BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF052B19

Length=881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611357.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    451   6e-149   
ref|XP_009758541.1|  PREDICTED: alpha-N-acetylglucosaminidase           446   9e-148   Nicotiana sylvestris
ref|XP_006345419.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      444   5e-147   Solanum tuberosum [potatoes]
ref|XP_010324692.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    439   8e-146   
ref|XP_010324687.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    440   2e-145   Solanum lycopersicum
ref|XP_007052479.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    429   2e-143   
emb|CDP19299.1|  unnamed protein product                                433   2e-142   Coffea canephora [robusta coffee]
ref|XP_007052478.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    429   6e-141   
ref|XP_002517785.1|  alpha-n-acetylglucosaminidase, putative            413   1e-140   
gb|KJB24985.1|  hypothetical protein B456_004G170700                    417   1e-138   Gossypium raimondii
ref|XP_008375201.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      406   4e-137   
emb|CAA77084.1|  alpha-N-acetylglucosaminidase                          419   4e-137   Nicotiana tabacum [American tobacco]
gb|KJB24984.1|  hypothetical protein B456_004G170700                    417   1e-136   Gossypium raimondii
ref|XP_002314048.1|  hypothetical protein POPTR_0009s06320g             417   2e-136   Populus trichocarpa [western balsam poplar]
gb|KJB24982.1|  hypothetical protein B456_004G170700                    417   3e-136   Gossypium raimondii
ref|XP_007218923.1|  hypothetical protein PRUPE_ppa001555mg             416   4e-136   Prunus persica
ref|XP_008231468.1|  PREDICTED: alpha-N-acetylglucosaminidase           416   9e-136   Prunus mume [ume]
ref|XP_011025477.1|  PREDICTED: alpha-N-acetylglucosaminidase           409   2e-133   Populus euphratica
ref|XP_009368036.1|  PREDICTED: alpha-N-acetylglucosaminidase           409   3e-133   Pyrus x bretschneideri [bai li]
ref|XP_010659443.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    406   4e-133   
gb|KDP43563.1|  hypothetical protein JCGZ_16850                         407   2e-132   Jatropha curcas
ref|XP_002273084.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    407   2e-132   
ref|XP_011469505.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    401   3e-132   Fragaria vesca subsp. vesca
emb|CBI24942.3|  unnamed protein product                                407   7e-132   Vitis vinifera
gb|KHM99190.1|  Alpha-N-acetylglucosaminidase                           404   2e-131   Glycine soja [wild soybean]
ref|XP_010257140.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    400   2e-131   Nelumbo nucifera [Indian lotus]
ref|XP_003535842.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    404   2e-131   Glycine max [soybeans]
ref|XP_010097439.1|  hypothetical protein L484_004673                   404   3e-131   
ref|XP_011087998.1|  PREDICTED: alpha-N-acetylglucosaminidase           403   5e-131   Sesamum indicum [beniseed]
ref|XP_011469504.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    403   6e-131   Fragaria vesca subsp. vesca
ref|XP_010257138.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    400   7e-130   Nelumbo nucifera [Indian lotus]
gb|KHG14952.1|  Alpha-N-acetylglucosaminidase                           400   7e-130   Gossypium arboreum [tree cotton]
gb|KEH33252.1|  alpha-N-acetylglucosaminidase family protein            396   2e-129   Medicago truncatula
gb|EYU27032.1|  hypothetical protein MIMGU_mgv1a001508mg                399   3e-129   Erythranthe guttata [common monkey flower]
gb|AES69665.2|  alpha-N-acetylglucosaminidase family protein            397   2e-128   Medicago truncatula
ref|XP_004499942.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      396   2e-128   Cicer arietinum [garbanzo]
ref|XP_003599414.1|  Alpha-N-acetylglucosaminidase                      397   3e-128   
ref|XP_007148897.1|  hypothetical protein PHAVU_005G023300g             395   6e-128   Phaseolus vulgaris [French bean]
dbj|BAK00311.1|  predicted protein                                      382   2e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004984324.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      387   6e-127   Setaria italica
ref|XP_006399865.1|  hypothetical protein EUTSA_v100127270mg            375   6e-126   
ref|XP_010456519.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      375   7e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010694988.1|  PREDICTED: alpha-N-acetylglucosaminidase           389   2e-125   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW66076.1|  hypothetical protein EUGRSUZ_G03358                     387   3e-125   Eucalyptus grandis [rose gum]
ref|XP_010228604.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    379   1e-124   
ref|XP_010067843.1|  PREDICTED: alpha-N-acetylglucosaminidase           386   2e-124   Eucalyptus grandis [rose gum]
ref|XP_008802642.1|  PREDICTED: alpha-N-acetylglucosaminidase           386   2e-124   Phoenix dactylifera
gb|EEC75285.1|  hypothetical protein OsI_11626                          385   9e-124   Oryza sativa Indica Group [Indian rice]
gb|KFK25595.1|  hypothetical protein AALP_AA8G134900                    373   1e-123   Arabis alpina [alpine rockcress]
gb|KDO83339.1|  hypothetical protein CISIN_1g003545mg                   379   1e-123   Citrus sinensis [apfelsine]
gb|EEE59081.1|  hypothetical protein OsJ_10898                          383   5e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660142.1|  PREDICTED: alpha-N-acetylglucosaminidase           383   5e-123   
ref|XP_010938526.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    382   7e-123   Elaeis guineensis
ref|XP_006482916.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      382   1e-122   Citrus sinensis [apfelsine]
ref|XP_010228603.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    377   1e-122   Brachypodium distachyon [annual false brome]
gb|KDO83338.1|  hypothetical protein CISIN_1g003545mg                   379   8e-122   Citrus sinensis [apfelsine]
ref|NP_196873.1|  alpha-N-acetylglucosaminidase                         379   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438966.1|  hypothetical protein CICLE_v10030724mg             378   2e-121   Citrus clementina [clementine]
ref|XP_003557830.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    377   5e-121   Brachypodium distachyon [annual false brome]
ref|XP_002871580.1|  alpha-N-acetylglucosaminidase family               377   5e-121   
ref|XP_006651392.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      376   5e-121   
gb|AES69666.2|  alpha-N-acetylglucosaminidase family protein            373   1e-120   Medicago truncatula
ref|XP_007148898.1|  hypothetical protein PHAVU_005G023300g             375   4e-120   Phaseolus vulgaris [French bean]
ref|XP_010492144.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      374   6e-120   Camelina sativa [gold-of-pleasure]
gb|AES69667.2|  alpha-N-acetylglucosaminidase family protein            374   8e-120   Medicago truncatula
ref|XP_003599416.1|  Alpha-N-acetylglucosaminidase                      374   9e-120   
ref|XP_010453460.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    372   8e-119   Camelina sativa [gold-of-pleasure]
emb|CDX85632.1|  BnaA02g01810D                                          372   9e-119   
ref|XP_009125936.1|  PREDICTED: alpha-N-acetylglucosaminidase           371   2e-118   Brassica rapa
ref|XP_009391536.1|  PREDICTED: alpha-N-acetylglucosaminidase           370   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006851078.1|  hypothetical protein AMTR_s00025p00242240          369   5e-118   
emb|CDX91103.1|  BnaC02g04940D                                          366   1e-116   
ref|XP_006287089.1|  hypothetical protein CARUB_v10000251mg             362   4e-115   Capsella rubella
ref|XP_010534240.1|  PREDICTED: alpha-N-acetylglucosaminidase           358   1e-113   Tarenaya hassleriana [spider flower]
gb|EMT10178.1|  hypothetical protein F775_30738                         354   5e-111   
ref|XP_004158231.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    339   6e-109   
ref|XP_008461320.1|  PREDICTED: alpha-N-acetylglucosaminidase           341   3e-107   Cucumis melo [Oriental melon]
ref|XP_002465249.1|  hypothetical protein SORBIDRAFT_01g034960          340   5e-107   
ref|XP_004135943.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      338   2e-106   Cucumis sativus [cucumbers]
gb|KGN45103.1|  hypothetical protein Csa_7G425950                       323   8e-101   Cucumis sativus [cucumbers]
gb|EPS59043.1|  hypothetical protein M569_15767                         300   3e-98    Genlisea aurea
ref|XP_008793800.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      308   2e-94    
ref|XP_010112589.1|  hypothetical protein L484_010094                   308   4e-94    
gb|KDO69793.1|  hypothetical protein CISIN_1g008173mg                   300   8e-94    Citrus sinensis [apfelsine]
gb|KDO69790.1|  hypothetical protein CISIN_1g008173mg                   299   1e-93    Citrus sinensis [apfelsine]
gb|KDO69789.1|  hypothetical protein CISIN_1g008173mg                   299   2e-93    Citrus sinensis [apfelsine]
ref|XP_010663217.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      304   4e-93    Vitis vinifera
emb|CBI15090.3|  unnamed protein product                                305   7e-93    Vitis vinifera
ref|XP_010318943.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      295   1e-92    Solanum lycopersicum
ref|XP_010928215.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      303   2e-92    Elaeis guineensis
ref|XP_006856885.1|  hypothetical protein AMTR_s00055p00202230          300   5e-92    
ref|XP_006476679.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      299   4e-91    Citrus sinensis [apfelsine]
gb|KJB08355.1|  hypothetical protein B456_001G078400                    299   8e-91    Gossypium raimondii
ref|XP_006439738.1|  hypothetical protein CICLE_v10018883mg             298   8e-91    Citrus clementina [clementine]
ref|XP_002318632.2|  hypothetical protein POPTR_0012s07760g             297   9e-91    
gb|KHN19340.1|  Alpha-N-acetylglucosaminidase                           285   9e-91    Glycine soja [wild soybean]
ref|XP_007036097.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    291   2e-90    
ref|XP_007210354.1|  hypothetical protein PRUPE_ppa001642mg             296   5e-90    
ref|XP_002511461.1|  alpha-n-acetylglucosaminidase, putative            295   8e-90    Ricinus communis
ref|XP_006345181.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      296   9e-90    Solanum tuberosum [potatoes]
gb|KHG03421.1|  Alpha-N-acetylglucosaminidase                           295   1e-89    Gossypium arboreum [tree cotton]
ref|XP_008239708.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      295   1e-89    
ref|XP_010027888.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    291   2e-89    
ref|XP_011008329.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    295   2e-89    Populus euphratica
ref|XP_011008330.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    295   2e-89    Populus euphratica
ref|XP_004166229.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      281   3e-89    
ref|XP_011087174.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      296   4e-89    Sesamum indicum [beniseed]
gb|KDP31153.1|  hypothetical protein JCGZ_11529                         293   4e-89    Jatropha curcas
ref|XP_008393079.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    292   2e-88    
ref|XP_008393078.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    292   2e-88    
ref|XP_007036096.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    292   2e-88    
ref|XP_007138122.1|  hypothetical protein PHAVU_009G182100g             287   2e-88    Phaseolus vulgaris [French bean]
ref|XP_010027879.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    292   2e-88    Eucalyptus grandis [rose gum]
ref|XP_010027872.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    292   2e-88    Eucalyptus grandis [rose gum]
gb|KCW83402.1|  hypothetical protein EUGRSUZ_B00338                     292   3e-88    Eucalyptus grandis [rose gum]
ref|XP_011464528.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      292   3e-88    Fragaria vesca subsp. vesca
ref|XP_009625152.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    291   7e-88    Nicotiana tomentosiformis
ref|XP_009625151.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    290   1e-87    Nicotiana tomentosiformis
gb|KEH35072.1|  alpha-N-acetylglucosaminidase family protein            288   3e-87    Medicago truncatula
ref|XP_007138123.1|  hypothetical protein PHAVU_009G182100g             286   1e-86    Phaseolus vulgaris [French bean]
ref|XP_009799801.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    285   8e-86    Nicotiana sylvestris
ref|XP_009799792.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    285   1e-85    Nicotiana sylvestris
ref|XP_008453133.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      284   2e-85    Cucumis melo [Oriental melon]
gb|KFK25596.1|  hypothetical protein AALP_AA8G134900                    270   8e-85    Arabis alpina [alpine rockcress]
gb|KCW66077.1|  hypothetical protein EUGRSUZ_G03358                     278   5e-84    Eucalyptus grandis [rose gum]
ref|XP_006581937.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    280   5e-84    Glycine max [soybeans]
ref|XP_006581936.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    280   5e-84    Glycine max [soybeans]
ref|XP_004138287.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      280   7e-84    
emb|CDP16996.1|  unnamed protein product                                280   1e-83    Coffea canephora [robusta coffee]
ref|XP_006653830.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      277   1e-82    
ref|XP_010240531.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    271   6e-82    Brachypodium distachyon [annual false brome]
ref|XP_010453461.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    270   7e-81    Camelina sativa [gold-of-pleasure]
ref|XP_008667109.1|  PREDICTED: uncharacterized protein LOC100192...    271   1e-80    
dbj|BAD94027.1|  alpha-N-acetylglucosaminidase                          253   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KFK25594.1|  hypothetical protein AALP_AA8G134900                    269   2e-80    Arabis alpina [alpine rockcress]
ref|XP_003580702.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    270   3e-80    Brachypodium distachyon [annual false brome]
ref|XP_001782392.1|  predicted protein                                  270   3e-80    
gb|EEC78143.1|  hypothetical protein OsI_17702                          270   4e-80    Oryza sativa Indica Group [Indian rice]
dbj|BAK03902.1|  predicted protein                                      270   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07078.1|  predicted protein                                      270   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA35665.1|  TPA: hypothetical protein ZEAMMB73_337226              273   5e-80    
emb|CAE04506.2|  OSJNBb0059K02.16                                       270   6e-80    Oryza sativa Japonica Group [Japonica rice]
gb|EEE61812.1|  hypothetical protein OsJ_16433                          271   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977055.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      261   1e-76    Setaria italica
ref|XP_002977411.1|  hypothetical protein SELMODRAFT_107285             259   3e-76    
gb|KJB24983.1|  hypothetical protein B456_004G170700                    258   3e-76    Gossypium raimondii
ref|XP_004502129.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      259   4e-76    Cicer arietinum [garbanzo]
gb|EMS67905.1|  hypothetical protein TRIUR3_00413                       254   1e-74    Triticum urartu
ref|XP_002974994.1|  hypothetical protein SELMODRAFT_102402             254   1e-74    
gb|EMS50400.1|  hypothetical protein TRIUR3_11279                       253   1e-74    Triticum urartu
gb|EMT10385.1|  hypothetical protein F775_10757                         251   2e-73    
ref|XP_008356770.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      233   1e-70    
gb|KGN63614.1|  hypothetical protein Csa_1G005750                       208   5e-61    Cucumis sativus [cucumbers]
ref|XP_006439737.1|  hypothetical protein CICLE_v10018883mg             216   8e-61    
ref|XP_010456520.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      201   1e-60    
ref|XP_002448659.1|  hypothetical protein SORBIDRAFT_06g030930          197   8e-58    
emb|CAJ86183.1|  H0212B02.15                                            186   7e-50    Oryza sativa [red rice]
gb|ACF81735.1|  unknown                                                 171   8e-49    Zea mays [maize]
gb|KDO69791.1|  hypothetical protein CISIN_1g008173mg                   178   2e-48    Citrus sinensis [apfelsine]
gb|KCW83403.1|  hypothetical protein EUGRSUZ_B00338                     181   3e-48    Eucalyptus grandis [rose gum]
ref|XP_006439736.1|  hypothetical protein CICLE_v10018883mg             178   4e-47    
ref|XP_007208776.1|  hypothetical protein PRUPE_ppa023629mg             164   4e-46    
ref|XP_009625153.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    175   4e-46    
gb|EYU29515.1|  hypothetical protein MIMGU_mgv1a0184372mg               166   2e-45    Erythranthe guttata [common monkey flower]
ref|XP_009799807.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    171   1e-44    Nicotiana sylvestris
ref|XP_009420879.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      150   7e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_029711569.1|  hypothetical protein                               158   6e-40    
ref|XP_001638539.1|  predicted protein                                  149   5e-37    Nematostella vectensis
tpg|DAA35664.1|  TPA: hypothetical protein ZEAMMB73_337226              148   2e-36    
ref|XP_007558689.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      142   6e-35    Poecilia formosa
gb|ELW54978.1|  Alpha-N-acetylglucosaminidase                           143   7e-35    Tupaia chinensis
ref|XP_006156074.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    144   8e-35    
ref|XP_007558665.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    142   1e-34    
ref|XP_005811749.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      142   1e-34    
ref|XP_007558657.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    142   4e-34    Poecilia formosa
ref|WP_012790769.1|  alpha-N-acetylglucosaminidase                      141   5e-34    Chitinophaga pinensis
ref|XP_005645139.1|  hypothetical protein COCSUDRAFT_37819              140   1e-33    Coccomyxa subellipsoidea C-169
ref|XP_011486876.1|  PREDICTED: alpha-N-acetylglucosaminidase           139   2e-33    
ref|XP_002156234.2|  PREDICTED: alpha-N-acetylglucosaminidase-like      139   2e-33    
gb|EFB20123.1|  hypothetical protein PANDA_011160                       138   3e-33    Ailuropoda melanoleuca
ref|XP_005313977.1|  PREDICTED: alpha-N-acetylglucosaminidase           139   3e-33    Chrysemys picta bellii
ref|XP_008436404.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    139   3e-33    Poecilia reticulata
ref|XP_011226954.1|  PREDICTED: alpha-N-acetylglucosaminidase           138   3e-33    
ref|XP_011333454.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    139   3e-33    
ref|XP_008436403.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    139   3e-33    Poecilia reticulata
ref|XP_005139916.1|  PREDICTED: alpha-N-acetylglucosaminidase           139   3e-33    Melopsittacus undulatus
ref|XP_007236414.1|  PREDICTED: alpha-N-acetylglucosaminidase           139   5e-33    Astyanax mexicanus [blind cave fish]
ref|XP_011333453.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    139   5e-33    
gb|EFN75548.1|  Alpha-N-acetylglucosaminidase                           138   6e-33    Harpegnathos saltator
gb|EDM06081.1|  rCG33377, isoform CRA_d                                 136   6e-33    Rattus norvegicus [brown rat]
ref|XP_011152868.1|  PREDICTED: alpha-N-acetylglucosaminidase           138   8e-33    Harpegnathos saltator
gb|KEH33327.1|  alpha-N-acetylglucosaminidase                           127   8e-33    Medicago truncatula
ref|XP_003131436.1|  PREDICTED: alpha-N-acetylglucosaminidase           138   9e-33    
ref|XP_006810907.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      134   1e-32    Neolamprologus brichardi [lyretail cichlid]
gb|AIG55486.1|  secreted protein                                        137   1e-32    Thraustotheca clavata
ref|WP_013992396.1|  alpha-N-acetylglucosaminidase                      137   2e-32    Zobellia galactanivorans
gb|ETP45296.1|  hypothetical protein, variant                           136   2e-32    Phytophthora parasitica P10297
gb|ETI47474.1|  hypothetical protein, variant                           136   2e-32    Phytophthora parasitica P1569
gb|ETK87396.1|  hypothetical protein, variant                           136   2e-32    Phytophthora parasitica
gb|ETP17256.1|  hypothetical protein, variant                           136   2e-32    Phytophthora parasitica CJ01A1
ref|XP_004707539.1|  PREDICTED: alpha-N-acetylglucosaminidase           136   2e-32    Echinops telfairi [lesser hedgehog tenrec]
gb|ETM47210.1|  hypothetical protein, variant                           136   2e-32    Phytophthora parasitica
ref|XP_008905155.1|  hypothetical protein, variant                      136   2e-32    Phytophthora parasitica INRA-310
ref|XP_008301715.1|  PREDICTED: alpha-N-acetylglucosaminidase           135   3e-32    Stegastes partitus
gb|ETI47473.1|  hypothetical protein F443_08379                         136   3e-32    Phytophthora parasitica P1569
gb|ETP45295.1|  hypothetical protein F442_08321                         136   3e-32    Phytophthora parasitica P10297
ref|WP_014217056.1|  alpha-N-acetylglucosaminidase                      136   3e-32    Niastella koreensis
gb|ETP17255.1|  hypothetical protein F441_08364                         136   3e-32    Phytophthora parasitica CJ01A1
ref|XP_008312357.1|  PREDICTED: alpha-N-acetylglucosaminidase           136   3e-32    Cynoglossus semilaevis [half-smooth tongue sole]
gb|ETM47209.1|  hypothetical protein L914_08097                         136   3e-32    Phytophthora parasitica
gb|ETK87395.1|  hypothetical protein L915_08211                         136   3e-32    Phytophthora parasitica
ref|XP_006125827.1|  PREDICTED: alpha-N-acetylglucosaminidase           135   3e-32    
ref|XP_008905154.1|  hypothetical protein PPTG_11754                    136   4e-32    Phytophthora parasitica INRA-310
ref|XP_008147571.1|  PREDICTED: alpha-N-acetylglucosaminidase           136   4e-32    Eptesicus fuscus
ref|XP_004655806.1|  PREDICTED: alpha-N-acetylglucosaminidase           135   5e-32    Jaculus jaculus
gb|ETL93946.1|  hypothetical protein, variant                           135   5e-32    Phytophthora parasitica
ref|XP_001081442.1|  PREDICTED: alpha-N-acetylglucosaminidase           135   5e-32    Rattus norvegicus [brown rat]
ref|XP_007899764.1|  PREDICTED: alpha-N-acetylglucosaminidase           135   6e-32    Callorhinchus milii [Australian ghost shark]
ref|XP_003978574.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      135   6e-32    
gb|ETL93945.1|  hypothetical protein L917_08033                         135   7e-32    Phytophthora parasitica
ref|XP_005429681.1|  PREDICTED: alpha-N-acetylglucosaminidase           133   7e-32    Geospiza fortis
gb|KFO97538.1|  Alpha-N-acetylglucosaminidase                           133   7e-32    Calypte anna
ref|XP_008504015.1|  PREDICTED: alpha-N-acetylglucosaminidase           133   8e-32    Calypte anna
gb|KFO72136.1|  Alpha-N-acetylglucosaminidase                           134   1e-31    Cuculus canorus
ref|XP_005950306.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      134   1e-31    Haplochromis burtoni
ref|XP_004571517.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      134   1e-31    Maylandia zebra
ref|XP_007177897.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      134   2e-31    
