3/267 (1%)
 Frame = -2

Query  883   SVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
             SVFE+LDR TEI  D     +LIK+ G IELRD+ F+YPSRP+  IF   N+++R G+S+
Sbjct  954   SVFELLDRATEIDLDGPRSRKLIKLRGDIELRDIHFAYPSRPEVAIFAGLNLKIRAGRSL  1013

Query  709   ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
             ALVG SGSGKSSVI+L+ RFYDP  G V++DG+D+K L +K+ R+H+GLVQQEPALF TS
Sbjct  1014  ALVGPSGSGKSSVIALVERFYDPFKGMVLVDGRDVKKLNVKAYRRHVGLVQQEPALFGTS  1073

Query  529   IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
             I ENI YGKE A+E+E++ AAK ANAH FIS+LP+GY+T VGERGVQLSGGQKQRVAIAR
Sbjct  1074  ICENIAYGKESASEAEIVAAAKAANAHEFISSLPDGYATNVGERGVQLSGGQKQRVAIAR  1133

Query  349   AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
             AVLKNP ILLLDEATSALD ESER VQ+AL+RLM+ RT+VVVAHRLSTI +ADQI VL D
Sbjct  1134  AVLKNPAILLLDEATSALDAESERTVQEALERLMEERTTVVVAHRLSTICSADQIAVLHD  1193

Query  169   GKIIEQGTHSTLIENRDGAYYKLINLQ  89
             G+I+EQG HS L+  R GAY +LI LQ
Sbjct  1194  GEIVEQGRHSELVAKR-GAYAQLIKLQ  1219


 Score =   308 bits (789),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 199/270 (74%), Gaps = 7/270 (3%)
 Frame = -2

Query  880  VFEVLDRKTEILADVGEE-----LIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            + E LD K  I     EE     L  V G +EL  V F+YPSRPD  I  D ++++ PGK
Sbjct  318  ILETLDDKNTI--SNSEESTEFCLQHVRGELELNKVTFNYPSRPDARILHDLSLKIPPGK  375

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S+ +VG SGSGKS++ISLI RFYDP SG++++DG + K+L+LK LR  IGLV QEPALFA
Sbjct  376  SIGIVGPSGSGKSTIISLIERFYDPTSGEILLDGYNTKSLQLKWLRLQIGLVNQEPALFA  435

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
            T+I +NILYGK+ A   E+  AA+ +NAH FI+ LP+GY T+VG RG+QLSGGQKQR+AI
Sbjct  436  TTIAQNILYGKDDANMEEIKLAARTSNAHDFINQLPQGYETQVGSRGLQLSGGQKQRIAI  495

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARA+++NP ILLLDEATSALD ESE +VQ ALD++M +RT+V++AHRL T+K  D I VL
Sbjct  496  ARALVRNPAILLLDEATSALDAESENVVQDALDKIMVARTTVIIAHRLCTVKGTDSIAVL  555

Query  175  QDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            Q+G+++E G+H  LI +    Y  L+ L++
Sbjct  556  QNGRLVETGSHQQLIADEKSVYSGLVRLEE  585



>gb|EMS56432.1| ABC transporter B family member 19 [Triticum urartu]
Length=1309

 Score =   363 bits (932),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 178/264 (67%), Positives = 215/264 (81%), Gaps = 2/264 (1%)
 Frame = -2

Query  889   VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
             V SVF VL+ +T I  D    E++ KV G IELR V+F+YPSRPD  +FK+F++R+R G+
Sbjct  913   VRSVFAVLNSRTRIDPDEPEAEQVEKVRGEIELRHVDFAYPSRPDVMVFKEFSLRIRAGQ  972

Query  715   SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
             S ALVG SGSGKS+VI+LI RFYDP++GKVMIDGKDI+ L LKSLR  IGLVQQEP LFA
Sbjct  973   SQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPVLFA  1032

Query  535   TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             TSI ENI YGK+G TE EV+EAAK+AN H F+SALP+GY T VGERGVQLSGGQKQR+AI
Sbjct  1033  TSILENIAYGKDGVTEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQLSGGQKQRIAI  1092

Query  355   ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
             ARAVLK+P ILLLDEATSALD ESE ++Q+AL R+MK RT+V+VAHRLSTI+  D I V+
Sbjct  1093  ARAVLKDPAILLLDEATSALDAESECVLQEALGRIMKGRTTVLVAHRLSTIRCVDSIAVV  1152

Query  175   QDGKIIEQGTHSTLIENRDGAYYK  104
             QDG+++EQG H  L+   DGAY +
Sbjct  1153  QDGRVLEQGGHGDLVARPDGAYSR  1176


 Score =   313 bits (801),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            + EV+ ++  I+ D   G  L +V G IE ++V FSYPSRPD  +F+DF++    GK+ A
Sbjct  267  LLEVIRQRPTIVQDSTDGRCLDEVHGNIEFKEVSFSYPSRPDVMVFRDFSLFFPAGKTAA  326

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            +VG SGSGKS+V+SLI RFYDP  G+V++D  DIK+L+LK LR  IGLV QEPALFAT+I
Sbjct  327  VVGGSGSGKSTVVSLIERFYDPNQGQVLLDNADIKSLQLKWLRDQIGLVNQEPALFATTI  386