ref|XP_785272.3|  PREDICTED: alpha-N-acetylglucosaminidase              134   2e-31    
ref|WP_022353495.1|  hypothetical protein                               134   2e-31    
ref|XP_007102204.1|  PREDICTED: alpha-N-acetylglucosaminidase           134   3e-31    
ref|XP_003724005.1|  PREDICTED: uncharacterized protein LOC100893810    134   3e-31    
ref|XP_011162675.1|  PREDICTED: alpha-N-acetylglucosaminidase           134   3e-31    Solenopsis invicta [imported red fire ant]
ref|XP_009553768.1|  PREDICTED: alpha-N-acetylglucosaminidase           133   3e-31    Cuculus canorus
ref|WP_029284353.1|  alpha-N-acetylglucosaminidase                      133   3e-31    Pedobacter sp. R20-19
ref|XP_002902563.1|  alpha-N-acetylglucosaminidase (NAGLU), putative    133   3e-31    Phytophthora infestans T30-4
gb|EKC30145.1|  Alpha-N-acetylglucosaminidase                           134   3e-31    Crassostrea gigas
ref|XP_007424968.1|  PREDICTED: alpha-N-acetylglucosaminidase           133   3e-31    Python bivittatus
ref|XP_006992969.1|  PREDICTED: alpha-N-acetylglucosaminidase           133   4e-31    Peromyscus maniculatus bairdii
ref|XP_548088.2|  PREDICTED: alpha-N-acetylglucosaminidase              133   4e-31    Canis lupus familiaris [dogs]
gb|AAK73654.1|  lysosomal alpha-N-acetyl glucosaminidase                133   4e-31    Dromaius novaehollandiae
ref|WP_015809205.1|  alpha-N-acetylglucosaminidase                      133   4e-31    Pedobacter heparinus
ref|XP_005070217.1|  PREDICTED: alpha-N-acetylglucosaminidase           132   5e-31    Mesocricetus auratus [Syrian golden hamster]
ref|XP_005111892.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      132   6e-31    
ref|WP_036890440.1|  beta-glucosidase                                   132   7e-31    
ref|XP_001366343.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      132   8e-31    Monodelphis domestica
gb|EPQ13642.1|  Alpha-N-acetylglucosaminidase                           130   9e-31    Myotis brandtii
ref|XP_004319191.1|  PREDICTED: alpha-N-acetylglucosaminidase           132   1e-30    
ref|XP_320760.4|  AGAP011750-PA                                         132   1e-30    Anopheles gambiae str. PEST
ref|XP_003488083.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      132   1e-30    Bombus impatiens
ref|XP_007449909.1|  PREDICTED: alpha-N-acetylglucosaminidase           131   2e-30    Lipotes vexillifer [baiji]
ref|XP_005471266.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      131   2e-30    Oreochromis niloticus
ref|XP_008833525.1|  PREDICTED: alpha-N-acetylglucosaminidase           131   2e-30    
ref|XP_006004314.1|  PREDICTED: alpha-N-acetylglucosaminidase           129   2e-30    Latimeria chalumnae
ref|XP_001865888.1|  alpha-N-acetyl glucosaminidase                     131   2e-30    Culex quinquefasciatus
emb|CEL21832.1|  Alpha-N-acetylglucosaminidase                          132   2e-30    Kibdelosporangium sp. MJ126-NF4
ref|WP_042196464.1|  hypothetical protein                               131   2e-30    
ref|XP_009992492.1|  PREDICTED: alpha-N-acetylglucosaminidase           129   3e-30    Chaetura pelagica
ref|XP_005875784.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    129   3e-30    
ref|XP_005875783.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    130   3e-30    Myotis brandtii
ref|WP_028730326.1|  alpha-N-acetylglucosaminidase                      130   3e-30    Parabacteroides gordonii
ref|XP_003768245.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      130   3e-30    
gb|KFU87022.1|  Alpha-N-acetylglucosaminidase                           129   4e-30    Chaetura pelagica
ref|XP_011379506.1|  PREDICTED: alpha-N-acetylglucosaminidase           130   4e-30    Pteropus vampyrus
ref|WP_025498547.1|  alpha-N-acetylglucosaminidase                      130   4e-30    
ref|XP_011413974.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    130   4e-30    
ref|XP_008570139.1|  PREDICTED: alpha-N-acetylglucosaminidase           129   5e-30    Galeopterus variegatus [Malayan flying lemur]
ref|XP_011413971.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    130   5e-30    
ref|XP_011413973.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    130   5e-30    
ref|XP_006721983.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    127   5e-30    Homo sapiens [man]
ref|XP_004041658.1|  PREDICTED: alpha-N-acetylglucosaminidase           130   6e-30    Gorilla gorilla gorilla [lowland gorilla]
ref|WP_044225091.1|  alpha-N-acetylglucosaminidase                      129   6e-30    
ref|XP_003397173.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      130   6e-30    Bombus terrestris [large earth bumblebee]
ref|XP_004282871.1|  PREDICTED: alpha-N-acetylglucosaminidase           130   6e-30    Orcinus orca [Orca]
gb|KHM49101.1|  alpha-N-acetylglucosaminidase                           129   7e-30    Coprobacter secundus
ref|XP_004685005.1|  PREDICTED: alpha-N-acetylglucosaminidase           129   7e-30    Condylura cristata
ref|WP_022158612.1|  alpha-N-acetylglucosaminidase                      129   7e-30    
ref|XP_002827555.2|  PREDICTED: alpha-N-acetylglucosaminidase           129   9e-30    Pongo abelii [orang utan]
ref|XP_008010821.1|  PREDICTED: alpha-N-acetylglucosaminidase           129   9e-30    Chlorocebus sabaeus
ref|WP_022340419.1|  alpha-N-acetylglucosaminidase                      123   1e-29    
ref|WP_039474560.1|  alpha-N-acetylglucosaminidase                      129   1e-29    
ref|XP_003786703.1|  PREDICTED: alpha-N-acetylglucosaminidase           129   1e-29    
ref|XP_006533528.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    126   1e-29    
ref|XP_003813989.2|  PREDICTED: alpha-N-acetylglucosaminidase           129   1e-29    
ref|WP_022047963.1|  hypothetical protein                               128   1e-29    
ref|XP_004884538.1|  PREDICTED: alpha-N-acetylglucosaminidase           128   2e-29    
ref|WP_021847800.1|  alpha-N-acetylglucosaminidase                      128   2e-29    
ref|WP_044175664.1|  alpha-N-acetylglucosaminidase                      128   2e-29    
ref|XP_006092419.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    128   2e-29    
gb|EDL03875.1|  alpha-N-acetylglucosaminidase (Sanfilippo disease...    126   2e-29    
ref|XP_006940426.2|  PREDICTED: alpha-N-acetylglucosaminidase           128   2e-29    
ref|XP_001656341.1|  AAEL003150-PA                                      128   2e-29    
ref|XP_003279518.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    128   2e-29    
ref|WP_018709673.1|  alpha-N-acetylglucosaminidase                      127   3e-29    
ref|XP_523654.2|  PREDICTED: alpha-N-acetylglucosaminidase              128   3e-29    
gb|EHB02808.1|  Alpha-N-acetylglucosaminidase                           127   3e-29    
ref|XP_006773971.1|  PREDICTED: alpha-N-acetylglucosaminidase           127   3e-29    
ref|XP_006638268.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      127   3e-29    
ref|XP_004410599.1|  PREDICTED: alpha-N-acetylglucosaminidase           127   3e-29    
gb|AIG56008.1|  secreted protein                                        127   3e-29    
ref|XP_004859890.1|  PREDICTED: alpha-N-acetylglucosaminidase           127   3e-29    
ref|XP_003733088.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    127   4e-29    
gb|AAB36605.1|  alpha-N-acetylglucosaminidase                           127   4e-29    
gb|ELR53922.1|  Alpha-N-acetylglucosaminidase                           126   4e-29    
ref|XP_009524403.1|  hypothetical protein PHYSODRAFT_495971             127   4e-29    
ref|WP_009136816.1|  alpha-N-acetylglucosaminidase                      127   4e-29    
gb|AAK73655.1|  lysosomal alpha-N-acetyl glucosaminidase                127   4e-29    
ref|XP_005899298.1|  PREDICTED: alpha-N-acetylglucosaminidase           126   4e-29    
ref|NP_000254.2|  alpha-N-acetylglucosaminidase precursor               127   5e-29    
gb|AAC50512.1|  alpha-N-acetylglucosaminidase                           127   5e-29    
ref|XP_005321936.1|  PREDICTED: alpha-N-acetylglucosaminidase           127   5e-29    
ref|WP_008505739.1|  alpha-N-acetylglucosaminidase                      127   5e-29    
ref|XP_010752614.1|  PREDICTED: alpha-N-acetylglucosaminidase           125   7e-29    
gb|ETE58649.1|  Alpha-N-acetylglucosaminidase                           128   7e-29    
ref|WP_005944776.1|  hypothetical protein                               126   7e-29    
ref|XP_006017759.1|  PREDICTED: alpha-N-acetylglucosaminidase           126   7e-29    
ref|XP_007618471.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    126   7e-29    
ref|WP_042131612.1|  hypothetical protein                               126   7e-29    
ref|WP_022507796.1|  alpha-N-acetylglucosaminidase                      126   7e-29    
ref|XP_007955960.1|  PREDICTED: alpha-N-acetylglucosaminidase           126   8e-29    
ref|XP_009281568.1|  PREDICTED: alpha-N-acetylglucosaminidase           125   8e-29    
ref|XP_011064974.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    126   9e-29    
ref|XP_006260477.1|  PREDICTED: alpha-N-acetylglucosaminidase           127   9e-29    
gb|EHH58149.1|  Alpha-N-acetylglucosaminidase                           125   9e-29    
ref|XP_005232780.1|  PREDICTED: alpha-N-acetylglucosaminidase           125   1e-28    
ref|XP_002942650.2|  PREDICTED: alpha-N-acetylglucosaminidase           125   1e-28    
ref|XP_003913130.1|  PREDICTED: alpha-N-acetylglucosaminidase           126   1e-28    
ref|XP_006924662.1|  PREDICTED: alpha-N-acetylglucosaminidase           126   1e-28    
ref|XP_005584302.1|  PREDICTED: alpha-N-acetylglucosaminidase           126   1e-28    
ref|WP_035658720.1|  alpha-N-acetylglucosaminidase                      126   1e-28    
ref|XP_003504701.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    126   1e-28    
ref|XP_688608.3|  PREDICTED: alpha-N-acetylglucosaminidase              126   1e-28    
ref|XP_011064972.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    126   1e-28    
ref|XP_011064973.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    125   1e-28    
gb|KFM01295.1|  Alpha-N-acetylglucosaminidase                           125   1e-28    
ref|XP_004365200.1|  lysosomal alpha-N-acetyl glucosaminidase           125   1e-28    
gb|EHH24987.1|  Alpha-N-acetylglucosaminidase                           125   1e-28    
gb|AAB88084.1|  Naglu                                                   125   2e-28    
ref|XP_006199287.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   2e-28    
ref|NP_038820.2|  alpha-N-acetylglucosaminidase precursor               125   2e-28    
gb|KDN55814.1|  alpha-N-acetylglucosaminidase                           125   2e-28    
ref|WP_025018807.1|  alpha-N-acetylglucosaminidase                      125   2e-28    
ref|XP_004390347.1|  PREDICTED: alpha-N-acetylglucosaminidase           125   2e-28    
ref|WP_013546018.1|  alpha-N-acetylglucosaminidase                      125   2e-28    
ref|WP_026997693.1|  alpha-N-acetylglucosaminidase                      125   3e-28    
ref|XP_005964937.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   3e-28    
ref|XP_004012979.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    125   3e-28    
ref|WP_005810563.1|  alpha-N-acetylglucosaminidase                      125   3e-28    
ref|WP_005823289.1|  alpha-N-acetylglucosaminidase                      125   3e-28    
ref|XP_004012978.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    125   3e-28    
ref|WP_032543363.1|  alpha-N-acetylglucosaminidase                      125   3e-28    
ref|WP_022011046.1|  glycoside hydrolase family 89                      124   3e-28    
ref|WP_005775364.1|  alpha-N-acetylglucosaminidase                      124   3e-28    
ref|WP_027324066.1|  alpha-N-acetylglucosaminidase                      124   3e-28    
ref|XP_009061231.1|  hypothetical protein LOTGIDRAFT_175910             122   3e-28    
ref|XP_010790118.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   3e-28    
ref|XP_010841403.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   3e-28    
ref|WP_016278136.1|  MULTISPECIES: alpha-N-acetylglucosaminidase        124   3e-28    
ref|XP_007535086.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   3e-28    
ref|XP_003584151.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   4e-28    
ref|WP_025866072.1|  alpha-N-acetylglucosaminidase                      124   4e-28    
ref|XP_005369092.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   4e-28    
ref|WP_028375569.1|  alpha-N-acetylglucosaminidase                      124   4e-28    
ref|XP_004599216.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   4e-28    
ref|WP_032539607.1|  alpha-N-acetylglucosaminidase                      124   5e-28    
ref|WP_032530236.1|  alpha-N-acetylglucosaminidase                      124   5e-28    
ref|WP_021987418.1|  hypothetical protein                               124   5e-28    
ref|WP_007564342.1|  alpha-N-acetylglucosaminidase                      124   7e-28    
ref|XP_005531528.1|  PREDICTED: alpha-N-acetylglucosaminidase           124   7e-28    
ref|WP_037256677.1|  hypothetical protein                               124   8e-28    
ref|XP_010967292.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   8e-28    
ref|XP_006175267.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   8e-28    
ref|XP_003698943.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    124   8e-28    
ref|XP_010633860.1|  PREDICTED: alpha-N-acetylglucosaminidase           122   9e-28    
ref|WP_009229637.1|  alpha-N-acetylglucosaminidase                      123   1e-27    
ref|XP_010980090.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   1e-27    
ref|XP_003414528.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   1e-27    
ref|WP_032536918.1|  MULTISPECIES: alpha-N-acetylglucosaminidase        123   1e-27    
ref|XP_005694378.1|  PREDICTED: alpha-N-acetylglucosaminidase           122   1e-27    
ref|WP_032592883.1|  alpha-N-acetylglucosaminidase                      120   1e-27    
ref|XP_010584033.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   1e-27    
ref|WP_018967225.1|  beta-glucosidase                                   124   2e-27    
ref|WP_044302151.1|  alpha-N-acetylglucosaminidase                      122   2e-27    
ref|XP_973259.1|  PREDICTED: alpha-N-acetylglucosaminidase isofor...    122   2e-27    
emb|CDQ63621.1|  unnamed protein product                                122   2e-27    
ref|XP_008191832.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    122   2e-27    
ref|WP_009236706.1|  beta-glucosidase                                   124   2e-27    
gb|EPY88172.1|  v-type proton ATPase subunit a isoform 1                123   2e-27    
ref|XP_002719212.1|  PREDICTED: alpha-N-acetylglucosaminidase           122   2e-27    
ref|XP_007087779.1|  PREDICTED: alpha-N-acetylglucosaminidase           123   2e-27    
ref|WP_042368952.1|  alpha-N-acetylglucosaminidase                      122   2e-27    
ref|XP_006559874.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      122   2e-27    
gb|KFO28536.1|  V-type proton ATPase 116 kDa subunit a isoform 1        123   2e-27    
ref|XP_006055805.1|  PREDICTED: alpha-N-acetylglucosaminidase           122   2e-27    
ref|XP_008047020.1|  PREDICTED: alpha-N-acetylglucosaminidase           121   2e-27    
ref|XP_006620136.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      122   3e-27    
ref|WP_005796336.1|  alpha-N-acetylglucosaminidase                      122   3e-27    
ref|XP_011413972.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    122   3e-27    
ref|XP_008556350.1|  PREDICTED: alpha-N-acetylglucosaminidase           122   4e-27    
ref|XP_004633968.1|  PREDICTED: alpha-N-acetylglucosaminidase           121   4e-27    
ref|WP_044071512.1|  hypothetical protein                               121   4e-27    
ref|XP_009524369.1|  hypothetical protein PHYSODRAFT_247428             122   4e-27    
ref|WP_025072935.1|  hypothetical protein                               121   4e-27    
ref|WP_032578733.1|  alpha-N-acetylglucosaminidase                      121   4e-27    
ref|XP_001606979.1|  PREDICTED: alpha-N-acetylglucosaminidase           121   4e-27    
ref|WP_022054582.1|  hypothetical protein                               121   5e-27    
ref|WP_029465255.1|  alpha-N-acetylglucosaminidase                      120   5e-27    
ref|WP_009125701.1|  alpha-N-acetylglucosaminidase                      121   5e-27    
ref|WP_036925473.1|  hypothetical protein                               121   6e-27    
ref|WP_032573566.1|  alpha-N-acetylglucosaminidase                      121   6e-27    
gb|EFA96954.1|  Alpha-N-acetylglucosaminidase (NAGLU)                   120   6e-27    
ref|WP_005813399.1|  alpha-N-acetylglucosaminidase                      120   6e-27    
ref|WP_042984772.1|  alpha-N-acetylglucosaminidase                      120   6e-27    
gb|EXZ02033.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...    120   7e-27    
ref|WP_032582321.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
gb|EYE47317.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...    120   7e-27    
ref|WP_032528740.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_005801474.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|XP_004609026.1|  PREDICTED: alpha-N-acetylglucosaminidase           121   7e-27    
gb|ETP17151.1|  hypothetical protein F441_08395                         121   7e-27    
ref|XP_008905189.1|  hypothetical protein PPTG_11777                    121   7e-27    
ref|WP_032599594.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_022347848.1|  MULTISPECIES: alpha-N-acetylglucosaminidase        120   7e-27    
ref|WP_032556169.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_011202102.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_009291551.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_032593361.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
gb|EXY71647.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...    119   7e-27    
ref|WP_042986407.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_032564220.1|  alpha-N-acetylglucosaminidase                      120   7e-27    
ref|WP_008658446.1|  MULTISPECIES: alpha-N-acetylglucosaminidase        120   8e-27    
ref|WP_005784698.1|  alpha-N-acetylglucosaminidase                      120   8e-27    
ref|WP_009136297.1|  alpha-N-acetylglucosaminidase                      120   8e-27    
gb|ADF51355.1|  predicted protein                                       120   8e-27    
ref|WP_025814828.1|  alpha-N-acetylglucosaminidase                      120   8e-27    
ref|WP_032572541.1|  alpha-N-acetylglucosaminidase                      120   8e-27    
ref|WP_039868596.1|  hypothetical protein                               120   8e-27    
ref|WP_032567947.1|  alpha-N-acetylglucosaminidase                      120   8e-27    
ref|WP_022393425.1|  alpha-N-acetylglucosaminidase (NAGLU)              120   8e-27    
ref|WP_032577544.1|  alpha-N-acetylglucosaminidase                      120   9e-27    
ref|WP_041579630.1|  alpha-N-acetylglucosaminidase                      120   9e-27    
ref|WP_008769378.1|  MULTISPECIES: alpha-N-acetylglucosaminidase        120   9e-27    
ref|WP_022047279.1|  hypothetical protein                               120   1e-26    
ref|XP_008111624.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    120   1e-26    
gb|ETL93871.1|  hypothetical protein L917_08068                         120   1e-26    
ref|WP_032532645.1|  alpha-N-acetylglucosaminidase                      120   1e-26    
gb|ETI47342.1|  hypothetical protein F443_08415                         120   1e-26    
ref|WP_032569775.1|  alpha-N-acetylglucosaminidase                      120   1e-26    
ref|WP_032602235.1|  hypothetical protein                               114   1e-26    
ref|WP_019945814.1|  hypothetical protein                               119   1e-26    
ref|WP_044532366.1|  alpha-N-acetylglucosaminidase                      120   1e-26    
ref|WP_044259345.1|  beta-glucosidase                                   120   2e-26    
ref|WP_044154925.1|  alpha-N-acetylglucosaminidase                      119   2e-26    
ref|XP_011266261.1|  PREDICTED: alpha-N-acetylglucosaminidase           119   2e-26    
gb|EDV06431.1|  Alpha-N-acetylglucosaminidase (NAGLU)                   119   2e-26    
ref|WP_021892361.1|  uncharacterized protein                            119   2e-26    
ref|WP_009130300.1|  hypothetical protein                               119   2e-26    
ref|XP_010384417.1|  PREDICTED: alpha-N-acetylglucosaminidase           119   3e-26    
ref|WP_035141001.1|  alpha-N-acetylglucosaminidase                      119   3e-26    
ref|XP_009094885.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    119   3e-26    
ref|XP_003467170.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    119   3e-26    
ref|WP_019149356.1|  hypothetical protein                               120   3e-26    
ref|WP_022471202.1|  alpha-N-acetylglucosaminidase family protein       119   3e-26    
ref|XP_009646990.1|  PREDICTED: alpha-N-acetylglucosaminidase           117   4e-26    
ref|WP_022322545.1|  alpha-N-acetylglucosaminidase (NAGLU)              118   4e-26    
ref|WP_008863225.1|  hypothetical protein                               119   4e-26    
ref|XP_006901783.1|  PREDICTED: alpha-N-acetylglucosaminidase           118   4e-26    
gb|KJF42829.1|  alpha-N-acetylglucosaminidase                           118   4e-26    
ref|WP_021930253.1|  hypothetical protein                               118   5e-26    
ref|WP_022019830.1|  uncharacterized protein                            118   6e-26    
dbj|BAD92767.1|  huntingtin interacting protein-1-related               115   6e-26    
ref|WP_022829666.1|  alpha-N-acetylglucosaminidase                      118   6e-26    
ref|WP_022146886.1|  hypothetical protein                               119   7e-26    
ref|WP_025065256.1|  beta-glucosidase                                   119   7e-26    
ref|XP_004824877.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    118   7e-26    
gb|ETO11259.1|  hypothetical protein RFI_26116                          116   7e-26    
gb|ETK87294.1|  hypothetical protein L915_08245                         118   7e-26    
gb|ETL40708.1|  hypothetical protein L916_08170                         118   7e-26    
gb|EFS30964.2|  hypothetical protein BSGG_1664                          117   8e-26    
ref|WP_005633489.1|  alpha-N-acetylglucosaminidase                      117   8e-26    
ref|WP_032853783.1|  alpha-N-acetylglucosaminidase                      117   8e-26    
ref|XP_004772740.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    117   8e-26    
ref|XP_004174728.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    117   8e-26    
ref|XP_006833764.1|  PREDICTED: alpha-N-acetylglucosaminidase           117   9e-26    
ref|XP_010899528.1|  PREDICTED: alpha-N-acetylglucosaminidase           117   9e-26    
ref|WP_002559220.1|  alpha-N-acetylglucosaminidase                      117   1e-25    
ref|XP_004772739.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    117   1e-25    
ref|XP_004534032.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      117   1e-25    
ref|XP_001357424.2|  GA12255                                            117   1e-25    
ref|WP_044625252.1|  alpha-N-acetylglucosaminidase                      117   1e-25    
ref|WP_034542471.1|  alpha-N-acetylglucosaminidase                      117   1e-25    
gb|ERI85525.1|  Alpha-N-acetylglucosaminidase                           117   1e-25    
gb|EFG19121.1|  alpha-N-acetylglucosaminidase (NAGLU)                   117   1e-25    
ref|WP_015532301.1|  Alpha-N-acetylglucosaminidase (NAGLU)              117   1e-25    
ref|WP_011965366.1|  alpha-N-acetylglucosaminidase                      117   1e-25    
ref|WP_005849126.1|  alpha-N-acetylglucosaminidase                      117   1e-25    
gb|KDS42638.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...    117   1e-25    
gb|KDR09306.1|  Alpha-N-acetylglucosaminidase                           117   1e-25    
ref|WP_008669385.1|  MULTISPECIES: alpha-N-acetylglucosaminidase        117   1e-25    
gb|KDS23321.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...    117   1e-25    
gb|EFV65959.1|  glycoside hydrolase family 89                           117   1e-25    



>ref|XP_009611357.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Nicotiana tomentosiformis]
Length=857

 Score =   451 bits (1160),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 248/291 (85%), Gaps = 5/291 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHT-----KAFVLT  717
            +EAAW+ILYHT+YNCTDGIADHNKDYIVEFPDWDPS  TG+D+   D +     +     
Sbjct  567  IEAAWDILYHTIYNCTDGIADHNKDYIVEFPDWDPSGKTGTDISGTDSSSQNRMQKLAGF  626

Query  716  HQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLS  537
               RRF   E SSSLP+PHLWYSTEDV+KALKLF+ AG EL+GSLTYRYDLVDL+RQSLS
Sbjct  627  QLNRRFLFFEKSSSLPKPHLWYSTEDVIKALKLFIDAGKELSGSLTYRYDLVDLSRQSLS  686

Query  536  KLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTE  357
            KLANQVYLD+I+AF  +D+KALS+HSQKFLQLIKDID LLAADD  LLGTWLESAK+L  
Sbjct  687  KLANQVYLDAISAFRREDSKALSLHSQKFLQLIKDIDKLLAADDNFLLGTWLESAKNLAM  746

Query  356  NSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRS  177
            NS+E KQYEWNARTQVTMWFD TKY +S+LHDYANKFWSGLLE+YYLPRASMYF  LS+S
Sbjct  747  NSDEKKQYEWNARTQVTMWFDNTKYNKSQLHDYANKFWSGLLEAYYLPRASMYFKLLSKS  806

Query  176  LNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            L E ++FK+EEWRKEWIA+S KWQ  +ELYPVKAQG+ALAIA AL++KYFS
Sbjct  807  LEEKMDFKLEEWRKEWIAYSNKWQESTELYPVKAQGNALAIATALFEKYFS  857



>ref|XP_009758541.1| PREDICTED: alpha-N-acetylglucosaminidase [Nicotiana sylvestris]
Length=809

 Score =   446 bits (1148),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 215/291 (74%), Positives = 247/291 (85%), Gaps = 5/291 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHT-----KAFVLT  717
            ++AAW+ILYHT+YNCTDGIADHNKDYIVEFPDWDPS  TG+D+   D +     +     
Sbjct  519  IQAAWDILYHTIYNCTDGIADHNKDYIVEFPDWDPSGKTGTDISGTDSSSQNRMQKLAGF  578

Query  716  HQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLS  537
               RRF   E SSSLP+PHLWYSTEDV+KAL+LF+ AG EL+GSLTYRYDLVDL+RQSLS
Sbjct  579  QWNRRFLFFEKSSSLPKPHLWYSTEDVIKALQLFIDAGKELSGSLTYRYDLVDLSRQSLS  638

Query  536  KLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTE  357
            KLANQVYLD+I+AF  +DAKA+S HSQKFLQLIKDID LLAADD  LLGTWLESA++L  
Sbjct  639  KLANQVYLDAISAFRREDAKAVSQHSQKFLQLIKDIDRLLAADDNFLLGTWLESAQNLAM  698

Query  356  NSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRS  177
            NS+E KQYEWNARTQ+TMWFD TKY QS+LHDYANKFWSGLLE+YYLPRAS+YF  LS+S
Sbjct  699  NSDEKKQYEWNARTQITMWFDNTKYNQSQLHDYANKFWSGLLEAYYLPRASIYFELLSKS  758

Query  176  LNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            L E V+FK+EEWRKEWIA+S KWQ  +ELYPVKAQGDALAIA AL++KYFS
Sbjct  759  LKEKVDFKLEEWRKEWIAYSNKWQESTELYPVKAQGDALAIATALFEKYFS  809



>ref|XP_006345419.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum tuberosum]
Length=807

 Score =   444 bits (1143),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 218/291 (75%), Positives = 243/291 (84%), Gaps = 5/291 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGS-----DMPENDHTKAFVLT  717
            +EAAWEILYHT+YNCTDGIA HN DYIV+FPDWDPS  TG+     DM   +  +     
Sbjct  517  IEAAWEILYHTIYNCTDGIAFHNTDYIVKFPDWDPSGKTGTGISGTDMSNQNRMQQLSGF  576

Query  716  HQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLS  537
               RRF   E SSSLP+PHLWYSTEDV+KALKLFL AG EL+GSLTYRYDLVDLTRQSLS
Sbjct  577  QWNRRFLFSEKSSSLPKPHLWYSTEDVIKALKLFLDAGKELSGSLTYRYDLVDLTRQSLS  636

Query  536  KLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTE  357
            KLANQVYLD+I+AF ++DAKALS+HSQKFLQLIKDID LLAADD  LLGTWLESAK+L  
Sbjct  637  KLANQVYLDAISAFHHEDAKALSLHSQKFLQLIKDIDKLLAADDNFLLGTWLESAKNLAM  696

Query  356  NSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRS  177
            NS+ETKQYEWNARTQ+TMW+D  KY QSKLHDYANKFWSGLLE+YYLPRASMYF  LSRS
Sbjct  697  NSDETKQYEWNARTQITMWYDNAKYNQSKLHDYANKFWSGLLEAYYLPRASMYFKLLSRS  756

Query  176  LNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            L E ++F + EWRKEWIA+S KWQ  +ELYPVKAQGDALAIA  LY+KYFS
Sbjct  757  LEEKLDFSLLEWRKEWIAYSNKWQESTELYPVKAQGDALAIATVLYEKYFS  807



>ref|XP_010324692.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Solanum 
lycopersicum]
Length=744

 Score =   439 bits (1130),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 216/291 (74%), Positives = 240/291 (82%), Gaps = 5/291 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPT-----GSDMPENDHTKAFVLT  717
            +EAAWEILYHT+YNCTDGIA HN DYIV+FPDWDPS  T     G+DM   +  +     
Sbjct  454  IEAAWEILYHTIYNCTDGIAFHNTDYIVKFPDWDPSGKTETGISGTDMSNQNGMQQLAGF  513

Query  716  HQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLS  537
               RRF   E SSSLP+PHLWYSTEDV+KALKLFL AG EL+GSLTYRYDLVDLTRQSLS
Sbjct  514  QWNRRFLFSEKSSSLPKPHLWYSTEDVIKALKLFLDAGKELSGSLTYRYDLVDLTRQSLS  573

Query  536  KLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTE  357
            KLANQVYLD+I+AF ++D KALS+HSQKFLQLIKDID LLAADD  LLGTWLESAK+L  
Sbjct  574  KLANQVYLDAISAFHHEDVKALSLHSQKFLQLIKDIDKLLAADDNFLLGTWLESAKNLAM  633

Query  356  NSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRS  177
            NS+E KQYEWNARTQ+TMW+D  KY QSKLHDYANKFWSGLLE+YYLPRASMYF  LSRS
Sbjct  634  NSDEMKQYEWNARTQITMWYDNGKYNQSKLHDYANKFWSGLLEAYYLPRASMYFKLLSRS  693

Query  176  LNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            L E V+F + EWRKEWIA+S KWQ   ELYPVKA+GDALAIA  LY+KYFS
Sbjct  694  LEEKVDFNLLEWRKEWIAYSNKWQESKELYPVKAKGDALAIATVLYEKYFS  744



>ref|XP_010324687.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Solanum 
lycopersicum]
Length=807

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/291 (74%), Positives = 240/291 (82%), Gaps = 5/291 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPT-----GSDMPENDHTKAFVLT  717
            +EAAWEILYHT+YNCTDGIA HN DYIV+FPDWDPS  T     G+DM   +  +     
Sbjct  517  IEAAWEILYHTIYNCTDGIAFHNTDYIVKFPDWDPSGKTETGISGTDMSNQNGMQQLAGF  576

Query  716  HQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLS  537
               RRF   E SSSLP+PHLWYSTEDV+KALKLFL AG EL+GSLTYRYDLVDLTRQSLS
Sbjct  577  QWNRRFLFSEKSSSLPKPHLWYSTEDVIKALKLFLDAGKELSGSLTYRYDLVDLTRQSLS  636

Query  536  KLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTE  357
            KLANQVYLD+I+AF ++D KALS+HSQKFLQLIKDID LLAADD  LLGTWLESAK+L  
Sbjct  637  KLANQVYLDAISAFHHEDVKALSLHSQKFLQLIKDIDKLLAADDNFLLGTWLESAKNLAM  696

Query  356  NSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRS  177
            NS+E KQYEWNARTQ+TMW+D  KY QSKLHDYANKFWSGLLE+YYLPRASMYF  LSRS
Sbjct  697  NSDEMKQYEWNARTQITMWYDNGKYNQSKLHDYANKFWSGLLEAYYLPRASMYFKLLSRS  756

Query  176  LNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            L E V+F + EWRKEWIA+S KWQ   ELYPVKA+GDALAIA  LY+KYFS
Sbjct  757  LEEKVDFNLLEWRKEWIAYSNKWQESKELYPVKAKGDALAIATVLYEKYFS  807



>ref|XP_007052479.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 2 
[Theobroma cacao]
 gb|EOX96636.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 2 
[Theobroma cacao]
Length=621

 Score =   429 bits (1104),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 235/286 (82%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AWEILYHTVYNCTDGIADHN D+IV+FPDWDPS  +GS   + D+        + RR
Sbjct  336  IEEAWEILYHTVYNCTDGIADHNTDFIVKFPDWDPSTNSGSQTSKLDNMHKLHTITENRR  395

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ET S LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  396  FLFQETISDLPQAHLWYSTHEVVNALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  455

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ AF  KD KAL+VHSQKFLQLIKDID+LLA+DD  LLGTWLESAK+L EN +E 
Sbjct  456  VYLDAVKAFRRKDVKALNVHSQKFLQLIKDIDILLASDDNFLLGTWLESAKTLAENPSEM  515

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFDTT   QSKLHDYANKFWSGLLE YYLPRAS YF+ LS+SL EN 
Sbjct  516  QQYEWNARTQVTMWFDTTTTNQSKLHDYANKFWSGLLEGYYLPRASSYFSCLSKSLKENE  575

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRKEW+AFS KWQ G ELYP+KA+GD L+IA AL++KYF+
Sbjct  576  SFKLVEWRKEWVAFSNKWQEGVELYPLKAKGDFLSIAKALFEKYFN  621



>emb|CDP19299.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/285 (72%), Positives = 239/285 (84%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAWEIL+ T+YNCTDG+ADHN DYIV+FPDWDP+  + SD+ + +  +     ++ RR
Sbjct  524  IEAAWEILHRTIYNCTDGVADHNTDYIVQFPDWDPTLHSRSDLHQENQMQKIPGIYRNRR  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E SS L QPHLWY T+D + ALKLFL AG ELAGSLTYRYDLVDLTRQSLSKLANQ
Sbjct  584  FMLHEISSPLTQPHLWYDTQDAIAALKLFLDAGNELAGSLTYRYDLVDLTRQSLSKLANQ  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I+AF NKDA AL V SQ+FLQLIKDIDVLLAADD  LLG+WLESAKSL  NS+E 
Sbjct  644  VYLDAISAFQNKDANALVVQSQRFLQLIKDIDVLLAADDNFLLGSWLESAKSLAVNSDEA  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFD TKY+QSKLHDYANKFWSGLL+ YY PRASMYF+HLS+SL+E+ 
Sbjct  704  KQYEWNARTQVTMWFDNTKYIQSKLHDYANKFWSGLLQGYYFPRASMYFSHLSKSLSEDK  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +E+WRKEWIA+S +WQ G+E YPVKAQGDALA+A  LY+KY 
Sbjct  764  AFSLEDWRKEWIAYSNEWQAGTEHYPVKAQGDALALAKDLYEKYL  808