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             +NILYGK  AT +EV  AA  ANAHSFI+ LP GY+T+VGERG+QLSGGQKQR+AIARA
Sbjct  387  IDNILYGKPDATMAEVEAAASAANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARA  446

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP+ILLLDEATSALD  SE IVQ+ALDR+M  RT+VVVAHRLSTI+N D I V+Q G
Sbjct  447  MLKNPKILLLDEATSALDAGSESIVQEALDRIMIGRTTVVVAHRLSTIRNVDMIAVIQQG  506

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
            +++E GTH  L+ +   GAY  LI  Q+
Sbjct  507  QVVETGTHDELLAKGSSGAYAALIRFQE  534



>gb|KHN09525.1| ABC transporter B family member 1 [Glycine soja]
Length=1342

 Score =   363 bits (933),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 221/279 (79%), Gaps = 6/279 (2%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVR  725
             Q + SVFE+LDR+TEI  D  +  +   ++ G +EL+ V+FSYP+RPD P+F+D ++R R
Sbjct  1043  QAMRSVFELLDRRTEIEPDDQDATLVPDRLRGEVELKHVDFSYPTRPDMPVFRDLSLRAR  1102

Query  724   PGKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPA  545
              GK++ALVG SG GKSSVI+LI RFYDP SG+VMIDGKDI+   LKSLR+HI +V QEP 
Sbjct  1103  AGKTLALVGPSGCGKSSVIALIQRFYDPTSGRVMIDGKDIRKYNLKSLRRHISVVPQEPC  1162

Query  544   LFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQR  365
             LFAT+IYENI YG E ATE+E+IEAA LANAH FIS LP+GY T VGERGVQLSGGQKQR
Sbjct  1163  LFATTIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVGERGVQLSGGQKQR  1222

Query  364   VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
             +A+ARA L+  E++LLDEATSALD ESER VQ+ALDR    +T+++VAHRLST++NA+ I
Sbjct  1223  IAVARAFLRKAELMLLDEATSALDAESERSVQEALDRASSGKTTIIVAHRLSTVRNANLI  1282

Query  184   CVLQDGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
              V+ DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1283  AVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQRFTHSQ  1321


 Score =   332 bits (850),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 210/270 (78%), Gaps = 3/270 (1%)
 Frame = -2

Query  886  ASVFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            A +F ++D K  I   ++ G EL  V G +EL++V+FSYPSRP+  I  DF++ V  GK+
Sbjct  392  AKIFRIIDHKPNIDRNSESGIELDTVTGLVELKNVDFSYPSRPEVQILNDFSLNVPAGKT  451

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
            +ALVG SGSGKS+V+SLI RFYDP SG+V++DG DIK LKL+ LR+ IGLV QEPALFAT
Sbjct  452  IALVGSSGSGKSTVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFAT  511

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            +I ENIL G+  A + E+ EAA++ANAHSFI  LP+GY T+VGERG+QLSGGQKQR+AIA
Sbjct  512  TIRENILLGRPDADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQRIAIA  571

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA+LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ
Sbjct  572  RAMLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQ  631

Query  172  DGKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             G + E GTH  L  +  +G Y KLI +Q+
Sbjct  632  LGSVSEIGTHDELFSKGENGVYAKLIKMQE  661



>ref|XP_002519488.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF42902.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1352

 Score =   363 bits (933),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 218/275 (79%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTEI  D  +      ++ G +EL+ V+FSYP+RPD PIF+D N+R R GK+
Sbjct  1056  SVFDLLDRKTEIEPDDADATAVPDRLRGEVELKHVDFSYPTRPDVPIFRDLNLRARAGKT  1115

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+L+ RFY+P SG+VMIDGKDI+   LKSLRKHI +V QEP LFAT
Sbjct  1116  LALVGPSGCGKSSVIALVQRFYEPSSGRVMIDGKDIRKYNLKSLRKHIAIVPQEPCLFAT  1175

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FIS LP+GY T VGERGVQLSGGQKQR+AIA
Sbjct  1176  TIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVGERGVQLSGGQKQRIAIA  1235

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1236  RALVRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1295

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+H+ L++N  DG Y ++I LQ+  H Q
Sbjct  1296  DGKVAEQGSHTHLLKNYPDGCYARMIQLQRFTHSQ  1330


 Score =   330 bits (847),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 208/268 (78%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D K  +   ++ G +L  V G +EL++V+FSYPSRPD  I  +F + V  GK++A
Sbjct  403  IFRIIDHKPAVDRNSESGLKLDSVTGLVELKNVDFSYPSRPDVKILNNFTLNVPAGKTIA  462

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP SG+V++DG DIK L L+ LR+ IGLV QEPALFAT+I
Sbjct  463  LVGSSGSGKSTVVSLIERFYDPNSGQVLLDGHDIKTLDLRWLRQQIGLVSQEPALFATTI  522

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + E+ EAA++ANAHSFI+ LPEG+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  523  KENILLGRPDADQIEIEEAARVANAHSFIAKLPEGFDTQVGERGLQLSGGQKQRIAIARA  582

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  583  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  642

Query  166  KIIEQGTHSTLIENRD-GAYYKLINLQQ  86
             + E GTH  LI   D G Y KLI +Q+
Sbjct  643  SVTEIGTHDELIAKGDNGVYAKLIRMQE  670



>gb|KJB36509.1| hypothetical protein B456_006G163000 [Gossypium raimondii]
Length=1294

 Score =   363 bits (931),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 219/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILAD---VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTEI  D     +    ++G +EL+ ++FSYPSRPD PIF+D N+R R GK+
Sbjct  998   SVFDLLDRKTEIEPDDPDATQVPDCLQGEVELKHIDFSYPSRPDVPIFRDLNLRARAGKT  1057

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFY+P SG+VMIDGKDI+   LKSLRKHI +V QEP LFA+
Sbjct  1058  LALVGPSGCGKSSVIALIQRFYEPSSGRVMIDGKDIRKYNLKSLRKHIAIVPQEPCLFAS  1117

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FIS+LPEGY T VGERGVQLSGGQKQR+AIA
Sbjct  1118  TIYENIAYGHESATEAEIIEAATLANAHKFISSLPEGYKTFVGERGVQLSGGQKQRIAIA  1177

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1178  RALVRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1237

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1238  DGKVAEQGSHSYLLKNYPDGCYARMIQLQRFTHSQ  1272


 Score =   325 bits (833),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 210/272 (77%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D K  I   ++ G +L  V G +EL++V+F+YPSRPD  I  +F + V  GK++A
Sbjct  345  IFRIIDNKPGIDRNSESGLDLESVTGLVELKNVDFAYPSRPDVRILNNFFLTVPAGKTIA  404

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP  G+V++DG DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  405  LVGSSGSGKSTVVSLIERFYDPSLGEVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTI  464

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + E+ EAA++ANAHSFI  LP+G+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  465  KENILLGRPDANQIEIEEAARVANAHSFIVKLPDGFDTQVGERGLQLSGGQKQRIAIARA  524

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  525  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  584

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
             + E GTH  LI +  +GAY KLI +Q+   +
Sbjct  585  SVSEIGTHDELIAKGENGAYAKLIRMQEMAHE  616



>gb|KGN58980.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1346

 Score =   363 bits (932),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 217/275 (79%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILAD---VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF +LDRKTEI  D   V +   K+ G +EL+ V+FSYP+RPD  +F+D N+RVR GK+
Sbjct  1050  SVFALLDRKTEIEPDDPNVTQVPDKLRGEVELKHVDFSYPTRPDILVFRDLNLRVRAGKT  1109

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVISL+ RFY+P SG+VMIDGKDI+   LKSLRKHI +V QEP LFA 
Sbjct  1110  LALVGPSGCGKSSVISLVQRFYEPTSGRVMIDGKDIRKFNLKSLRKHIAMVPQEPCLFAA  1169

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             SIY+NI YG E ATE+E+IEAA LANAH FIS LPEGY T VGERGVQLSGGQKQR+AIA
Sbjct  1170  SIYDNIAYGHESATEAEIIEAATLANAHKFISGLPEGYKTFVGERGVQLSGGQKQRIAIA  1229

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1230  RALIRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1289

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y K+I LQ+  H Q
Sbjct  1290  DGKVSEQGSHSHLLKNYPDGCYAKMIQLQRFTHSQ  1324


 Score =   330 bits (847),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/272 (60%), Positives = 211/272 (78%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            ++ ++D K  +  +   G EL  V G +EL++V+F+YPSRPD  I  +F++ V  GK++A
Sbjct  397  IYRIIDHKPTLNRNNESGLELESVSGLVELKNVDFTYPSRPDVRILNNFSLAVPAGKTIA  456

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V++LI RFYDPISG+V++DG+DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  457  LVGSSGSGKSTVVALIERFYDPISGEVLLDGRDIKTLKLRWLRQQIGLVSQEPALFATTI  516

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + EV EAA++ANAHSFI  LPEGY T+VGERG+QLSGGQKQR+AIARA
Sbjct  517  KENILLGRPEADQLEVEEAARVANAHSFIIKLPEGYDTQVGERGLQLSGGQKQRIAIARA  576

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  577  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  636

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
             + E GTH  L  +  +G Y KLI +Q+   +
Sbjct  637  SVSEMGTHDELFAKGENGVYAKLIRMQEMAHE  668



>ref|XP_004137839.1| PREDICTED: ABC transporter B family member 1-like [Cucumis sativus]
Length=1361

 Score =   363 bits (932),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 216/275 (79%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF +LDRKTEI  D  +      K+ G +EL+ V+FSYP+RPD P+FKD N+R R GK+
Sbjct  1065  SVFALLDRKTEIEPDEPDATPVPDKLRGEVELKHVDFSYPTRPDIPVFKDLNLRARAGKT  1124

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+L+ RFY+P SG+VMIDGKDI+   LKSLRKHI +V QEP LFA 
Sbjct  1125  LALVGPSGCGKSSVIALVQRFYEPTSGRVMIDGKDIRKFNLKSLRKHIAMVPQEPCLFAA  1184

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             SIY+NI YG E ATE+E+IEAA LANAH FIS LPEGY T VGERGVQLSGGQKQR+AIA
Sbjct  1185  SIYDNIAYGHESATETEIIEAATLANAHKFISGLPEGYKTFVGERGVQLSGGQKQRIAIA  1244

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1245  RALIRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1304

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1305  DGKVSEQGSHSHLLKNYPDGCYARMIQLQRFTHSQ  1339


 Score =   332 bits (850),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 211/272 (78%), Gaps = 3/272 (1%)
 Frame = -2