>ref|XP_007052478.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
 gb|EOX96635.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
Length=809

 Score =   429 bits (1103),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 235/286 (82%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AWEILYHTVYNCTDGIADHN D+IV+FPDWDPS  +GS   + D+        + RR
Sbjct  524  IEEAWEILYHTVYNCTDGIADHNTDFIVKFPDWDPSTNSGSQTSKLDNMHKLHTITENRR  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ET S LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  584  FLFQETISDLPQAHLWYSTHEVVNALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ AF  KD KAL+VHSQKFLQLIKDID+LLA+DD  LLGTWLESAK+L EN +E 
Sbjct  644  VYLDAVKAFRRKDVKALNVHSQKFLQLIKDIDILLASDDNFLLGTWLESAKTLAENPSEM  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFDTT   QSKLHDYANKFWSGLLE YYLPRAS YF+ LS+SL EN 
Sbjct  704  QQYEWNARTQVTMWFDTTTTNQSKLHDYANKFWSGLLEGYYLPRASSYFSCLSKSLKENE  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRKEW+AFS KWQ G ELYP+KA+GD L+IA AL++KYF+
Sbjct  764  SFKLVEWRKEWVAFSNKWQEGVELYPLKAKGDFLSIAKALFEKYFN  809



>ref|XP_002517785.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
 gb|EEF44592.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Length=360

 Score =   413 bits (1062),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 234/287 (82%), Gaps = 1/287 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEILYHT+YNCTDGIADHN D+IV+FPDWDPS  +GSD  + D+   F+     RR
Sbjct  74   VEAAWEILYHTIYNCTDGIADHNTDFIVKFPDWDPSVQSGSDTSQQDNKHIFLHRSGSRR  133

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F     +S+LPQ H+WYS + V+ AL+LF+  G+ L GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  134  FLFEGPNSTLPQAHIWYSIQKVINALQLFIDGGSHLTGSLTYRYDLVDLTRQVLSKLANQ  193

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D+I AF + DA+AL++HSQKF+QLIKDIDVLLA+DD  L+GTWLESAK L  N +E 
Sbjct  194  VYVDAIIAFRSNDARALNLHSQKFIQLIKDIDVLLASDDNFLIGTWLESAKELALNPSEM  253

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+DTTK  QSKLHDYANKFWSGLLE YYLPRAS YF+HL +SL +N 
Sbjct  254  RQYEWNARTQVTMWYDTTKTNQSKLHDYANKFWSGLLEDYYLPRASTYFDHLVKSLKQNE  313

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQG-DALAIANALYQKYFS  24
            +FK++EWR++WIAFS +WQ G++LYP+K  G DALAI+ ALY KYF 
Sbjct  314  KFKLQEWREKWIAFSNEWQAGTKLYPMKGSGDDALAISKALYDKYFG  360



>gb|KJB24985.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=621

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 231/286 (81%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDGIADHN D+IV+FPDWDPS   GS   + +    F L  + RR
Sbjct  336  IKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRLRTRSRR  395

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E SS LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  396  FSFQERSSDLPQAHLWYSTHEVVSALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  455

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I AF  KD KAL++HSQKF+QLIKDIDVLLA+DD  LLGTWLESAK L EN +E 
Sbjct  456  VYLDAINAFRRKDVKALNIHSQKFIQLIKDIDVLLASDDNFLLGTWLESAKLLAENPSEM  515

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFDTT   QSKLHDYANKFWSGLLE YYLPRAS YF++LS+SL +N 
Sbjct  516  RQYEWNARTQVTMWFDTTPTNQSKLHDYANKFWSGLLEGYYLPRASSYFSYLSKSLEKNE  575

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRK+W++FS KWQ G ELYPVKAQG+ L IA AL+ KY S
Sbjct  576  SFKLVEWRKQWVSFSNKWQAGLELYPVKAQGNFLTIAKALFDKYLS  621



>ref|XP_008375201.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Malus domestica]
Length=412

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 233/285 (82%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAW+IL+ T+YNCTDGIADHN D+IV+ PDWDPS    S++ + +  ++F+   ++RR
Sbjct  124  VEAAWDILHQTIYNCTDGIADHNTDFIVKLPDWDPSPNHISNISKQNQMQSFIPLDKKRR  183

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L +TSS+LPQ HLWYST++V+ AL+LFL  G E +GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  184  VLLQKTSSNLPQAHLWYSTQEVVNALRLFLDTGNEFSGSLTYRYDLVDLTRQVLSKLANQ  243

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ A+  +D KA S HSQKF+QLI DID LLA+DD  LLGTWLESAK+L  N  E 
Sbjct  244  VYLDAVTAYRRRDVKAYSHHSQKFVQLIMDIDELLASDDNFLLGTWLESAKNLAANPTEM  303

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFD TK  QS+LHDYANKFWSGLL+SYYLPRAS YF  LS+SL +N 
Sbjct  304  QQYEWNARTQVTMWFDNTKTNQSRLHDYANKFWSGLLKSYYLPRASTYFGLLSKSLRDNK  363

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F++EEWRKEWIA+S  WQ G+ELY VKA+GDALAI+ ALY+KYF
Sbjct  364  DFELEEWRKEWIAYSNNWQAGTELYRVKAKGDALAISKALYEKYF  408



>emb|CAA77084.1| alpha-N-acetylglucosaminidase [Nicotiana tabacum]
Length=811

 Score =   419 bits (1077),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 240/292 (82%), Gaps = 6/292 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHT-----KAFVLT  717
            ++AAW+ILYHT+YNCTDGIADHNKDYIVEFPDWDPS  TG+D+   D +     +     
Sbjct  520  IQAAWDILYHTIYNCTDGIADHNKDYIVEFPDWDPSGKTGTDISGTDSSSQNRMQKLAGF  579

Query  716  HQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLS  537
               RRF   E SSSLP+P LWYSTEDV +AL+LF+ A  +L+GSLTYRYDLVDL+RQSLS
Sbjct  580  QWNRRFLFFEKSSSLPKPRLWYSTEDVFQALQLFIDALKKLSGSLTYRYDLVDLSRQSLS  639

Query  536  KLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA-KSLT  360
            KLANQVYLD+I+AF  +DAK L+ HS KFL L++DID LLAADD  LLGTWLE+  ++L 
Sbjct  640  KLANQVYLDAISAFRREDAKPLNQHSPKFLPLLQDIDRLLAADDNFLLGTWLENCPQNLA  699

Query  359  ENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSR  180
             NS+E KQYEWNARTQ+TMWFD TKY QS+LHDYANKFWSGLLE+YYLPRAS+YF  LS+
Sbjct  700  MNSDEKKQYEWNARTQITMWFDNTKYNQSQLHDYANKFWSGLLEAYYLPRASIYFELLSK  759

Query  179  SLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            SL E V+FK+EEWRKEWIA+S KWQ  +ELYPVKAQGDALAIA AL++KYFS
Sbjct  760  SLKEKVDFKLEEWRKEWIAYSNKWQESTELYPVKAQGDALAIATALFEKYFS  811



>gb|KJB24984.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=784

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 231/286 (81%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDGIADHN D+IV+FPDWDPS   GS   + +    F L  + RR
Sbjct  499  IKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRLRTRSRR  558

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E SS LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  559  FSFQERSSDLPQAHLWYSTHEVVSALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  618

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I AF  KD KAL++HSQKF+QLIKDIDVLLA+DD  LLGTWLESAK L EN +E 
Sbjct  619  VYLDAINAFRRKDVKALNIHSQKFIQLIKDIDVLLASDDNFLLGTWLESAKLLAENPSEM  678

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFDTT   QSKLHDYANKFWSGLLE YYLPRAS YF++LS+SL +N 
Sbjct  679  RQYEWNARTQVTMWFDTTPTNQSKLHDYANKFWSGLLEGYYLPRASSYFSYLSKSLEKNE  738

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRK+W++FS KWQ G ELYPVKAQG+ L IA AL+ KY S
Sbjct  739  SFKLVEWRKQWVSFSNKWQAGLELYPVKAQGNFLTIAKALFDKYLS  784



>ref|XP_002314048.1| hypothetical protein POPTR_0009s06320g [Populus trichocarpa]
 gb|EEE88003.1| hypothetical protein POPTR_0009s06320g [Populus trichocarpa]
Length=806

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 234/286 (82%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V AAW+ILYHT+YNCTDGIADHN D+IV+FPDWDPS  +GS++ E D+ +  + +   RR
Sbjct  521  VVAAWDILYHTIYNCTDGIADHNTDFIVKFPDWDPSLHSGSNISEQDNMRILLTSSGTRR  580

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ETSS  P+ HLWYST++V++AL LFL AG +LAGS TYRYDLVDLTRQ LSKLANQ
Sbjct  581  FLFQETSSDFPEAHLWYSTQEVIQALWLFLDAGNDLAGSPTYRYDLVDLTRQVLSKLANQ  640

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY D++ AF  KDA+AL++H QKFLQ+IKDIDVLLA+DD  LLGTWLESAK L  + N+ 
Sbjct  641  VYRDAMIAFRRKDARALNLHGQKFLQIIKDIDVLLASDDNFLLGTWLESAKKLAVDPNDM  700

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            K YEWNARTQVTMW+DTTK  QS+LHDYANKFWSGLLE YYLPRAS YF HL +SL EN 
Sbjct  701  KLYEWNARTQVTMWYDTTKTNQSQLHDYANKFWSGLLEDYYLPRASTYFGHLMKSLEENK  760

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRKEWIAFS KWQ  +++YPVKA+GDALAIA ALY+KYF 
Sbjct  761  NFKLTEWRKEWIAFSNKWQADTKIYPVKAKGDALAIAKALYRKYFG  806



>gb|KJB24982.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=820

 Score =   417 bits (1072),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 231/286 (81%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDGIADHN D+IV+FPDWDPS   GS   + +    F L  + RR
Sbjct  535  IKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRLRTRSRR  594

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E SS LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  595  FSFQERSSDLPQAHLWYSTHEVVSALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  654

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I AF  KD KAL++HSQKF+QLIKDIDVLLA+DD  LLGTWLESAK L EN +E 
Sbjct  655  VYLDAINAFRRKDVKALNIHSQKFIQLIKDIDVLLASDDNFLLGTWLESAKLLAENPSEM  714

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFDTT   QSKLHDYANKFWSGLLE YYLPRAS YF++LS+SL +N 
Sbjct  715  RQYEWNARTQVTMWFDTTPTNQSKLHDYANKFWSGLLEGYYLPRASSYFSYLSKSLEKNE  774

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRK+W++FS KWQ G ELYPVKAQG+ L IA AL+ KY S
Sbjct  775  SFKLVEWRKQWVSFSNKWQAGLELYPVKAQGNFLTIAKALFDKYLS  820



>ref|XP_007218923.1| hypothetical protein PRUPE_ppa001555mg [Prunus persica]
 gb|EMJ20122.1| hypothetical protein PRUPE_ppa001555mg [Prunus persica]
Length=803

 Score =   416 bits (1070),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 236/286 (83%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEIL+HT+YNCTDGIADHN D+IV+FPDWDPS    S++ + +  +  +   ++RR
Sbjct  518  VEAAWEILHHTIYNCTDGIADHNTDFIVKFPDWDPSSNPISNITKQNQMQMLLALDRKRR  577

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L ETS+ LPQ HLWYST++V+ AL+LFL  G +L+GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  578  VLLQETSAHLPQAHLWYSTQEVVNALRLFLDGGNDLSGSLTYRYDLVDLTRQVLSKLANQ  637

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ A+  +D KA S+HS+ F+QLIKDIDVLLA+DD  LLGTWLESAK L  N  E 
Sbjct  638  VYVDAVTAYQGRDVKAYSLHSRNFVQLIKDIDVLLASDDNFLLGTWLESAKKLAANPTER  697

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFD TK  QSKLHDYANKFWSGLL SYYLPRAS YF++LS+SL +N 
Sbjct  698  RQYEWNARTQVTMWFDNTKTNQSKLHDYANKFWSGLLGSYYLPRASTYFSYLSKSLRDNK  757

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F+VEEWRKEWI+ S  WQ G+ELYPVKA+GDALAI+ ALY+KYFS
Sbjct  758  DFEVEEWRKEWISLSNGWQAGTELYPVKAKGDALAISRALYKKYFS  803



>ref|XP_008231468.1| PREDICTED: alpha-N-acetylglucosaminidase [Prunus mume]
Length=803

 Score =   416 bits (1068),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 235/286 (82%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEIL+HT+YNCTDGIADHN D+IV+FPDWDPS    S++ + +  +  +   ++RR
Sbjct  518  VEAAWEILHHTIYNCTDGIADHNTDFIVKFPDWDPSSNPISNITKQNQMQMLLALDRKRR  577

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L ETS+ LPQ HLWYST++V+ AL+LFL  G +L+GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  578  VLLQETSAHLPQAHLWYSTQEVVNALRLFLDGGNDLSGSLTYRYDLVDLTRQVLSKLANQ  637

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ A+  +D KA S+HS+ F+QLIKDIDVLLA+DD  LLGTWLESAK L  N  E 
Sbjct  638  VYVDAVTAYQGRDVKAYSLHSRNFVQLIKDIDVLLASDDNFLLGTWLESAKKLAANPTER  697

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFD TK  QSKLHDYANKFWSGLL SYYLPRAS YF++LS+SL  N 
Sbjct  698  RQYEWNARTQVTMWFDNTKTNQSKLHDYANKFWSGLLGSYYLPRASTYFSYLSKSLRVNK  757

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F+VEEWRKEWI+ S  WQ G+ELYPVKA+GDALAI+ ALY+KYFS
Sbjct  758  DFEVEEWRKEWISLSNGWQAGTELYPVKAKGDALAISRALYKKYFS  803



>ref|XP_011025477.1| PREDICTED: alpha-N-acetylglucosaminidase [Populus euphratica]
Length=806

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 231/286 (81%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V AAW+ILY TVYNCTDGIADHN D+IV+FPDWDPS  +GS++ + D+ +  + +   RR
Sbjct  521  VVAAWDILYRTVYNCTDGIADHNTDFIVKFPDWDPSLNSGSNISQQDNMRIHLTSSGTRR  580

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E SS  P+ HLWYST++V++AL LFL AG +  GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  581  FLFQEKSSDFPEAHLWYSTKEVIQALWLFLDAGNDFVGSLTYRYDLVDLTRQVLSKLANQ  640

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY D++ AF  KDA+AL++H QKFLQ+IKDIDVLLA+DD  LLGTWLESAK L  + N+ 
Sbjct  641  VYRDAMIAFRRKDARALNLHGQKFLQIIKDIDVLLASDDNFLLGTWLESAKKLAVDPNDM  700

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            K YEWNARTQVTMW+DTTK  QS+LHDYANKFWSGLLE YYLPRAS YF HL +SL EN 
Sbjct  701  KLYEWNARTQVTMWYDTTKTNQSQLHDYANKFWSGLLEDYYLPRASTYFGHLMKSLEENK  760

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRKEWIAFS KWQ  +++YPVKA+GDALAIA ALY+KYF 
Sbjct  761  NFKLTEWRKEWIAFSNKWQADTKIYPVKAKGDALAIAKALYRKYFG  806



>ref|XP_009368036.1| PREDICTED: alpha-N-acetylglucosaminidase [Pyrus x bretschneideri]
Length=808

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 234/285 (82%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAW+IL+ T+YNCTDGIADHN D+IV+ PDWDPS    S++ + +  ++F+L  ++RR
Sbjct  520  VEAAWDILHRTIYNCTDGIADHNTDFIVKLPDWDPSPNHISNISKQNQMQSFILLDKKRR  579

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L +TSS+LPQ HLWYST++V+ AL+LFL  G E +GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  580  VLLQKTSSNLPQAHLWYSTQEVVNALRLFLDTGNEFSGSLTYRYDLVDLTRQVLSKLANQ  639

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ A+  +D KA S HSQKF+QLI DID LLA+DD  LLGTWLESAK+L  N  E 
Sbjct  640  VYLDAVTAYRRRDVKAYSHHSQKFVQLIMDIDELLASDDNFLLGTWLESAKNLAANPTEM  699

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFD TK  QS+LHDYANKFWSGLL+SYYLPRAS YF  LS+SL +N 
Sbjct  700  QQYEWNARTQVTMWFDNTKTNQSRLHDYANKFWSGLLKSYYLPRASTYFGLLSKSLRDNE  759

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +FK+EEWR+EWIAFS  WQ G+ELY VKA+GDALAI+ ALY+KYF
Sbjct  760  DFKLEEWRREWIAFSNNWQAGTELYRVKAKGDALAISKALYEKYF  804



>ref|XP_010659443.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Vitis vinifera]
Length=715

 Score =   406 bits (1043),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 229/287 (80%), Gaps = 1/287 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQ-RR  705
            VEAAWEILY T+YNCTDGIADHN D++V FPDWDPS    SD+ +  H    +LT   RR
Sbjct  429  VEAAWEILYRTIYNCTDGIADHNTDFMVNFPDWDPSLNPSSDISKEQHIIQKILTQTGRR  488

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +    ETSS LPQ HLWYST +V+ AL+LFL AG EL+ S TYRYDLVDLTRQ LSKL N
Sbjct  489  KILFQETSSDLPQSHLWYSTHEVVNALRLFLDAGNELSKSSTYRYDLVDLTRQVLSKLGN  548

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVYLD++ AF  KDAK   +HSQKF+QL+KDID LLA+DD  LLGTWLESAK L  N  E
Sbjct  549  QVYLDAVIAFRQKDAKNFHLHSQKFVQLVKDIDTLLASDDNFLLGTWLESAKKLAVNPRE  608

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             +QYEWNARTQ+TMWF  TK  QSKLHDYANKFWSGLLE+YYLPRASMYF++L+++L EN
Sbjct  609  MEQYEWNARTQLTMWFYVTKTNQSKLHDYANKFWSGLLENYYLPRASMYFSYLAKALTEN  668

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
              FK+EEWR+EWI++S KWQ G ELYPV+A+GD LAI+ ALY+KYF+
Sbjct  669  KNFKLEEWRREWISYSNKWQAGKELYPVRAKGDTLAISRALYEKYFN  715



>gb|KDP43563.1| hypothetical protein JCGZ_16850 [Jatropha curcas]
Length=811

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 234/286 (82%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAW+IL+ T+YNCTDGIADHN D+IV+FPDWDPS  +GS++ +     +F+     RR
Sbjct  526  VEAAWKILHRTIYNCTDGIADHNTDFIVKFPDWDPSANSGSEVSKEVEIHSFLPIPGTRR  585

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E +S LP+ HLWY+T++V+ AL+LFL AG +L GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  586  FLFQEPNSKLPRAHLWYATQEVVNALQLFLDAGNDLLGSLTYRYDLVDLTRQVLSKLANQ  645

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             Y+DSI AF  KDA AL++HS+KF+QLIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  646  AYIDSIIAFQRKDANALNLHSRKFIQLIKDIDLLLASDDNFLLGTWLKSAKELAVNPSEM  705

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+DTTK  QSKLHDYANKFWSGLL+ YYLPRAS+YF+HL +SL  N 
Sbjct  706  RQYEWNARTQVTMWYDTTKTNQSKLHDYANKFWSGLLKDYYLPRASIYFDHLLKSLKGNK  765

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+EEWRKEWI FS KWQ  ++LYP+KA+GDALAI+  LY+KYF 
Sbjct  766  KFKIEEWRKEWIEFSNKWQADTKLYPMKAKGDALAISKVLYEKYFG  811



>ref|XP_002273084.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Vitis vinifera]
Length=803

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 229/287 (80%), Gaps = 1/287 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQ-RR  705
            VEAAWEILY T+YNCTDGIADHN D++V FPDWDPS    SD+ +  H    +LT   RR
Sbjct  517  VEAAWEILYRTIYNCTDGIADHNTDFMVNFPDWDPSLNPSSDISKEQHIIQKILTQTGRR  576

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +    ETSS LPQ HLWYST +V+ AL+LFL AG EL+ S TYRYDLVDLTRQ LSKL N
Sbjct  577  KILFQETSSDLPQSHLWYSTHEVVNALRLFLDAGNELSKSSTYRYDLVDLTRQVLSKLGN  636

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVYLD++ AF  KDAK   +HSQKF+QL+KDID LLA+DD  LLGTWLESAK L  N  E
Sbjct  637  QVYLDAVIAFRQKDAKNFHLHSQKFVQLVKDIDTLLASDDNFLLGTWLESAKKLAVNPRE  696

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             +QYEWNARTQ+TMWF  TK  QSKLHDYANKFWSGLLE+YYLPRASMYF++L+++L EN
Sbjct  697  MEQYEWNARTQLTMWFYVTKTNQSKLHDYANKFWSGLLENYYLPRASMYFSYLAKALTEN  756

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
              FK+EEWR+EWI++S KWQ G ELYPV+A+GD LAI+ ALY+KYF+
Sbjct  757  KNFKLEEWRREWISYSNKWQAGKELYPVRAKGDTLAISRALYEKYFN  803



>ref|XP_011469505.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Fragaria 
vesca subsp. vesca]
Length=645

 Score =   401 bits (1031),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 232/285 (81%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE AWEIL+ T+YNCTDGIADHN D+IV+FPDWDPS  + S+  E+     F    ++RR
Sbjct  360  VEEAWEILHRTIYNCTDGIADHNTDFIVKFPDWDPSLESVSNTSEHKRMHMFFSLDKKRR  419

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L  TSS  P+ HLWYST+DV+ AL+LFL AG +L+GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  420  FLLQTTSSQFPKAHLWYSTQDVINALQLFLDAGNDLSGSLTYRYDLVDLTRQVLSKLANQ  479

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KD KA  V+S+KF+QLIKDI+ LLA+DD  LLGTWLESAK L  +  E 
Sbjct  480  VYVDAVTAFQKKDVKAYDVNSKKFVQLIKDIEGLLASDDNFLLGTWLESAKKLATSPMEK  539

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+DTTK  QS+LHDYANKFWSGLLESYYLPRAS YF++LS+SL EN 
Sbjct  540  RQYEWNARTQVTMWYDTTKTNQSQLHDYANKFWSGLLESYYLPRASSYFHYLSKSLRENK  599

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+VE+WR EWI+FS  WQ G+ELYPVKA+G+ALAI+ ALY+KY 
Sbjct  600  DFEVEKWRTEWISFSNNWQAGTELYPVKAKGNALAISRALYKKYL  644



>emb|CBI24942.3| unnamed protein product [Vitis vinifera]
Length=868

 Score =   407 bits (1046),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 229/287 (80%), Gaps = 1/287 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQ-RR  705
            VEAAWEILY T+YNCTDGIADHN D++V FPDWDPS    SD+ +  H    +LT   RR
Sbjct  582  VEAAWEILYRTIYNCTDGIADHNTDFMVNFPDWDPSLNPSSDISKEQHIIQKILTQTGRR  641

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +    ETSS LPQ HLWYST +V+ AL+LFL AG EL+ S TYRYDLVDLTRQ LSKL N
Sbjct  642  KILFQETSSDLPQSHLWYSTHEVVNALRLFLDAGNELSKSSTYRYDLVDLTRQVLSKLGN  701

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVYLD++ AF  KDAK   +HSQKF+QL+KDID LLA+DD  LLGTWLESAK L  N  E
Sbjct  702  QVYLDAVIAFRQKDAKNFHLHSQKFVQLVKDIDTLLASDDNFLLGTWLESAKKLAVNPRE  761

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             +QYEWNARTQ+TMWF  TK  QSKLHDYANKFWSGLLE+YYLPRASMYF++L+++L EN
Sbjct  762  MEQYEWNARTQLTMWFYVTKTNQSKLHDYANKFWSGLLENYYLPRASMYFSYLAKALTEN  821

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
              FK+EEWR+EWI++S KWQ G ELYPV+A+GD LAI+ ALY+KYF+
Sbjct  822  KNFKLEEWRREWISYSNKWQAGKELYPVRAKGDTLAISRALYEKYFN  868



>gb|KHM99190.1| Alpha-N-acetylglucosaminidase [Glycine soja]
Length=807

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 230/285 (81%), Gaps = 2/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE+AWEILYHT+YNCTDGIADHN D+IV FPDW+PS  T S    +++ K ++L    RR
Sbjct  518  VESAWEILYHTIYNCTDGIADHNHDFIVMFPDWNPS--TNSVTGTSNNQKIYLLPPGNRR  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            +   ET S +PQ HLWY ++DV+KAL+LFLA G  LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  576  YLFQETLSDMPQAHLWYPSDDVIKALQLFLAGGKNLAGSLTYRYDLVDLTRQVLSKLANQ  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY  ++ ++  K+ +AL  HS KFLQLIKDIDVLLA+DD  LLGTWLESAK L  N +E 
Sbjct  636  VYHKAVTSYQKKNIEALQFHSNKFLQLIKDIDVLLASDDNFLLGTWLESAKKLAVNPSEI  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSGLLESYYLPRAS YF+HL+ SL +N 
Sbjct  696  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGLLESYYLPRASTYFSHLTESLRQND  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +FK+ EWRK+WI+ S KWQ G+ELYPVKA+GDAL I+ ALY+KYF
Sbjct  756  KFKLIEWRKQWISQSNKWQEGNELYPVKAKGDALTISQALYEKYF  800



>ref|XP_010257140.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Nelumbo 
nucifera]
Length=676

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 227/286 (79%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW ILY T+YNCTDGIADHN+D+IV+FPDWDPS    +++ + +  +   +  + RR
Sbjct  391  MEEAWGILYRTIYNCTDGIADHNRDFIVQFPDWDPSLKPKAELSKQEQMQNPFMRDRTRR  450

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ET S L QPHLWYSTE+V+ AL LFL AG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  451  FSFRETISFLTQPHLWYSTEEVIYALHLFLDAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  510

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KD K+L+  SQKF QLIKDID LLA DD  LLGTWLESAK L EN  E 
Sbjct  511  VYMDAVTAFQQKDIKSLNFQSQKFAQLIKDIDTLLACDDNFLLGTWLESAKRLAENPKEM  570

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQVTMW+D T+  QSKLHDYANKFWSG+LESYYLPRAS YF++L +SL ENV
Sbjct  571  IQYEWNARTQVTMWYDNTQNNQSKLHDYANKFWSGILESYYLPRASTYFSYLLKSLRENV  630

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWR+EWI+FS +WQ G ELYPVKAQGDAL ++  L++KY +
Sbjct  631  TFELEEWRREWISFSNRWQAGRELYPVKAQGDALTVSKELFKKYLT  676



>ref|XP_003535842.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Glycine 
max]
Length=807

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 230/285 (81%), Gaps = 2/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE+AWEILYHT+YNCTDGIADHN D+IV FPDW+PS  T S    +++ K ++L    RR
Sbjct  518  VESAWEILYHTIYNCTDGIADHNHDFIVMFPDWNPS--TNSVTGTSNNQKIYLLPPGNRR  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            +   ET S +PQ HLWY ++DV+KAL+LFLA G  LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  576  YLFQETLSDMPQAHLWYPSDDVIKALQLFLAGGKNLAGSLTYRYDLVDLTRQVLSKLANQ  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY  ++ ++  K+ +AL  HS KFLQLIKDIDVLLA+DD  LLGTWLESAK L  N +E 
Sbjct  636  VYHKAVTSYQKKNIEALQFHSNKFLQLIKDIDVLLASDDNFLLGTWLESAKKLAVNPSEI  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSGLLESYYLPRAS YF+HL+ SL +N 
Sbjct  696  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGLLESYYLPRASTYFSHLTESLRQND  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +FK+ EWRK+WI+ S KWQ G+ELYPVKA+GDAL I+ ALY+KYF
Sbjct  756  KFKLIEWRKQWISQSNKWQEGNELYPVKAKGDALTISQALYEKYF  800



>ref|XP_010097439.1| hypothetical protein L484_004673 [Morus notabilis]
 gb|EXB68327.1| hypothetical protein L484_004673 [Morus notabilis]
Length=802

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 229/286 (80%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEIL+ T+YNCTDGIADHN D+IV+FPDWDP     S+ P+ +  +  +    +RR
Sbjct  517  VEAAWEILHQTIYNCTDGIADHNTDFIVKFPDWDPEPNHKSNTPKRNRMQMILDLDVKRR  576

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L ++SS LPQ HLWYST +V+ ALKLF+ AGT  +GSLT+RYDLVDLTRQ+LSKLANQ
Sbjct  577  FLLQDSSSELPQAHLWYSTPEVINALKLFIDAGTNFSGSLTFRYDLVDLTRQALSKLANQ  636

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY +++ AF  KD  A   H QKF+QLIKDID+LLA+DD  LLGTWLESAK L  + +E 
Sbjct  637  VYTNAVIAFREKDVDACRYHGQKFVQLIKDIDMLLASDDNFLLGTWLESAKKLAVDPHER  696

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLLESYYLPRAS YFN+L +SL EN 
Sbjct  697  RQYEWNARTQVTMWYDNTKTNQSKLHDYANKFWSGLLESYYLPRASSYFNYLLKSLTENK  756

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+E+WR+EWI FS  WQ G+ +YPVKA+GDALAI+  LYQKYFS
Sbjct  757  KFKLEDWRREWILFSNNWQEGTGIYPVKAKGDALAISELLYQKYFS  802



>ref|XP_011087998.1| PREDICTED: alpha-N-acetylglucosaminidase [Sesamum indicum]
Length=809

 Score =   403 bits (1036),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 231/286 (81%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAW+IL+ T+YNCTDGIADHN DYIV+FPDWDPS        E +         Q+RR
Sbjct  524  VEAAWKILHRTIYNCTDGIADHNTDYIVKFPDWDPSVNNQHGRSEINQRHKLAGIQQQRR  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL ETSS+LP+PHLWY+ +D + ALKLFL AG ELAG  TYRYDLVDLTRQSLSKLAN+
Sbjct  584  FFLRETSSTLPRPHLWYNNQDAVSALKLFLDAGDELAGIPTYRYDLVDLTRQSLSKLANE  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYL++I AF +KD KALS HS KFLQL KDID LLAADD  LLGTWLESAK L+ N+ ET
Sbjct  644  VYLNAIHAFRDKDPKALSFHSLKFLQLTKDIDTLLAADDNFLLGTWLESAKKLSVNAEET  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQVTMW+D TKYVQSKLHDYANKFW+GLLE+YYLPRA+MYF  L +SL E  
Sbjct  704  NQYEWNARTQVTMWYDNTKYVQSKLHDYANKFWAGLLEAYYLPRAAMYFKRLLKSLEEKE  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            EFK+E+WR+EWIA+S KWQ G+ELYPV AQG+A AIA  LYQKY +
Sbjct  764  EFKLEDWREEWIAYSNKWQAGTELYPVTAQGNAFAIAKELYQKYLT  809



>ref|XP_011469504.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Fragaria 
vesca subsp. vesca]
Length=804

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 232/285 (81%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE AWEIL+ T+YNCTDGIADHN D+IV+FPDWDPS  + S+  E+     F    ++RR
Sbjct  519  VEEAWEILHRTIYNCTDGIADHNTDFIVKFPDWDPSLESVSNTSEHKRMHMFFSLDKKRR  578

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L  TSS  P+ HLWYST+DV+ AL+LFL AG +L+GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  579  FLLQTTSSQFPKAHLWYSTQDVINALQLFLDAGNDLSGSLTYRYDLVDLTRQVLSKLANQ  638

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KD KA  V+S+KF+QLIKDI+ LLA+DD  LLGTWLESAK L  +  E 
Sbjct  639  VYVDAVTAFQKKDVKAYDVNSKKFVQLIKDIEGLLASDDNFLLGTWLESAKKLATSPMEK  698

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+DTTK  QS+LHDYANKFWSGLLESYYLPRAS YF++LS+SL EN 
Sbjct  699  RQYEWNARTQVTMWYDTTKTNQSQLHDYANKFWSGLLESYYLPRASSYFHYLSKSLRENK  758

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+VE+WR EWI+FS  WQ G+ELYPVKA+G+ALAI+ ALY+KY 
Sbjct  759  DFEVEKWRTEWISFSNNWQAGTELYPVKAKGNALAISRALYKKYL  803



>ref|XP_010257138.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Nelumbo 
nucifera]
Length=801

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 227/286 (79%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW ILY T+YNCTDGIADHN+D+IV+FPDWDPS    +++ + +  +   +  + RR
Sbjct  516  MEEAWGILYRTIYNCTDGIADHNRDFIVQFPDWDPSLKPKAELSKQEQMQNPFMRDRTRR  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ET S L QPHLWYSTE+V+ AL LFL AG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  576  FSFRETISFLTQPHLWYSTEEVIYALHLFLDAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KD K+L+  SQKF QLIKDID LLA DD  LLGTWLESAK L EN  E 
Sbjct  636  VYMDAVTAFQQKDIKSLNFQSQKFAQLIKDIDTLLACDDNFLLGTWLESAKRLAENPKEM  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQVTMW+D T+  QSKLHDYANKFWSG+LESYYLPRAS YF++L +SL ENV
Sbjct  696  IQYEWNARTQVTMWYDNTQNNQSKLHDYANKFWSGILESYYLPRASTYFSYLLKSLRENV  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWR+EWI+FS +WQ G ELYPVKAQGDAL ++  L++KY +
Sbjct  756  TFELEEWRREWISFSNRWQAGRELYPVKAQGDALTVSKELFKKYLT  801



>gb|KHG14952.1| Alpha-N-acetylglucosaminidase [Gossypium arboreum]
Length=805

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 228/286 (80%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDGIADHN D+IV+FPDWDPS   GS   + +    F    + RR
Sbjct  520  IKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRSRTRSRR  579

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E SS LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  580  FSFQERSSDLPQAHLWYSTHEVVNALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  639

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I AF  KD KAL++H QKF+QLIKDIDVLLA+DD  LLGTWLESAK L EN +E 
Sbjct  640  VYLDAINAFRRKDVKALNIHGQKFIQLIKDIDVLLASDDNFLLGTWLESAKLLAENPSEM  699

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMWFDTT   QSKLHDYANKFWSGLLE YYLPRAS YF++L +SL +N 
Sbjct  700  RQYEWNARTQVTMWFDTTPTNQSKLHDYANKFWSGLLEGYYLPRASSYFSYLFKSLEKNE  759

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ EWRK+WI+FS KWQ G ELYPVKAQG+ L IA AL+ KY S
Sbjct  760  SFKLVEWRKQWISFSNKWQAGLELYPVKAQGNFLTIAKALFDKYLS  805



>gb|KEH33252.1| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=711

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 221/286 (77%), Gaps = 1/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YN TDGIADHN DYIV  PDWDPS    S M  N   K + L    RR
Sbjct  427  VDAAWEILYHTIYNSTDGIADHNHDYIVMLPDWDPSAAVKSGM-SNHQKKIYFLPPGNRR  485

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            +   +T + +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSK ANQ
Sbjct  486  YLFQQTPAGMPQAHLWYPPEDVIKALQLFLAGGKNLKGSLTYRYDLVDLTRQVLSKFANQ  545

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+ +I +F  K+  AL ++S  FL+LIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  546  VYIKAITSFQKKNIDALQLNSHMFLELIKDIDLLLASDDNFLLGTWLQSAKKLAVNPSEL  605

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  606  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLKQNE  665

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F + EWRKEWI  S KWQ GSELYPVKA+GDAL I+ ALY+KYFS
Sbjct  666  KFNLTEWRKEWIPMSNKWQEGSELYPVKAKGDALTISQALYKKYFS  711



>gb|EYU27032.1| hypothetical protein MIMGU_mgv1a001508mg [Erythranthe guttata]
Length=806

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 232/285 (81%), Gaps = 3/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE+AW+IL+ T+YNCTDGIA+HNKDYIV+FPDWDPS    ++  E    + F    Q+ R
Sbjct  524  VESAWKILHRTIYNCTDGIANHNKDYIVKFPDWDPSV---NNQLEIIQRRKFTGVQQKMR  580

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FF+ ET S LPQPHLWY+  D + ALKLF+ AG ELA   TYRYDLVDLTRQSLSKLAN+
Sbjct  581  FFIHETMSFLPQPHLWYNNRDSITALKLFIDAGNELAEIPTYRYDLVDLTRQSLSKLANE  640

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYL +I AF +KDAKALS HS KFLQLIKDID LLA+DD  LLGTWLESAK L+ N++E 
Sbjct  641  VYLSAINAFQDKDAKALSFHSLKFLQLIKDIDKLLASDDNFLLGTWLESAKKLSSNADEK  700

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK VQSKLHDY NKFWSGLLE+YYLPRASMYF  LS+SL EN 
Sbjct  701  KQYEWNARTQVTMWYDNTKSVQSKLHDYGNKFWSGLLEAYYLPRASMYFTRLSKSLEENE  760

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            EFK+EEWRKEWIA+S KWQ+  E+YP+KAQGDALAIA  LY KYF
Sbjct  761  EFKLEEWRKEWIAYSNKWQKSVEIYPLKAQGDALAIAKELYHKYF  805



>gb|AES69665.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=806

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 221/286 (77%), Gaps = 1/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YN TDGIADHN DYIV  PDWDPS    S M  N   K + L    RR
Sbjct  522  VDAAWEILYHTIYNSTDGIADHNHDYIVMLPDWDPSAAVKSGM-SNHQKKIYFLPPGNRR  580

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            +   +T + +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSK ANQ
Sbjct  581  YLFQQTPAGMPQAHLWYPPEDVIKALQLFLAGGKNLKGSLTYRYDLVDLTRQVLSKFANQ  640

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+ +I +F  K+  AL ++S  FL+LIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  641  VYIKAITSFQKKNIDALQLNSHMFLELIKDIDLLLASDDNFLLGTWLQSAKKLAVNPSEL  700

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  701  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLKQNE  760

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F + EWRKEWI  S KWQ GSELYPVKA+GDAL I+ ALY+KYFS
Sbjct  761  KFNLTEWRKEWIPMSNKWQEGSELYPVKAKGDALTISQALYKKYFS  806