Query  880  VFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            ++ ++D K  +  +   G EL  V G +EL++V+F+YPSRPD  I  +F++ V  GK++A
Sbjct  412  IYRIIDHKPTLNRNNESGLELESVSGLVELKNVDFAYPSRPDVRILNNFSLTVPAGKTIA  471

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDPISG+V++DG+DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  472  LVGSSGSGKSTVVSLIERFYDPISGEVLLDGRDIKTLKLRWLRQQIGLVSQEPALFATTI  531

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + EV EAA++ANAHSFI  LPEGY T+VGERG+QLSGGQKQR+AIARA
Sbjct  532  KENILLGRPEADQLEVEEAARVANAHSFIIKLPEGYDTQVGERGLQLSGGQKQRIAIARA  591

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  592  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  651

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
             + E GTH  L  +  +G Y KLI +Q+   +
Sbjct  652  SVSEMGTHDELFAKGENGVYAKLIRMQEMAHE  683



>ref|XP_003520656.1| PREDICTED: ABC transporter B family member 1-like [Glycine max]
Length=1342

 Score =   363 bits (932),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 221/279 (79%), Gaps = 6/279 (2%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVR  725
             Q + SVFE+LDR+TEI  D  +  +   ++ G +EL+ V+FSYP+RPD P+F+D ++R R
Sbjct  1043  QAMRSVFELLDRRTEIEPDDQDATLVPDRLRGEVELKHVDFSYPTRPDMPVFRDLSLRAR  1102

Query  724   PGKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPA  545
              GK++ALVG SG GKSS+I+LI RFYDP SG+VMIDGKDI+   LKSLR+HI +V QEP 
Sbjct  1103  AGKTLALVGPSGCGKSSIIALIQRFYDPTSGRVMIDGKDIRKYNLKSLRRHISVVPQEPC  1162

Query  544   LFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQR  365
             LFAT+IYENI YG E ATE+E+IEAA LANAH FIS LP+GY T VGERGVQLSGGQKQR
Sbjct  1163  LFATTIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVGERGVQLSGGQKQR  1222

Query  364   VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
             +A+ARA L+  E++LLDEATSALD ESER VQ+ALDR    +T+++VAHRLST++NA+ I
Sbjct  1223  IAVARAFLRKAELMLLDEATSALDAESERSVQEALDRASSGKTTIIVAHRLSTVRNANLI  1282

Query  184   CVLQDGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
              V+ DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1283  AVIDDGKVAEQGSHSQLLKNHPDGIYARMIQLQRFTHSQ  1321


 Score =   332 bits (850),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 210/270 (78%), Gaps = 3/270 (1%)
 Frame = -2

Query  886  ASVFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
            A +F ++D K  I   ++ G EL  V G +EL++V+FSYPSRP+  I  DF++ V  GK+
Sbjct  392  AKIFRIIDHKPNIDRNSESGIELDTVTGLVELKNVDFSYPSRPEVQILNDFSLNVPAGKT  451

Query  712  MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
            +ALVG SGSGKS+V+SLI RFYDP SG+V++DG DIK LKL+ LR+ IGLV QEPALFAT
Sbjct  452  IALVGSSGSGKSTVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFAT  511

Query  532  SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
            +I ENIL G+  A + E+ EAA++ANAHSFI  LP+GY T+VGERG+QLSGGQKQR+AIA
Sbjct  512  TIRENILLGRPDADQVEIEEAARVANAHSFIIKLPDGYETQVGERGLQLSGGQKQRIAIA  571

Query  352  RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
            RA+LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ
Sbjct  572  RAMLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQ  631

Query  172  DGKIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             G + E GTH  L  +  +G Y KLI +Q+
Sbjct  632  LGSVSEIGTHDELFSKGENGVYAKLIKMQE  661



>gb|KDO84909.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1082

 Score =   359 bits (921),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 218/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q +  VF +L RKT I  D    +E+ +++G IELR+V F YP RPD  IF++ N++V  
Sbjct  803   QALGPVFGILYRKTAIQPDDPASKEVTEIKGNIELRNVSFKYPVRPDITIFENLNLKVSA  862

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S+A+VGQSGSGKS+VISL++RFYDPISG V+IDG DI+ L L+SLR+ IGLVQQEPAL
Sbjct  863   GRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTLNLRSLRRKIGLVQQEPAL  922

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F+T+IYENI YG E A+E E+++A K ANAH FIS +PEGY + VG+RGVQLSGGQKQRV
Sbjct  923   FSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGDRGVQLSGGQKQRV  982

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARA+LKNP ILLLDEATSALD  SE ++Q+ALD+LM+ RT+++VAHRLSTI+NAD+I 
Sbjct  983   AIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVAHRLSTIRNADKIA  1042

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             VLQ GK+ E G+H  L+   +G Y +LI LQQ
Sbjct  1043  VLQQGKVAEIGSHEQLLRKENGIYKQLIRLQQ  1074


 Score =   312 bits (800),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 198/255 (78%), Gaps = 2/255 (1%)
 Frame = -2

Query  841  DVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISL  662
            D G  L K+ G IE  +V F+YPSRP   +F++ N  V  GK+ A VG SGSGKS++IS+
Sbjct  194  DDGITLPKLAGQIEFSEVCFAYPSRPHM-VFENLNFSVDAGKTFAFVGPSGSGKSTIISM  252