>ref|XP_004499942.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cicer arietinum]
Length=805

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 226/286 (79%), Gaps = 1/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YNCTDGIADHN DYIV  PDWDPS    SD+   +  K + L    +R
Sbjct  521  VDAAWEILYHTIYNCTDGIADHNHDYIVMLPDWDPSTNVESDISSYEK-KIYFLPPGNKR  579

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L  T + +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  580  SLLQPTPADMPQTHLWYPPEDVIKALQLFLAGGKNLTGSLTYRYDLVDLTRQVLSKLANQ  639

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY++++++F  K+   L ++S KFL+LIKDID+LLAADD  LLGTWLESAK L  N  E 
Sbjct  640  VYINAVSSFQKKNIDGLHLNSHKFLELIKDIDLLLAADDNFLLGTWLESAKKLAVNPPEL  699

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+DT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  700  KQYEWNARTQVTMWYDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLRQNE  759

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+ EWRK+WI+ S KWQ G+ELYPVKA+GDAL IA +LY+KYF+
Sbjct  760  KFKLIEWRKQWISISNKWQEGNELYPVKAKGDALTIAQSLYEKYFA  805



>ref|XP_003599414.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=832

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 221/286 (77%), Gaps = 1/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YN TDGIADHN DYIV  PDWDPS    S M  N   K + L    RR
Sbjct  548  VDAAWEILYHTIYNSTDGIADHNHDYIVMLPDWDPSAAVKSGM-SNHQKKIYFLPPGNRR  606

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            +   +T + +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSK ANQ
Sbjct  607  YLFQQTPAGMPQAHLWYPPEDVIKALQLFLAGGKNLKGSLTYRYDLVDLTRQVLSKFANQ  666

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+ +I +F  K+  AL ++S  FL+LIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  667  VYIKAITSFQKKNIDALQLNSHMFLELIKDIDLLLASDDNFLLGTWLQSAKKLAVNPSEL  726

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  727  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLKQNE  786

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F + EWRKEWI  S KWQ GSELYPVKA+GDAL I+ ALY+KYFS
Sbjct  787  KFNLTEWRKEWIPMSNKWQEGSELYPVKAKGDALTISQALYKKYFS  832



>ref|XP_007148897.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
 gb|ESW20891.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
Length=802

 Score =   395 bits (1015),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 227/287 (79%), Gaps = 4/287 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDP-TGSDMPENDHTKAFVLTHQRR  705
            VEAAWEILYHT+YNCTDGIADHN D+IV FPDWDPS+  TG     N+  K  +L     
Sbjct  518  VEAAWEILYHTIYNCTDGIADHNHDFIVMFPDWDPSNSETGV---SNNQKKINLLRPVNT  574

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            R+ L ET S  P+ HLWY ++DV+KAL+LFLA G  L+ SLTYRYDLVDLTRQ LSK AN
Sbjct  575  RYLLQETPSDKPRAHLWYPSDDVIKALQLFLAGGKNLSTSLTYRYDLVDLTRQVLSKFAN  634

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            Q+Y  ++++F  K+ +AL  HS KFLQLIKDIDVLLA+DD  LLGTWLESAK L  N +E
Sbjct  635  QLYYKAVSSFQKKNIEALQFHSNKFLQLIKDIDVLLASDDNFLLGTWLESAKKLAVNPSE  694

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             KQYEWNARTQVTMWFDT    QSKLHDYANKFWSGL+ESYYLPRAS YF+HL  SL +N
Sbjct  695  IKQYEWNARTQVTMWFDTNATTQSKLHDYANKFWSGLVESYYLPRASTYFSHLLESLRQN  754

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             +FK+ EWRK+WI+ S KWQ G+ELYPVKA+GDALAI+ ALY+KYF+
Sbjct  755  EKFKLIEWRKQWISQSNKWQEGNELYPVKAKGDALAISQALYEKYFA  801



>dbj|BAK00311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=428

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 226/285 (79%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDGIADHNKDYIVEFPD      + S        ++  L  +  R
Sbjct  148  IQKAWGILYHTIYNCTDGIADHNKDYIVEFPD-----MSPSSFSSQYSKRSISLARKHPR  202

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL E S+SLPQPHLWYSTE+ +K+L+LFL AG +L+ SLTYRYDLVDLTRQSLSKLAN+
Sbjct  203  FFLSEVSASLPQPHLWYSTEEAIKSLELFLNAGNDLSKSLTYRYDLVDLTRQSLSKLANK  262

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY D+I+++  +D+  L+ H+++FL+LI DID LLA+DD  LLG WLESAKSL    +E 
Sbjct  263  VYHDAISSYQKRDSSGLNFHTKEFLELIVDIDTLLASDDNFLLGPWLESAKSLAMTEDER  322

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLL+SYYLPRAS YF+ LSRSL EN 
Sbjct  323  KQYEWNARTQVTMWYDDTKTEQSKLHDYANKFWSGLLKSYYLPRASKYFSRLSRSLQENR  382

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++EEWR++WI++S +WQ G ELYPVKA GD+LAI+ +L+ KYF
Sbjct  383  SFQLEEWRRDWISYSNEWQSGKELYPVKAIGDSLAISRSLFTKYF  427



>ref|XP_004984324.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Setaria italica]
Length=617

 Score =   387 bits (994),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 224/286 (78%), Gaps = 4/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW  LYHT+YNCTDGIADHNKDYIVEFPD  PS    S   +    +   ++   RR
Sbjct  336  IEKAWRYLYHTIYNCTDGIADHNKDYIVEFPDISPS----SFSTQLSKRRGMSISSNHRR  391

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL E S SLP PHLWYST++ +KAL+LFL AG + + S+TYRYDLVDLTRQ LSKLAN+
Sbjct  392  FFLSEVSGSLPHPHLWYSTKEAIKALELFLNAGNDFSKSITYRYDLVDLTRQCLSKLANE  451

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ ++  KD+  L+ H++KFL++I DID LLAADD  LLG WLESAKSL    +E 
Sbjct  452  VYLDAMRSYQKKDSNGLNSHARKFLEIIADIDTLLAADDNFLLGPWLESAKSLAMTESER  511

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D T+  QSKLHDYANKFWSGLL+SYYLPRAS YF +L+RSL EN 
Sbjct  512  KQYEWNARTQVTMWYDNTETEQSKLHDYANKFWSGLLKSYYLPRASKYFAYLTRSLQENR  571

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWRK+WI++S +WQ G ELY VKA GDALAIA +LY+KYFS
Sbjct  572  SFQLEEWRKDWISYSNEWQSGKELYGVKATGDALAIARSLYRKYFS  617



>ref|XP_006399865.1| hypothetical protein EUTSA_v100127270mg, partial [Eutrema salsugineum]
 gb|ESQ41318.1| hypothetical protein EUTSA_v100127270mg, partial [Eutrema salsugineum]
Length=338

 Score =   375 bits (962),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/291 (63%), Positives = 225/291 (77%), Gaps = 8/291 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLT----H  714
            +EAAWEILYHTVYNCTDGIADHN D+IV+ PDWDPS    S   E   T  ++++     
Sbjct  51   IEAAWEILYHTVYNCTDGIADHNTDFIVKLPDWDPS---SSVQGETKKTDPYMISTDPYE  107

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
             +RRF   + SS LP+ HLWYST++V+KAL+LFL AG +L GSLTYRYD+VDLTRQ LSK
Sbjct  108  TKRRFLFQDDSSGLPKAHLWYSTKEVIKALQLFLEAGDDLFGSLTYRYDMVDLTRQVLSK  167

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
            LAN+VY++++ AF  KD  +L   S+KFL+LIKDIDVLLA+DD  LLGTWLESAK L  N
Sbjct  168  LANKVYIEAVTAFVKKDIGSLRRLSKKFLELIKDIDVLLASDDNFLLGTWLESAKKLARN  227

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
             +E KQYEWNARTQVTMW+D+    QSKLHDYANKFWSGLLE YYLPRA +YFN L +SL
Sbjct  228  DDERKQYEWNARTQVTMWYDSKDVNQSKLHDYANKFWSGLLEDYYLPRAKLYFNELLKSL  287

Query  173  NENVEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYFS  24
             +  + ++E+WR+EWI  S KWQ+  SE+Y VKA+GDALAI+  L +KYF+
Sbjct  288  RDKKKLEIEKWRREWIMKSHKWQQSSSEVYQVKAKGDALAISRHLLRKYFT  338



>ref|XP_010456519.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Camelina 
sativa]
Length=348

 Score =   375 bits (963),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/286 (62%), Positives = 222/286 (78%), Gaps = 2/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAW+ILYHTVYNCTDGIADHN D+IV+ PDWDPS        + D          +RR
Sbjct  63   IEAAWDILYHTVYNCTDGIADHNTDFIVKLPDWDPSSSIQDKWKQTDSISTGSY-ETKRR  121

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   + SS LP+ HLWYST++V+KALKLFL AG +L+ SLTYRYD+VDLTRQ LSKLANQ
Sbjct  122  FLFQDKSSGLPKAHLWYSTKEVIKALKLFLEAGDDLSRSLTYRYDMVDLTRQVLSKLANQ  181

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY++++ AF  +D  +L   S+K+L++IKD+DVLLA+DD  LLGTWLESAK L  N++E 
Sbjct  182  VYIEAVTAFVKQDVGSLRRLSEKYLEIIKDMDVLLASDDNFLLGTWLESAKKLARNNDER  241

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D+    QSKLHDYANK+WSGLL+ YYLPRA++YFN + +SL +  
Sbjct  242  KQYEWNARTQVTMWYDSKDLNQSKLHDYANKYWSGLLKDYYLPRATLYFNEMLKSLQDKK  301

Query  161  EFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
            +FKVE+WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KYF
Sbjct  302  KFKVEKWRREWIMMSHKWQQSSSEIYPVKAKGDALAISRHLLCKYF  347



>ref|XP_010694988.1| PREDICTED: alpha-N-acetylglucosaminidase [Beta vulgaris subsp. 
vulgaris]
Length=808

 Score =   389 bits (999),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 222/286 (78%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AWEILYHT+YNCTDGIA+HNKDYIVEFPDWDP +    D+          + H+  R
Sbjct  523  LERAWEILYHTIYNCTDGIANHNKDYIVEFPDWDPVNNITLDVTRKLKKDNLFILHRSTR  582

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              LLE+  SLP PHLWYST++V+KAL LFL AG +L GS+T+RYD+VDLTRQ+LSKLAN 
Sbjct  583  HILLESRPSLPLPHLWYSTQEVIKALSLFLDAGKDLVGSVTFRYDMVDLTRQALSKLAND  642

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             YL ++ AF  KD KAL  HSQKF++LIKDID +LA+DD  LLGTWL SAK L  N  E 
Sbjct  643  AYLKAMTAFQLKDLKALDFHSQKFIKLIKDIDEVLASDDNFLLGTWLSSAKKLASNPKEM  702

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            + YEWNARTQ+TMWFDTT+  QSKLHDYANKFWSGLLE YYLPRA++YFNHL ++L  N 
Sbjct  703  RLYEWNARTQITMWFDTTETNQSKLHDYANKFWSGLLEDYYLPRATLYFNHLRKALRNNE  762

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             FK+ +WR+EWI++S +WQ  +++YPVKAQGDAL IA  +Y++Y S
Sbjct  763  TFKINDWRREWISYSTEWQSDTKIYPVKAQGDALFIAKKMYERYLS  808



>gb|KCW66076.1| hypothetical protein EUGRSUZ_G03358 [Eucalyptus grandis]
Length=742

 Score =   387 bits (993),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 221/286 (77%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEILYHT+YNCTDGIADHN D+IV+FPDWDPS  + S   + +           RR
Sbjct  457  VEAAWEILYHTIYNCTDGIADHNTDFIVKFPDWDPSTISASSFGKQEKMLLPFHLSPGRR  516

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F    T S  PQ HLWYST  V+ AL+LFL AG  L  SL +RYDLVDLTRQ LSKLAN+
Sbjct  517  FLSQATGSDFPQAHLWYSTRFVVDALELFLQAGNHLKESLPFRYDLVDLTRQVLSKLANK  576

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KDAKAL +HSQKFLQLIKDID+LLA DD  LLGTWLESAK+L    +E 
Sbjct  577  VYVDAMTAFQQKDAKALHLHSQKFLQLIKDIDLLLACDDNFLLGTWLESAKALAATPSEM  636

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+DT +  QSKLHDYANKFWSGLLE YYLPRAS YF++L++SL EN 
Sbjct  637  RQYEWNARTQVTMWYDTNRTAQSKLHDYANKFWSGLLEDYYLPRASSYFSYLTKSLRENK  696

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F++EEWRK+WI++S KWQ  +++Y VKA+GDAL IA  LY+ YF 
Sbjct  697  KFELEEWRKDWISYSNKWQSETQIYAVKAKGDALEIAKTLYKNYFG  742



>ref|XP_010228604.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X3 [Brachypodium 
distachyon]
Length=541

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 227/286 (79%), Gaps = 4/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW +LYHT+YNCTDGIADHN+DYIVEFPD  PS  +     +    +   +  +  R
Sbjct  260  IEKAWGVLYHTIYNCTDGIADHNRDYIVEFPDMSPSSFSSHFSKQ----RGMPIVRKHPR  315

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL E S++LP PHLWYST + +KAL+LFL AG +L+ SLT+RYDLVDLTRQSLSKLAN+
Sbjct  316  FFLSEVSANLPHPHLWYSTNEAVKALELFLNAGNDLSKSLTFRYDLVDLTRQSLSKLANK  375

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ ++ NK++  L+ H++KFL+LI DID+LLA+DD  LLG WLESAKSL  +  E 
Sbjct  376  VYLDAMDSYKNKNSSGLNFHTKKFLELIVDIDILLASDDNFLLGPWLESAKSLAMSEEER  435

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QS LHDYANKFWSGLL++YYLPRAS YF  LSRSL EN 
Sbjct  436  KQYEWNARTQVTMWYDNTKTEQSHLHDYANKFWSGLLKNYYLPRASKYFTGLSRSLQENR  495

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWR++WI++S +WQ G ELYPVKA+GDALAI+ +L++KY S
Sbjct  496  SFQLEEWRRDWISYSNEWQSGEELYPVKAKGDALAISKSLFRKYLS  541



>ref|XP_010067843.1| PREDICTED: alpha-N-acetylglucosaminidase [Eucalyptus grandis]
Length=804

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 221/286 (77%), Gaps = 0/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEILYHT+YNCTDGIADHN D+IV+FPDWDPS  + S   + +           RR
Sbjct  519  VEAAWEILYHTIYNCTDGIADHNTDFIVKFPDWDPSTISASSFGKQEKMLLPFHLSPGRR  578

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F    T S  PQ HLWYST  V+ AL+LFL AG  L  SL +RYDLVDLTRQ LSKLAN+
Sbjct  579  FLSQATGSDFPQAHLWYSTRFVVDALELFLQAGNHLKESLPFRYDLVDLTRQVLSKLANK  638

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KDAKAL +HSQKFLQLIKDID+LLA DD  LLGTWLESAK+L    +E 
Sbjct  639  VYVDAMTAFQQKDAKALHLHSQKFLQLIKDIDLLLACDDNFLLGTWLESAKALAATPSEM  698

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+DT +  QSKLHDYANKFWSGLLE YYLPRAS YF++L++SL EN 
Sbjct  699  RQYEWNARTQVTMWYDTNRTAQSKLHDYANKFWSGLLEDYYLPRASSYFSYLTKSLRENK  758

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F++EEWRK+WI++S KWQ  +++Y VKA+GDAL IA  LY+ YF 
Sbjct  759  KFELEEWRKDWISYSNKWQSETQIYAVKAKGDALEIAKTLYKNYFG  804



>ref|XP_008802642.1| PREDICTED: alpha-N-acetylglucosaminidase [Phoenix dactylifera]
Length=809

 Score =   386 bits (991),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 224/286 (78%), Gaps = 1/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAWE+LYHT+YNCTDGIADHNKDYIVEFPD  P  PTGS + +    +      +  R
Sbjct  525  IEAAWEVLYHTIYNCTDGIADHNKDYIVEFPDSSPF-PTGSQLSKEGWIQKLPTLEKNHR  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ET++++P PHLWYS E+ +KALKLFL AG +L GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  584  FSFRETNTNVPHPHLWYSNEEAIKALKLFLIAGNDLVGSLTYRYDLVDLTRQVLSKLANQ  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD +AA+ + +   L+++SQKFL+LI+DID LLA+DD  LLGTWLESAK L  +  E 
Sbjct  644  VYLDVMAAYHSNNTSRLTLYSQKFLELIEDIDTLLASDDNFLLGTWLESAKKLALSKKER  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLL+ YYLPRAS YF++LSRSL  N 
Sbjct  704  KQYEWNARTQVTMWYDNTKTNQSKLHDYANKFWSGLLKGYYLPRASTYFSYLSRSLEGNE  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F +EEWRK+WI +S KWQ G+ELY VKA GDALAI+ +L  KY S
Sbjct  764  YFPLEEWRKDWILYSNKWQAGTELYSVKAVGDALAISKSLAAKYLS  809



>gb|EEC75285.1| hypothetical protein OsI_11626 [Oryza sativa Indica Group]
Length=812

 Score =   385 bits (988),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 188/285 (66%), Positives = 228/285 (80%), Gaps = 4/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE AW ILYHT+YNCTDGIADHNKDYIV+FPD  P+  + SD+ +    KA     + RR
Sbjct  531  VEKAWGILYHTIYNCTDGIADHNKDYIVQFPDISPNSFS-SDVSKR---KAISEVKKHRR  586

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E S+SLP PHLWYST++ +KAL+LFL AG +L+ SLTYRYDLVDLTRQSLSKLAN+
Sbjct  587  FVLSEVSASLPHPHLWYSTKEAIKALELFLNAGNDLSKSLTYRYDLVDLTRQSLSKLANE  646

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ A+  KD+  L+ +++KFL+LI DID LLA+DD  LLG WLE AKSL    NE 
Sbjct  647  VYLDAMNAYRKKDSNGLNFYTKKFLELIVDIDTLLASDDNFLLGPWLEDAKSLARTENER  706

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLL+SYYLPRAS YF+ L++ L EN 
Sbjct  707  KQYEWNARTQVTMWYDNTKTEQSKLHDYANKFWSGLLKSYYLPRASKYFSRLTKGLQENQ  766

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++EEWRK+WIA+S +WQ G ELY VKA GDALAI+++L++KYF
Sbjct  767  SFQLEEWRKDWIAYSNEWQSGKELYAVKATGDALAISSSLFKKYF  811



>gb|KFK25595.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=441

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 225/290 (78%), Gaps = 8/290 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLT----H  714
            +EAAWEILYHTVY+CTDGIADHN D+IV+ PDWDPS        E+  T +++++     
Sbjct  152  IEAAWEILYHTVYSCTDGIADHNTDFIVKLPDWDPSSYVQD---ESKQTDSYMISTDPYE  208

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
             +RRF   + SS  P+ HLWYST++V+KAL+LFL AG +L GSLTYRYD+VDLTRQ LSK
Sbjct  209  TKRRFLFQDKSSVFPKAHLWYSTKEVIKALQLFLEAGDDLFGSLTYRYDMVDLTRQVLSK  268

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
            LANQVY++++ A+  KD  +L   S KFL+LIKDIDVLLA+DD  LLGTWL+SAK L  N
Sbjct  269  LANQVYIEAVTAYVKKDISSLRRLSGKFLELIKDIDVLLASDDNFLLGTWLDSAKKLARN  328

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
            S+E KQYEWNARTQVTMW+D+    QSKLHDYANKFWSGLLE YYLPRA +YF+ + RSL
Sbjct  329  SDERKQYEWNARTQVTMWYDSKDVNQSKLHDYANKFWSGLLEDYYLPRAKLYFDEMLRSL  388

Query  173  NENVEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
             +  +  +++WRKEWI  S KWQ+  SE+YPVKA+GDALAI+  L++KYF
Sbjct  389  RDKKKLGIDKWRKEWIMMSHKWQQSSSEIYPVKAKGDALAISRHLFRKYF  438



>gb|KDO83339.1| hypothetical protein CISIN_1g003545mg [Citrus sinensis]
 gb|KDO83340.1| hypothetical protein CISIN_1g003545mg [Citrus sinensis]
Length=629

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 223/290 (77%), Gaps = 5/290 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEA WEILYHTVYNCTDGIADHN D+IV+FPDWDPS  +GS + + D   A       RR
Sbjct  336  VEATWEILYHTVYNCTDGIADHNTDFIVKFPDWDPSLLSGSAISKRDQMHALHALPGPRR  395

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E +S +PQ HLWYS ++++K LKLFL AG  LAG  TYRYDLVD+TRQ+LSKLANQ
Sbjct  396  F-LSEENSDMPQAHLWYSNQELIKGLKLFLNAGNALAGCATYRYDLVDITRQALSKLANQ  454

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF +KDA A ++HSQKFLQLIKDID LLA++D  LLGTWLESAK L  N +E 
Sbjct  455  VYMDAVIAFQHKDASAFNIHSQKFLQLIKDIDELLASNDNFLLGTWLESAKKLATNPSEM  514

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYE+NARTQVTMW+DT    QSKLHDYANKFWSGLL  YYLPRAS YF+++S+SL E  
Sbjct  515  IQYEYNARTQVTMWYDTNITTQSKLHDYANKFWSGLLVDYYLPRASTYFDYMSKSLREKS  574

Query  161  EFKVEEWRKEWIAFSEKWQR----GSELYPVKAQGDALAIANALYQKYFS  24
            EF+V+ WR++W+  S  WQ     G++ YP++A+GD++AIA  LY KYF 
Sbjct  575  EFQVDRWRQQWVFISISWQSNWKTGTKNYPIRAKGDSIAIAKVLYDKYFG  624



>gb|EEE59081.1| hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
Length=812

 Score =   383 bits (983),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/286 (66%), Positives = 227/286 (79%), Gaps = 4/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VE AW ILYHT+YNCTDGIADHN DYIVEFPD  P+  + SD+ +    KA     + RR
Sbjct  531  VEKAWGILYHTIYNCTDGIADHNNDYIVEFPDISPNSFS-SDVSKR---KAISEVKKHRR  586

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E S+SLP PHLWYST++ +KAL+LFL AG +L+ SLTYRYDLVDLTRQSLSKLAN+
Sbjct  587  FVLSEVSASLPHPHLWYSTKEAIKALELFLNAGNDLSKSLTYRYDLVDLTRQSLSKLANE  646

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ A+  KD+  L+ +++KFL+LI DID LLA+DD  LLG WLE AKSL    NE 
Sbjct  647  VYLDAMNAYRKKDSNGLNFYTKKFLELIVDIDTLLASDDNFLLGPWLEDAKSLARTENER  706

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLL+SYYLPRAS YF+ L++ L EN 
Sbjct  707  KQYEWNARTQVTMWYDNTKTEQSKLHDYANKFWSGLLKSYYLPRASKYFSRLTKGLQENQ  766

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEW K+WIA+S +WQ G ELY VKA GDALAI+++L++KYFS
Sbjct  767  SFQLEEWTKDWIAYSNEWQSGKELYAVKATGDALAISSSLFKKYFS  812



>ref|XP_008660142.1| PREDICTED: alpha-N-acetylglucosaminidase [Zea mays]
 gb|AFW88340.1| hypothetical protein ZEAMMB73_315381 [Zea mays]
Length=814

 Score =   383 bits (983),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 221/285 (78%), Gaps = 4/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW  LYHT+YNCTDGIADHNKDYIVEFPD  PS  T     +    +   +T   RR
Sbjct  532  IEKAWRYLYHTIYNCTDGIADHNKDYIVEFPDISPSSVTY----QVSKRRGMSITRNHRR  587

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL E S  LPQPHLWYST++ +KAL+LFL AG+  + SLTYRYDLVDLTRQ LSKLAN+
Sbjct  588  FFLSEVSGILPQPHLWYSTKEAVKALELFLDAGSTFSESLTYRYDLVDLTRQCLSKLANE  647

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I+ +  KD+  L+ H++KFL++I DID LLAADD  LLG WLESAKSL     E 
Sbjct  648  VYLDAISLYQKKDSHGLNAHARKFLEIIVDIDTLLAADDNFLLGPWLESAKSLAITEKER  707

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+D T+  QSKLHDYANKFWSGLL+SYYLPRAS YF +L+RSL EN 
Sbjct  708  QQYEWNARTQVTMWYDNTETEQSKLHDYANKFWSGLLKSYYLPRASKYFAYLTRSLQENR  767

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++EEWRK+WI++S +WQ G E+Y VKA GDALAIA +LY+KY 
Sbjct  768  SFQLEEWRKDWISYSNEWQSGKEVYAVKATGDALAIARSLYRKYL  812



>ref|XP_010938526.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Elaeis guineensis]
Length=809

 Score =   382 bits (981),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 226/286 (79%), Gaps = 1/286 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAW ILYHT+YNCTDGIADHNKDYIV+FPD  P   T S + +    +      Q  R
Sbjct  525  IEAAWTILYHTIYNCTDGIADHNKDYIVQFPDSSPF-LTDSQLSKEGWIQKLPTLEQNHR  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ET++++PQPHLWYS ++ +KALKLFL AG +L GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  584  FSFRETNANVPQPHLWYSNKEAIKALKLFLIAGNDLVGSLTYRYDLVDLTRQVLSKLANQ  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD + A+ + +A A++++S KFL+LI+DID LLA+DD  LLGTWLESAK+L+ N NE 
Sbjct  644  VYLDVMIAYHSNNASAVTLYSHKFLELIEDIDTLLASDDNFLLGTWLESAKNLSVNKNER  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLL+ YYLPRAS YF+++SRSL EN 
Sbjct  704  RQYEWNARTQVTMWYDNTKTNQSKLHDYANKFWSGLLKGYYLPRASTYFSYVSRSLEENG  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F +EEWRK+WI++S  WQ G+E+Y VKA GDALAI+ +L  KY S
Sbjct  764  NFPLEEWRKDWISYSNNWQAGTEVYSVKAVGDALAISKSLAAKYLS  809



>ref|XP_006482916.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Citrus sinensis]
Length=811

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 226/291 (78%), Gaps = 7/291 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAF-VLTHQRR  705
            VEA WEILYHTVYNCTDGIADHN D+IV+FPDWDPS  +GS + + D   A  VL   RR
Sbjct  518  VEATWEILYHTVYNCTDGIADHNTDFIVKFPDWDPSLHSGSAISKRDQMHALHVLPGPRR  577

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              FL E +S +PQ HLWYS ++++K LKLFL AG  LAGS TYRYDLVD+TRQ+LSKLAN
Sbjct  578  --FLSEENSDMPQAHLWYSNQELIKGLKLFLNAGNALAGSATYRYDLVDITRQALSKLAN  635

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVY+D++ AF +KDA A ++HSQKFLQLIKDID LLA++D  LLGTWLESAK L  N +E
Sbjct  636  QVYMDAVIAFQHKDASAFNIHSQKFLQLIKDIDELLASNDNFLLGTWLESAKKLATNPSE  695

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
              QYE+NARTQVTMW+DT    QSKLHDYANKFWSGLL  YYLPRAS YF+++S+SL E 
Sbjct  696  MIQYEYNARTQVTMWYDTNITTQSKLHDYANKFWSGLLVDYYLPRASTYFDYMSKSLREK  755

Query  164  VEFKVEEWRKEWIAFSEKWQR----GSELYPVKAQGDALAIANALYQKYFS  24
             EF+V+ WR++W+  S  WQ     G++ YP++A+GD++AIA  LY KYF 
Sbjct  756  SEFQVDRWRQQWVFISISWQSNWKTGTKNYPIRAKGDSIAIAKVLYDKYFG  806



>ref|XP_010228603.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Brachypodium 
distachyon]
Length=649

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 227/286 (79%), Gaps = 4/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW +LYHT+YNCTDGIADHN+DYIVEFPD  PS  +     +    +   +  +  R
Sbjct  368  IEKAWGVLYHTIYNCTDGIADHNRDYIVEFPDMSPSSFSSHFSKQ----RGMPIVRKHPR  423

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL E S++LP PHLWYST + +KAL+LFL AG +L+ SLT+RYDLVDLTRQSLSKLAN+
Sbjct  424  FFLSEVSANLPHPHLWYSTNEAVKALELFLNAGNDLSKSLTFRYDLVDLTRQSLSKLANK  483

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ ++ NK++  L+ H++KFL+LI DID+LLA+DD  LLG WLESAKSL  +  E 
Sbjct  484  VYLDAMDSYKNKNSSGLNFHTKKFLELIVDIDILLASDDNFLLGPWLESAKSLAMSEEER  543

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QS LHDYANKFWSGLL++YYLPRAS YF  LSRSL EN 
Sbjct  544  KQYEWNARTQVTMWYDNTKTEQSHLHDYANKFWSGLLKNYYLPRASKYFTGLSRSLQENR  603

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWR++WI++S +WQ G ELYPVKA+GDALAI+ +L++KY S
Sbjct  604  SFQLEEWRRDWISYSNEWQSGEELYPVKAKGDALAISKSLFRKYLS  649



>gb|KDO83338.1| hypothetical protein CISIN_1g003545mg [Citrus sinensis]
Length=811

 Score =   379 bits (974),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 223/290 (77%), Gaps = 5/290 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEA WEILYHTVYNCTDGIADHN D+IV+FPDWDPS  +GS + + D   A       RR
Sbjct  518  VEATWEILYHTVYNCTDGIADHNTDFIVKFPDWDPSLLSGSAISKRDQMHALHALPGPRR  577

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E +S +PQ HLWYS ++++K LKLFL AG  LAG  TYRYDLVD+TRQ+LSKLANQ
Sbjct  578  F-LSEENSDMPQAHLWYSNQELIKGLKLFLNAGNALAGCATYRYDLVDITRQALSKLANQ  636

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF +KDA A ++HSQKFLQLIKDID LLA++D  LLGTWLESAK L  N +E 
Sbjct  637  VYMDAVIAFQHKDASAFNIHSQKFLQLIKDIDELLASNDNFLLGTWLESAKKLATNPSEM  696

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYE+NARTQVTMW+DT    QSKLHDYANKFWSGLL  YYLPRAS YF+++S+SL E  
Sbjct  697  IQYEYNARTQVTMWYDTNITTQSKLHDYANKFWSGLLVDYYLPRASTYFDYMSKSLREKS  756

Query  161  EFKVEEWRKEWIAFSEKWQR----GSELYPVKAQGDALAIANALYQKYFS  24
            EF+V+ WR++W+  S  WQ     G++ YP++A+GD++AIA  LY KYF 
Sbjct  757  EFQVDRWRQQWVFISISWQSNWKTGTKNYPIRAKGDSIAIAKVLYDKYFG  806



>ref|NP_196873.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 dbj|BAB08696.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AAL87291.1| putative alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AAM51254.1| putative alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AED91928.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
Length=806

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQ-RR  705
            +EAAWEILYHTVYNCTDGIADHN D+IV+ PDWDPS     D+ + D        ++ +R
Sbjct  519  IEAAWEILYHTVYNCTDGIADHNTDFIVKLPDWDPSSSVQDDLKQKDSYMISTGPYETKR  578

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            R    + ++ LP+ HLWYST++V++ALKLFL AG +L+ SLTYRYD+VDLTRQ LSKLAN
Sbjct  579  RVLFQDKTADLPKAHLWYSTKEVIQALKLFLEAGDDLSRSLTYRYDMVDLTRQVLSKLAN  638

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVY +++ AF  KD  +L   S+KFL+LIKD+DVLLA+DD CLLGTWLESAK L +N +E
Sbjct  639  QVYTEAVTAFVKKDIGSLGQLSEKFLELIKDMDVLLASDDNCLLGTWLESAKKLAKNGDE  698

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             KQYEWNARTQVTMW+D+    QSKLHDYANKFWSGLLE YYLPRA +YFN + +SL + 
Sbjct  699  RKQYEWNARTQVTMWYDSNDVNQSKLHDYANKFWSGLLEDYYLPRARLYFNEMLKSLRDK  758

Query  164  VEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
              FKVE+WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KYF
Sbjct  759  KIFKVEKWRREWIMMSHKWQQSSSEVYPVKAKGDALAISRHLLSKYF  805



>ref|XP_006438966.1| hypothetical protein CICLE_v10030724mg [Citrus clementina]
 gb|ESR52206.1| hypothetical protein CICLE_v10030724mg [Citrus clementina]
Length=811

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/290 (63%), Positives = 223/290 (77%), Gaps = 5/290 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEA WEILYHTVYNCTDGIADHN D+IV+FPDWDPS  +GS + + D   A       RR
Sbjct  518  VEATWEILYHTVYNCTDGIADHNTDFIVKFPDWDPSLHSGSAISKRDQMHALHALPGPRR  577

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E +S +PQ HLWYS ++++K LKLFL AG  LAGS TYRYDLVD+TRQ+LSKLANQ
Sbjct  578  F-LSEENSDMPQAHLWYSNQELIKGLKLFLNAGNALAGSATYRYDLVDITRQALSKLANQ  636

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF +KDA A + HSQKFLQLIKDID LLA++D  LLGTWLESAK L  N +E 
Sbjct  637  VYMDAVIAFQHKDASAFNNHSQKFLQLIKDIDELLASNDNFLLGTWLESAKKLATNPSEM  696

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYE+NARTQVTMW+DT    QSKLHDYANKFWSGLL  YYLPRAS YF+++S+SL E  
Sbjct  697  IQYEYNARTQVTMWYDTNITTQSKLHDYANKFWSGLLVDYYLPRASTYFDYMSKSLREKS  756

Query  161  EFKVEEWRKEWIAFSEKWQR----GSELYPVKAQGDALAIANALYQKYFS  24
            EF+V+ WR++W+  S  WQ     G++ YP++A+GD++AIA  LY KYF 
Sbjct  757  EFQVDRWRQQWVFISISWQSNWKTGTKNYPIRAKGDSIAIAKVLYDKYFG  806



>ref|XP_003557830.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Brachypodium 
distachyon]
Length=809

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 227/286 (79%), Gaps = 4/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW +LYHT+YNCTDGIADHN+DYIVEFPD  PS  +     +    +   +  +  R
Sbjct  528  IEKAWGVLYHTIYNCTDGIADHNRDYIVEFPDMSPSSFSSHFSKQ----RGMPIVRKHPR  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            FFL E S++LP PHLWYST + +KAL+LFL AG +L+ SLT+RYDLVDLTRQSLSKLAN+
Sbjct  584  FFLSEVSANLPHPHLWYSTNEAVKALELFLNAGNDLSKSLTFRYDLVDLTRQSLSKLANK  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD++ ++ NK++  L+ H++KFL+LI DID+LLA+DD  LLG WLESAKSL  +  E 
Sbjct  644  VYLDAMDSYKNKNSSGLNFHTKKFLELIVDIDILLASDDNFLLGPWLESAKSLAMSEEER  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QS LHDYANKFWSGLL++YYLPRAS YF  LSRSL EN 
Sbjct  704  KQYEWNARTQVTMWYDNTKTEQSHLHDYANKFWSGLLKNYYLPRASKYFTGLSRSLQENR  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWR++WI++S +WQ G ELYPVKA+GDALAI+ +L++KY S
Sbjct  764  SFQLEEWRRDWISYSNEWQSGEELYPVKAKGDALAISKSLFRKYLS  809



>ref|XP_002871580.1| alpha-N-acetylglucosaminidase family [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47839.1| alpha-N-acetylglucosaminidase family [Arabidopsis lyrata subsp. 
lyrata]
Length=806

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/290 (64%), Positives = 226/290 (78%), Gaps = 8/290 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLT----H  714
            +EAAWEILYHTVYNCTDGIADHN D+IV+ PDWDPS    S   E+ HT +++++     
Sbjct  519  IEAAWEILYHTVYNCTDGIADHNTDFIVKLPDWDPS---SSVQDESKHTDSYMISTGPYE  575

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
             +RR    + SS LP+ HLWYST++V++ALKLFL AG EL+ SLTYRYD+VDLTRQ LSK
Sbjct  576  TKRRVLFQDKSSDLPKAHLWYSTKEVIQALKLFLEAGDELSRSLTYRYDMVDLTRQVLSK  635

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
            LANQVY++++ AF  KD  +L   S+KFL+LIKDIDVLLA+DD  LLGTWLESAK L  N
Sbjct  636  LANQVYIEAVTAFVKKDIGSLGQLSEKFLELIKDIDVLLASDDNFLLGTWLESAKKLARN  695

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
             +E KQYEWNARTQVTMW+D+    QSKLHDYANK WSGLLE YYLPRA +YFN + +SL
Sbjct  696  GDERKQYEWNARTQVTMWYDSKDVNQSKLHDYANKLWSGLLEDYYLPRARLYFNEMLKSL  755

Query  173  NENVEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
             +  +FKVE+W++EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KYF
Sbjct  756  RDKKKFKVEKWQREWIMMSHKWQQSSSEVYPVKAKGDALAISKHLLLKYF  805



>ref|XP_006651392.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oryza brachyantha]
Length=755

 Score =   376 bits (965),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/286 (65%), Positives = 221/286 (77%), Gaps = 4/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +E AW ILYHT+YNCTDGIADHNKDYIVEFPD  PS  +     + +  K      + RR
Sbjct  474  MEKAWGILYHTIYNCTDGIADHNKDYIVEFPDISPSSFSSDHSKQREIAK----VRKHRR  529

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F L E S+ LP PHLWY T+D +KAL+LFL AG +L+ SLTYRYDLVDLTRQ+LSKLAN+
Sbjct  530  FVLSEVSAGLPHPHLWYPTKDAIKALELFLNAGNDLSKSLTYRYDLVDLTRQALSKLANE  589

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ A+  KD+  L  H +KFL+LI DID LLA+DD  LLG WLESAKSL    NE 
Sbjct  590  VYIDAMNAYQKKDSNGLRFHMKKFLKLITDIDTLLASDDNFLLGPWLESAKSLAMTENER  649