Query  661  ILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESE  482
            + R Y+P SGK+++DG D+K+L+LK LR+ +GLV QEPALFATSI  NIL GKE A+   
Sbjct  253  VQRLYEPTSGKILLDGHDLKSLQLKWLREQMGLVSQEPALFATSIANNILLGKEDASMDR  312

Query  481  VIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATS  302
            VIEAAK ANAHSF+  LP+GY T+VGE G QLSGGQKQR+AIARAVL+NP+ILLLDEATS
Sbjct  313  VIEAAKAANAHSFVEGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATS  372

Query  301  ALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENR  122
            ALD ESE IVQ+AL+++M +RT++VVAHRLST+++ D I VL++G+++E GTH  LI ++
Sbjct  373  ALDAESELIVQRALEKIMSNRTTIVVAHRLSTVRDVDTIMVLKNGQVVESGTHVDLI-SK  431

Query  121  DGAYYKLINLQQHQQ  77
             G Y  L+NLQ  + 
Sbjct  432  GGEYAALVNLQSSEH  446



>ref|XP_004304461.2| PREDICTED: ABC transporter B family member 1 [Fragaria vesca 
subsp. vesca]
Length=1354

 Score =   362 bits (930),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 221/279 (79%), Gaps = 6/279 (2%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVR  725
             Q + SVFE+LDRKTEI  D  +      ++ G +E + V+FSYPSRPD P+F+D ++R R
Sbjct  1053  QAMQSVFELLDRKTEIEPDDIDATAVPDRLRGEVEFKHVDFSYPSRPDVPVFRDLSLRAR  1112

Query  724   PGKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPA  545
              GK++ALVG SG GKSSVISL+ RFYDP SG+V+IDGKDI+   LKSLR+HI +V QEP 
Sbjct  1113  AGKTLALVGPSGCGKSSVISLVQRFYDPTSGRVIIDGKDIRKYNLKSLRRHIAVVPQEPC  1172

Query  544   LFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQR  365
             LFAT+IYENI YG E ATE+E+IEAA LANAH F+SALPEGY T VGERG+QLSGGQKQR
Sbjct  1173  LFATTIYENIAYGHESATEAEIIEAANLANAHKFVSALPEGYKTFVGERGIQLSGGQKQR  1232

Query  364   VAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQI  185
             +AIARA+L+  E++LLDEATSALD ESER +Q+AL+R    +T++VVAHRLSTI+NA+ I
Sbjct  1233  IAIARALLRKAELMLLDEATSALDAESERSIQEALERACSGKTTIVVAHRLSTIRNANVI  1292

Query  184   CVLQDGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
              V+ DGK+ EQG+H+ L++N  DG Y ++I LQ+  H Q
Sbjct  1293  AVIDDGKVAEQGSHNHLLKNYPDGCYARMIQLQRFSHSQ  1331


 Score =   327 bits (837),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 208/268 (78%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D K  +   ++ G EL  V G +EL++V+FSYPSR D  I  +F++ V  GK++A
Sbjct  404  IFRIIDHKPGMDRNSEAGVELQSVTGLVELKNVDFSYPSRQDVRILNNFSLNVPAGKTIA  463

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP SG+V++DG DIK LKLK LR+ IGLV QEPALFAT+I
Sbjct  464  LVGSSGSGKSTVVSLIERFYDPSSGQVLLDGHDIKTLKLKWLRQQIGLVSQEPALFATTI  523

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + E+ EAA++ANAHSFI  LP+G+ T+VGERGVQLSGGQKQR+AIARA
Sbjct  524  KENILLGRPDADQVEIEEAARVANAHSFIVKLPDGFDTQVGERGVQLSGGQKQRIAIARA  583

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  584  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  643

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             + E GTH  L  +  +G Y KLI +Q+
Sbjct  644  SVSEIGTHDELFSKGENGVYAKLIRMQE  671



>ref|XP_006473688.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Citrus sinensis]
Length=1034

 Score =   357 bits (917),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/272 (63%), Positives = 217/272 (80%), Gaps = 2/272 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q +  VF +L RKT I  D    +E+ +++G IELR+V F YP RPD  IF++ N++V  
Sbjct  755   QALGPVFGILYRKTAIQPDDPASKEVTEIKGNIELRNVSFKYPVRPDITIFENLNLKVSA  814

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             G+S+A+VGQSGSGKS+VISL++RFYDPISG V+IDG DI+   L+SLR+ IGLVQQEPAL
Sbjct  815   GRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDGYDIRTFNLRSLRRKIGLVQQEPAL  874

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F+T+IYENI YG E A+E E+++A K ANAH FIS +PEGY + VG+RGVQLSGGQKQRV
Sbjct  875   FSTTIYENIKYGNEDASEIELMKATKAANAHGFISRMPEGYQSHVGDRGVQLSGGQKQRV  934

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARA+LKNP ILLLDEATSALD  SE ++Q+ALD+LM+ RT+++VAHRLSTI+NAD+I 
Sbjct  935   AIARAILKNPSILLLDEATSALDTASENLIQEALDKLMEGRTTIMVAHRLSTIRNADKIA  994

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             VLQ GK+ E G+H  L+   +G Y +LI LQQ
Sbjct  995   VLQQGKVAEIGSHEQLLRKENGIYKQLIRLQQ  1026


 Score =   312 bits (799),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 204/271 (75%), Gaps = 2/271 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSM  710
            + S+ +     +E   D G  L K+ G IE  +V F+YPSRP   +F++ N  V  GK+ 
Sbjct  130  IVSIIKENSHSSERPGDDGITLPKLAGQIEFCEVCFAYPSRPHM-VFENLNFSVDAGKTF  188

Query  709  ALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATS  530
            A VG SGSGKS++IS++ R Y+P SGK+++DG D+K+L+LK LR+ +GLV QEPALFATS
Sbjct  189  AFVGPSGSGKSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLREQMGLVSQEPALFATS  248

Query  529  IYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIAR  350
            I  NIL GKE A+   VIEAAK ANAHSF+  LP+GY T+VGE G QLSGGQKQR+AIAR
Sbjct  249  IANNILLGKEDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEGGTQLSGGQKQRIAIAR  308

Query  349  AVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQD  170
            AVL+NP+ILLLDEATSALD ESE IVQ+AL+++M +RT++VVAHRLST+++ D I VL++
Sbjct  309  AVLRNPKILLLDEATSALDAESELIVQRALEKIMSNRTTIVVAHRLSTVRDVDTIMVLKN  368

Query  169  GKIIEQGTHSTLIENRDGAYYKLINLQQHQQ  77
            G+++E GTH  LI ++ G Y  L+NLQ  + 
Sbjct  369  GQVVESGTHVDLI-SKGGEYAALVNLQSSEH  398



>gb|AIU41628.1| ABC transporter family protein [Hevea brasiliensis]
Length=1363

 Score =   362 bits (929),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 217/275 (79%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTEI  D  +      ++ G +EL+ V+FSYP+RPD PIF+D N+R R GK+
Sbjct  1067  SVFDLLDRKTEIEPDDPDATAVPDRLRGEVELKHVDFSYPTRPDVPIFRDLNLRARAGKT  1126

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFY+P SG+VMIDGKDI+   LKSLRKHI +V QEP LFA 
Sbjct  1127  LALVGPSGCGKSSVIALIQRFYEPSSGRVMIDGKDIRKYNLKSLRKHIAMVPQEPCLFAA  1186

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH FIS LP+GY T VGERGVQLSGGQKQR+AIA
Sbjct  1187  TIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYKTFVGERGVQLSGGQKQRIAIA  1246

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1247  RALVRRAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVID  1306

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1307  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHSQ  1341


 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 209/268 (78%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D K  +   ++ G EL  V G +EL++V+FSYPSRPD  I  +F + V  GK++A
Sbjct  414  IFRIIDHKPAVDRNSESGLELDSVTGLVELKNVDFSYPSRPDVRILNNFTLNVSAGKTIA  473

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP SG+V++DG DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  474  LVGSSGSGKSTVVSLIERFYDPNSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTI  533

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + E+ EAA++ANAHSFI  LPEG+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  534  KENILLGRPDADQIEIEEAARVANAHSFIVKLPEGFDTQVGERGLQLSGGQKQRIAIARA  593

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  594  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  653

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             + E GTH  LI +  +G Y KLI +Q+
Sbjct  654  SVTEIGTHDELIAKGENGVYAKLIRMQE  681



>ref|XP_011034998.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Populus euphratica]
Length=1041

 Score =   357 bits (917),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/272 (63%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  895   QMVASVFEVLDRKTEILAD--VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRP  722
             Q + SVF +L RKT +  D    + +  ++G +ELR V F YP+RPDT IF+D N+ V  
Sbjct  763   QALESVFSILHRKTAMDPDDPTSKVITDIKGDVELRHVSFKYPARPDTIIFEDLNLEVSA  822

Query  721   GKSMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPAL  542
             GKS+A+VGQSGSGKS+VI+LILRFYDPISG V+IDG D+K L LKSLR+ IGLVQQEPAL
Sbjct  823   GKSLAVVGQSGSGKSTVIALILRFYDPISGTVLIDGYDVKTLNLKSLRRKIGLVQQEPAL  882

Query  541   FATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRV  362
             F+T+IYENI YG E A+E EV++AAK ANAH FIS + EGY T VG+RG+QLSGGQKQR+
Sbjct  883   FSTTIYENIQYGNENASEIEVMKAAKAANAHGFISRMNEGYQTHVGDRGLQLSGGQKQRI  942

Query  361   AIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQIC  182
             AIARA+LK+P ILLLDEATSALD  SE++VQ+ALD+LM+ RT+V+VAHRLST+++AD I 
Sbjct  943   AIARAILKDPSILLLDEATSALDTASEKLVQEALDKLMEGRTTVLVAHRLSTVRDADSIA  1002

Query  181   VLQDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
             VLQ G+++E G+H+ LI    G Y +L++LQQ
Sbjct  1003  VLQHGRVVEIGSHNQLIGKPCGVYKQLVSLQQ  1034


 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 193/244 (79%), Gaps = 2/244 (1%)
 Frame = -2

Query  820  KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMALVGQSGSGKSSVISLILRFYDP  641
            KV G IE  +V FSYPSR +  +F++ +  +  GK+ A+VG SGSGKS+VIS++ RFY+P
Sbjct  163  KVSGQIEFCEVCFSYPSRSNM-VFENLSFSISAGKTFAVVGPSGSGKSTVISMVQRFYEP  221

Query  640  ISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSIYENILYGKEGATESEVIEAAKL  461
             SGK+++DG D+K L+LK LR+ +GLV QEPALFAT+I +NIL+GKE A+  ++ EAAK 
Sbjct  222  TSGKILLDGHDLKTLQLKWLREQMGLVSQEPALFATTIADNILFGKEDASMDQIYEAAKA  281

Query  460  ANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESE  281
            AN HSF+   P+GY T+VGE G QLSGGQKQR+AIARAVL+NP+ILLLDEATSALD ESE
Sbjct  282  ANVHSFVLQCPDGYHTQVGEGGTQLSGGQKQRLAIARAVLRNPKILLLDEATSALDAESE  341

Query  280  RIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKL  101
              VQQAL+++M +RT++VVAHRLSTI++ D I VL++G+++E G+H  LI ++ G Y  +
Sbjct  342  LTVQQALEKIMANRTTIVVAHRLSTIRDVDTIIVLKNGQVVESGSHLELI-SKGGEYASM  400

Query  100  INLQ  89
             +LQ
Sbjct  401  ASLQ  404



>ref|XP_007027421.1| ATP binding cassette subfamily B1 isoform 3 [Theobroma cacao]
 gb|EOY07923.1| ATP binding cassette subfamily B1 isoform 3 [Theobroma cacao]
Length=1179

 Score =   360 bits (923),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 219/275 (80%), Gaps = 6/275 (2%)
 Frame = -2

Query  883   SVFEVLDRKTEILAD---VGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTE+  D     +   ++ G +EL+ V+FSYPSRPD PIF+D N+R R GK+
Sbjct  883   SVFDLLDRKTEVEPDDPDATQVPDRLRGEVELKHVDFSYPSRPDVPIFRDLNLRARAGKT  942

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+LI RFY+P SG+VM+DGKDI+   LKSLRKHI +V QEP LF +
Sbjct  943   LALVGPSGCGKSSVIALIQRFYEPSSGRVMVDGKDIRKYNLKSLRKHIAIVPQEPCLFGS  1002

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA L+NAH FIS+LP+GY T VGERGVQLSGGQKQR+AIA
Sbjct  1003  TIYENIAYGHESATEAEIIEAATLSNAHKFISSLPDGYKTFVGERGVQLSGGQKQRIAIA  1062

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA+++  E++LLDEATSALD ESER VQ+ALDR    +T++VVAHRLSTI+NA  I V++
Sbjct  1063  RALVRKAELMLLDEATSALDAESERSVQEALDRACSGKTTIVVAHRLSTIRNAHVIAVIE  1122

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ--HQQ  77
             DGK+ EQG+HS L++N  DG Y ++I LQ+  H Q
Sbjct  1123  DGKVAEQGSHSHLLKNYPDGCYARMIQLQRFTHSQ  1157


 Score =   334 bits (856),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 211/268 (79%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D K  I   ++ G EL  V G +EL++V+F+YPSRPD  I  +F++ V  GK++A
Sbjct  230  IFRIIDHKPGIDRNSESGLELESVNGLVELKNVDFAYPSRPDVKILNNFSLSVPAGKTIA  289

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDPISG+V++DG DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  290  LVGSSGSGKSTVVSLIERFYDPISGEVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTI  349

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             ENIL G+  A + E+ EAA++ANAHSFI  LPEG+ T+VGERG+QLSGGQKQR+AIARA
Sbjct  350  KENILLGRPDANQIEIEEAARVANAHSFIVKLPEGFDTQVGERGLQLSGGQKQRIAIARA  409

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  410  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADVVAVLQQG  469

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             + E GTH  LI +  +G Y KLI +Q+
Sbjct  470  SVSEIGTHDELISKGENGVYAKLIRMQE  497



>gb|AFW66244.1| hypothetical protein ZEAMMB73_446753 [Zea mays]
Length=806

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 219/275 (80%), Gaps = 3/275 (1%)
 Frame = -2

Query  889  VASVFEVLDRKTEILADV--GEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGK  716
            VASVF VLDR+TEI  D   G +  K++G ++++ V+F+YPSRPD  IFK F++ ++PGK
Sbjct  531  VASVFAVLDRETEIDPDNPEGYKPEKLKGEVDIKGVDFAYPSRPDVIIFKGFSLSIQPGK  590

Query  715  SMALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFA  536
            S ALVGQSGSGKS++I LI RFYDP+ G V IDGKDIK   L++LR+HIGLV QEP LFA
Sbjct  591  STALVGQSGSGKSTIIGLIERFYDPLRGVVKIDGKDIKTYNLRALRRHIGLVSQEPTLFA  650

Query  535  TSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAI  356
             +I ENI+YG E ATE+E+  AA+ ANAH FIS L +GY T  GERGVQLSGGQKQR+AI
Sbjct  651  GTIRENIVYGTETATEAEIENAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAI  710

Query  355  ARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVL  176
            ARA+LKNP ILLLDEATSALD +SE++VQ+ALDR+M  RTS+VVAHRLSTI+N DQI VL
Sbjct  711  ARAILKNPAILLLDEATSALDSQSEKVVQEALDRVMVGRTSIVVAHRLSTIQNCDQITVL  770

Query  175  QDGKIIEQGTHSTLI-ENRDGAYYKLINLQQHQQQ  74
            + G ++E+GTH++L+ +   G Y+ L++LQQ   Q
Sbjct  771  EKGIVVEKGTHASLMAKGPSGTYFGLVSLQQGGNQ  805


 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  571  IGLVQQEPALFATSIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGV  392
            +GLV QEPALFATSI ENIL+GKE AT  E++ AAK ANAH+FIS LP+GY T+VGERGV
Sbjct  1    MGLVSQEPALFATSIRENILFGKEDATGEEIVAAAKAANAHNFISQLPQGYDTQVGERGV  60

Query  391  QLSGGQKQRVAIARAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRL  212
            Q+SGGQKQR+AIARA+LK+P+ILLLDEATSALD ESER+VQ+ALD     RT++V+AHRL
Sbjct  61   QMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTIVIAHRL  120

Query  211  STIKNADQICVLQDGKIIEQGTHSTLIENRDGAYYKLINLQQ  86
            STI+NAD I V+Q G++ E G+H  LI+N +G Y  L+ LQQ
Sbjct  121  STIRNADMIAVMQYGEVKELGSHDDLIDNENGLYTSLVRLQQ  162



>ref|XP_002266505.1| PREDICTED: ABC transporter B family member 1 [Vitis vinifera]
Length=1354

 Score =   362 bits (928),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/270 (63%), Positives = 216/270 (80%), Gaps = 4/270 (1%)
 Frame = -2

Query  883   SVFEVLDRKTEILADVGEELI---KVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKS  713
             SVF++LDRKTEI  D  + +    ++ G +EL+ V+FSYPSRPD P+F+D  +R R GK+
Sbjct  1058  SVFDLLDRKTEIEPDDPDAIPVTDRLRGEVELKHVDFSYPSRPDVPVFRDLCLRARAGKT  1117

Query  712   MALVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFAT  533
             +ALVG SG GKSSVI+L+ RFY+P SG+VMIDGKDI+   LKSLR+HI +V QEP LFAT
Sbjct  1118  LALVGPSGCGKSSVIALVQRFYEPTSGRVMIDGKDIRKYNLKSLRRHIAIVPQEPCLFAT  1177

Query  532   SIYENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIA  353
             +IYENI YG E ATE+E+IEAA LANAH F+SALP+GY T VGERGVQLSGGQKQR+AIA
Sbjct  1178  TIYENIAYGHESATEAEIIEAATLANAHKFVSALPDGYKTFVGERGVQLSGGQKQRIAIA  1237

Query  352   RAVLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQ  173
             RA L+  E++LLDEATSALD ESER +Q+AL+R    +T++VVAHRLSTI+NA  I V+ 
Sbjct  1238  RAFLRKAELMLLDEATSALDAESERCIQEALERACSGKTTIVVAHRLSTIRNAHTIAVID  1297

Query  172   DGKIIEQGTHSTLIENR-DGAYYKLINLQQ  86
             DGK+ EQG+HS L++N  DG Y ++I LQ+
Sbjct  1298  DGKVAEQGSHSHLLKNYPDGCYARMIQLQR  1327


 Score =   330 bits (847),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 208/268 (78%), Gaps = 3/268 (1%)
 Frame = -2

Query  880  VFEVLDRKTEI--LADVGEELIKVEGTIELRDVEFSYPSRPDTPIFKDFNMRVRPGKSMA  707
            +F ++D K  I    + G EL  V G +EL++V+FSYPSRP+  I  DF++ V  GK++A
Sbjct  405  IFRIIDHKPNIERNGETGLELESVTGQVELKNVDFSYPSRPEVRILSDFSLNVPAGKTIA  464

Query  706  LVGQSGSGKSSVISLILRFYDPISGKVMIDGKDIKNLKLKSLRKHIGLVQQEPALFATSI  527
            LVG SGSGKS+V+SLI RFYDP SG+V++DG DIK LKL+ LR+ IGLV QEPALFAT+I
Sbjct  465  LVGSSGSGKSTVVSLIERFYDPTSGQVLLDGHDIKTLKLRWLRQQIGLVSQEPALFATTI  524

Query  526  YENILYGKEGATESEVIEAAKLANAHSFISALPEGYSTKVGERGVQLSGGQKQRVAIARA  347
             EN+L G+  AT  E+ EAA++ANA+SFI  LPEG+ T+VGERG QLSGGQKQR+AIARA
Sbjct  525  KENMLLGRPDATLVEIEEAARVANAYSFIVKLPEGFDTQVGERGFQLSGGQKQRIAIARA  584

Query  346  VLKNPEILLLDEATSALDVESERIVQQALDRLMKSRTSVVVAHRLSTIKNADQICVLQDG  167
            +LKNP ILLLDEATSALD ESE++VQ+ALDR M  RT++V+AHRLSTI+ AD + VLQ G
Sbjct  585  MLKNPAILLLDEATSALDSESEKLVQEALDRFMIGRTTLVIAHRLSTIRKADLVAVLQQG  644

Query  166  KIIEQGTHSTLI-ENRDGAYYKLINLQQ  86
             + E GTH  LI +  +G Y KLI +Q+
Sbjct  645  SVSEIGTHDELIAKGENGVYAKLIRMQE  672



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1982453040000