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QS+LHDYANKFWSGLL+SYYLPRAS YF  L++SL EN 
Sbjct  650  KQYEWNARTQVTMWYDNTKTEQSQLHDYANKFWSGLLKSYYLPRASKYFTRLTKSLQENQ  709

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F++EEWRK+WIA+S +WQ G ELY VKA GDALAI+ +L++KY S
Sbjct  710  SFQLEEWRKDWIAYSNEWQSGMELYAVKATGDALAISRSLFRKYLS  755



>gb|AES69666.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=686

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 211/286 (74%), Gaps = 26/286 (9%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YN TDGIADHN DYIV  PDWDPS                        
Sbjct  427  VDAAWEILYHTIYNSTDGIADHNHDYIVMLPDWDPSAAV---------------------  465

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                  S+ +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSK ANQ
Sbjct  466  -----KSAGMPQAHLWYPPEDVIKALQLFLAGGKNLKGSLTYRYDLVDLTRQVLSKFANQ  520

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+ +I +F  K+  AL ++S  FL+LIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  521  VYIKAITSFQKKNIDALQLNSHMFLELIKDIDLLLASDDNFLLGTWLQSAKKLAVNPSEL  580

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  581  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLKQNE  640

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F + EWRKEWI  S KWQ GSELYPVKA+GDAL I+ ALY+KYFS
Sbjct  641  KFNLTEWRKEWIPMSNKWQEGSELYPVKAKGDALTISQALYKKYFS  686



>ref|XP_007148898.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
 gb|ESW20892.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
Length=796

 Score =   375 bits (962),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 221/287 (77%), Gaps = 10/287 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDP-TGSDMPENDHTKAFVLTHQRR  705
            VEAAWEILYHT+YNCTDGIADHN D+IV FPDWDPS+  TG     N+  K  +L     
Sbjct  518  VEAAWEILYHTIYNCTDGIADHNHDFIVMFPDWDPSNSETGV---SNNQKKINLLRPVNT  574

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            R+ L ET S  P+ HLWY ++DV+KAL+LFLA G  L+ SLTYRYDLVDLTRQ LSK AN
Sbjct  575  RYLLQETPSDKPRAHLWYPSDDVIKALQLFLAGGKNLSTSLTYRYDLVDLTRQVLSKFAN  634

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            Q+Y  ++++F  K+ +AL  HS KFLQLIKDIDVLLA+DD  LLGTWLESAK L  N +E
Sbjct  635  QLYYKAVSSFQKKNIEALQFHSNKFLQLIKDIDVLLASDDNFLLGTWLESAKKLAVNPSE  694

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             KQYEWNARTQVTMWFDT    Q+      NKFWSGL+ESYYLPRAS YF+HL  SL +N
Sbjct  695  IKQYEWNARTQVTMWFDTNATTQT------NKFWSGLVESYYLPRASTYFSHLLESLRQN  748

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             +FK+ EWRK+WI+ S KWQ G+ELYPVKA+GDALAI+ ALY+KYF+
Sbjct  749  EKFKLIEWRKQWISQSNKWQEGNELYPVKAKGDALAISQALYEKYFA  795



>ref|XP_010492144.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Camelina sativa]
Length=807

 Score =   374 bits (961),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 223/287 (78%), Gaps = 2/287 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPEND-HTKAFVLTHQRR  705
            +EAAW+ILYHT+YNCTDGIADHN D+IV+ PDWDPS     +  + D H  +      +R
Sbjct  520  IEAAWQILYHTIYNCTDGIADHNTDFIVKLPDWDPSSSIQDESKQTDSHMISTGSYETKR  579

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            RF   + SS LP+ HLWYST+ V+KALK+FL AG +++ SLTYRYD+VDLTRQ LSKLAN
Sbjct  580  RFLFQDKSSGLPKAHLWYSTKQVIKALKIFLEAGDDMSRSLTYRYDMVDLTRQVLSKLAN  639

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVY++++ AF  KD  +L   S+KFL++IKD+DVLLA+DD  LLGTWLESAK L  N+ E
Sbjct  640  QVYIEAVTAFVKKDVGSLRRLSEKFLEIIKDMDVLLASDDNFLLGTWLESAKKLARNNGE  699

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             KQYEWNARTQVTMW+D+    QSKLHDYANKFWSGLLE YYLPRA++YF+ + +SL + 
Sbjct  700  RKQYEWNARTQVTMWYDSKDVNQSKLHDYANKFWSGLLEDYYLPRATLYFSEMLKSLRDK  759

Query  164  VEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
             +FKVE+WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KYF
Sbjct  760  KKFKVEKWRREWIMMSHKWQQSSSEVYPVKAKGDALAISRHLLCKYF  806



>gb|AES69667.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=781

 Score =   374 bits (959),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 211/286 (74%), Gaps = 26/286 (9%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YN TDGIADHN DYIV  PDWDPS                        
Sbjct  522  VDAAWEILYHTIYNSTDGIADHNHDYIVMLPDWDPSAAV---------------------  560

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                  S+ +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSK ANQ
Sbjct  561  -----KSAGMPQAHLWYPPEDVIKALQLFLAGGKNLKGSLTYRYDLVDLTRQVLSKFANQ  615

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+ +I +F  K+  AL ++S  FL+LIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  616  VYIKAITSFQKKNIDALQLNSHMFLELIKDIDLLLASDDNFLLGTWLQSAKKLAVNPSEL  675

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  676  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLKQNE  735

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F + EWRKEWI  S KWQ GSELYPVKA+GDAL I+ ALY+KYFS
Sbjct  736  KFNLTEWRKEWIPMSNKWQEGSELYPVKAKGDALTISQALYKKYFS  781



>ref|XP_003599416.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=807

 Score =   374 bits (960),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 211/286 (74%), Gaps = 26/286 (9%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHT+YN TDGIADHN DYIV  PDWDPS                        
Sbjct  548  VDAAWEILYHTIYNSTDGIADHNHDYIVMLPDWDPSAAV---------------------  586

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                  S+ +PQ HLWY  EDV+KAL+LFLA G  L GSLTYRYDLVDLTRQ LSK ANQ
Sbjct  587  -----KSAGMPQAHLWYPPEDVIKALQLFLAGGKNLKGSLTYRYDLVDLTRQVLSKFANQ  641

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+ +I +F  K+  AL ++S  FL+LIKDID+LLA+DD  LLGTWL+SAK L  N +E 
Sbjct  642  VYIKAITSFQKKNIDALQLNSHMFLELIKDIDLLLASDDNFLLGTWLQSAKKLAVNPSEL  701

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMWFDT +  QSKLHDYANKFWSG+LE+YYLPRAS YF+HLS SL +N 
Sbjct  702  KQYEWNARTQVTMWFDTNETTQSKLHDYANKFWSGILENYYLPRASTYFSHLSESLKQNE  761

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +F + EWRKEWI  S KWQ GSELYPVKA+GDAL I+ ALY+KYFS
Sbjct  762  KFNLTEWRKEWIPMSNKWQEGSELYPVKAKGDALTISQALYKKYFS  807



>ref|XP_010453460.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Camelina 
sativa]
Length=805

 Score =   372 bits (954),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 178/286 (62%), Positives = 222/286 (78%), Gaps = 2/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAW+ILYHTVYNCTDGIADHN D+IV+ PDWDPS        + D          +RR
Sbjct  520  IEAAWDILYHTVYNCTDGIADHNTDFIVKLPDWDPSSSIQDKWKQTDSISTGSY-ETKRR  578

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   + SS LP+ HLWYST++V+KALKLFL AG +L+ SLTYRYD+VDLTRQ LSKLANQ
Sbjct  579  FLFQDKSSGLPKAHLWYSTKEVIKALKLFLEAGDDLSRSLTYRYDMVDLTRQVLSKLANQ  638

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY++++ AF  +D  +L   S+K+L++IKD+DVLLA+DD  LLGTWLESAK L  N++E 
Sbjct  639  VYIEAVTAFVKQDVGSLRRLSEKYLEIIKDMDVLLASDDNFLLGTWLESAKKLARNNDER  698

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D+    QSKLHDYANK+WSGLL+ YYLPRA++YFN + +SL +  
Sbjct  699  KQYEWNARTQVTMWYDSKDLNQSKLHDYANKYWSGLLKDYYLPRATLYFNEMLKSLQDKK  758

Query  161  EFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
            +FKVE+WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KYF
Sbjct  759  KFKVEKWRREWIMMSHKWQQSSSEIYPVKAKGDALAISRHLLCKYF  804



>emb|CDX85632.1| BnaA02g01810D [Brassica napus]
Length=834

 Score =   372 bits (955),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 227/289 (79%), Gaps = 6/289 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHTVYNCTDG+ADHN D+IV+ PDWDPS    S +   D       TH+ +R
Sbjct  549  VDAAWEILYHTVYNCTDGVADHNTDFIVKLPDWDPS---SSSLHGTDTYMISTDTHETKR  605

Query  701  FFLLE-TSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTY-RYDLVDLTRQSLSKLA  528
             FL E  +S LP+ HLWYST++V+KAL+LFL AG +L GSLTY RYD+VDLTRQ LSKLA
Sbjct  606  RFLFEDNTSDLPKAHLWYSTKEVIKALRLFLEAGDDLFGSLTYSRYDMVDLTRQVLSKLA  665

Query  527  NQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            N+VY+D++ AF  KD ++L   S+KFL+LIKDIDVLLA+DD  LLGTWLESAK L  NS+
Sbjct  666  NKVYMDAVTAFVRKDIESLRRLSEKFLELIKDIDVLLASDDNFLLGTWLESAKKLARNSD  725

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E KQYEWNARTQVTMW+D+    QS LHDYANKFWSGLLE YYLPRA+MYF+ L +SL +
Sbjct  726  ERKQYEWNARTQVTMWYDSKGVNQSMLHDYANKFWSGLLEDYYLPRATMYFDELLKSLED  785

Query  167  NVEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYFS  24
              + ++E+WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L +KYF+
Sbjct  786  KKKLEIEKWRREWIMMSHKWQQSSSEVYPVKAKGDALAISRHLLRKYFT  834



>ref|XP_009125936.1| PREDICTED: alpha-N-acetylglucosaminidase [Brassica rapa]
Length=833

 Score =   371 bits (953),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 225/288 (78%), Gaps = 5/288 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAWEILYHTVYNCTDG+ADHN D+IV+ PDWDPS    S +   D       T++ +R
Sbjct  549  VDAAWEILYHTVYNCTDGVADHNTDFIVKLPDWDPS---SSSLHGTDTYMISTDTYETKR  605

Query  701  FFLLE-TSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
             FL E  SS LP+ HLWYST++V+KAL+LFL AG +L GSLTYRYD+VDLTRQ LSKLAN
Sbjct  606  RFLFEDNSSDLPKAHLWYSTKEVIKALRLFLEAGDDLFGSLTYRYDMVDLTRQVLSKLAN  665

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            +VY+D++ AF  KD ++L   S+KFL+LIKDIDVLLA+DD  LLGTW+ESAK L  NS+E
Sbjct  666  KVYMDAVTAFVRKDIESLRRLSEKFLELIKDIDVLLASDDNFLLGTWVESAKKLARNSDE  725

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             KQYEWNARTQVTMW+D+    QS LHDYANKFWSGLLE YYLPRA++YF+ L +SL + 
Sbjct  726  RKQYEWNARTQVTMWYDSKGVNQSMLHDYANKFWSGLLEDYYLPRATLYFDELLKSLEDE  785

Query  164  VEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYFS  24
             + ++E WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KYF+
Sbjct  786  KKLEIERWRREWIIMSHKWQQSSSEVYPVKAKGDALAISRHLLSKYFT  833



>ref|XP_009391536.1| PREDICTED: alpha-N-acetylglucosaminidase [Musa acuminata subsp. 
malaccensis]
Length=811

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 224/288 (78%), Gaps = 5/288 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDH--TKAFVLTHQR  708
            +EAAW ILYHT+YNCTDG+ADHN+DYIV+FPD   S P   D   ++   ++ F +  + 
Sbjct  527  IEAAWNILYHTIYNCTDGVADHNRDYIVQFPD---SVPILQDSQSSNEGPSRRFSVVDKN  583

Query  707  RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLA  528
             RF   ETSSS+P+PHLWYSTE+V+ ALKLFL AG  L  S TYRYDLVDL RQ LSKL 
Sbjct  584  HRFSFRETSSSMPRPHLWYSTEEVINALKLFLDAGDNLTRSATYRYDLVDLARQVLSKLG  643

Query  527  NQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            NQ YLD + A+  KDAKAL+ HSQKFL LI+DID LLA+++  LLGTWLESAKSL  + +
Sbjct  644  NQFYLDVMTAYQEKDAKALNFHSQKFLDLIEDIDELLASNNNFLLGTWLESAKSLAVSDS  703

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E +QY+WNARTQVTMW+D TK  QSKLHDYANKFWSGLL SYYLPRAS YF++LSRSL +
Sbjct  704  ERRQYQWNARTQVTMWYDNTKTNQSKLHDYANKFWSGLLRSYYLPRASTYFSYLSRSLQQ  763

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            N +F +E+WR +WI++S  WQ G+E+Y  +A G+++AI+ AL +KYFS
Sbjct  764  NTDFALEKWRMDWISYSNNWQAGTEVYATEAAGNSIAISKALLEKYFS  811



>ref|XP_006851078.1| hypothetical protein AMTR_s00025p00242240 [Amborella trichopoda]
 gb|ERN12659.1| hypothetical protein AMTR_s00025p00242240 [Amborella trichopoda]
Length=800

 Score =   369 bits (948),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 217/285 (76%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAW+ILYHT+YNCTDGIADHN DYIVE PD+ P+  + +             + + RR
Sbjct  514  IEAAWDILYHTIYNCTDGIADHNNDYIVELPDFVPTLKSNTQNAIGGQMIKASSSERIRR  573

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   ETSS LP+PHLWYS   V+ ALKLFL AG  L GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  574  FSFRETSSDLPRPHLWYSPGKVIHALKLFLDAGDLLIGSLTYRYDLVDLTRQVLSKLANQ  633

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ A+ +K  + L+V SQKF++LIKDID+LLA++DG LLG WLESAK+L  +  + 
Sbjct  634  VYVDALTAYHSKHVEELNVQSQKFIELIKDIDMLLASEDGFLLGPWLESAKNLARSPGQL  693

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +QYEWNARTQVTMW+D T   QSKLHDYANKFWS LL SYYLPRAS YF+HL +SL EN 
Sbjct  694  RQYEWNARTQVTMWYDNTNTNQSKLHDYANKFWSSLLRSYYLPRASTYFDHLLKSLRENQ  753

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +E+WR+EWI++S  WQ G+ELY VKAQGDA  I+  L++KY 
Sbjct  754  SFPLEKWRREWISYSNNWQSGTELYSVKAQGDAFKISKDLFKKYL  798



>emb|CDX91103.1| BnaC02g04940D [Brassica napus]
Length=833

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 222/285 (78%), Gaps = 4/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++AAWEILYHTVYNCTDG+ADHN D+IV+ PDWDPS            T+ +     +RR
Sbjct  548  IDAAWEILYHTVYNCTDGVADHNTDFIVKLPDWDPSSSLHGTDTYMISTEPY---ETKRR  604

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   + SS LP+ HLWYST++V+KAL+LFL AG +L GSL YRYD+VDLTRQ LSKLAN+
Sbjct  605  FLFEDNSSDLPKAHLWYSTKEVIKALRLFLEAGDDLFGSLPYRYDMVDLTRQVLSKLANK  664

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY++++ AF NKD ++L   S+KFL+LIKDIDVLLA+DD  LLGTWLESAK L  NS E 
Sbjct  665  VYMEAVTAFANKDIESLRRFSEKFLELIKDIDVLLASDDNFLLGTWLESAKKLARNSWER  724

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D+    QSKLHDYANKFWSGLLE YYLPRA++YF+ L +SL +  
Sbjct  725  KQYEWNARTQVTMWYDSKGVNQSKLHDYANKFWSGLLEDYYLPRATLYFDELLKSLEDKK  784

Query  161  EFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKY  30
            + ++++WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L +KY
Sbjct  785  KLEIQKWRREWIMMSHKWQQSSSEVYPVKAEGDALAISRHLLRKY  829



>ref|XP_006287089.1| hypothetical protein CARUB_v10000251mg [Capsella rubella]
 gb|EOA19987.1| hypothetical protein CARUB_v10000251mg [Capsella rubella]
Length=806

 Score =   362 bits (929),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/290 (61%), Positives = 223/290 (77%), Gaps = 8/290 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLT----H  714
            +EAAWEILYHT+YNCTDGIADHN D+IV+ PDWDPS    S   E+  T++++ +     
Sbjct  519  IEAAWEILYHTIYNCTDGIADHNTDFIVKLPDWDPS---CSVQDESKETESYMTSTAPYE  575

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
             +RRF   +  S  P+ HLWYST++V+KALKLFL AG +L+ SLTYRYD+VDLTRQ LSK
Sbjct  576  TKRRFLFQDNISGFPKAHLWYSTKEVIKALKLFLEAGDDLSRSLTYRYDMVDLTRQVLSK  635

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
            LANQVY++++ AF  KD   L   S+KFL+++KD+DVLLA+D+  LLGTWLESAK L  N
Sbjct  636  LANQVYIEAVTAFVKKDIGRLRRLSEKFLEIMKDMDVLLASDNNFLLGTWLESAKKLARN  695

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
             +E KQYEWNARTQVTMW+D+    QSKLHDY NKFWSGLLE YYLPRA++YF+ + +SL
Sbjct  696  DDERKQYEWNARTQVTMWYDSKDVNQSKLHDYGNKFWSGLLEDYYLPRATLYFSEMIKSL  755

Query  173  NENVEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKYF  27
             +  +FK+E+WR+EWI  S KWQ+  SE+Y VKA+GDALAI+  L  KYF
Sbjct  756  RDKKKFKIEKWRREWIMKSHKWQQSSSEIYGVKAKGDALAISRHLLCKYF  805



>ref|XP_010534240.1| PREDICTED: alpha-N-acetylglucosaminidase [Tarenaya hassleriana]
Length=817

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 217/290 (75%), Gaps = 4/290 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTH-QRR  705
             EAAWEILYHTVYNCTDGIADHN D+IV+ PDW+PS     +  E   +   +  H  RR
Sbjct  528  TEAAWEILYHTVYNCTDGIADHNTDFIVKLPDWNPSIRERDESEEKSDSDTLLALHGTRR  587

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            RF + +++S+LP+ HLWYS E+V++AL++FL AG +L+GS TYRYDL DL RQ LSKLAN
Sbjct  588  RFLIQDSNSNLPRAHLWYSNEEVVEALRIFLQAGDDLSGSFTYRYDLTDLMRQVLSKLAN  647

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QVY+D++ AF  ++ + L   S+KFL LIKDIDVLLA++D  LLGTWL SAK L  N NE
Sbjct  648  QVYIDAVTAFRERNTENLKRFSEKFLDLIKDIDVLLASNDNFLLGTWLASAKKLAVNHNE  707

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL---  174
             +QYEWNARTQVTMW+DT    QSKLHDYANK+WSGLLE YYLPRA  YF  L  SL   
Sbjct  708  REQYEWNARTQVTMWYDTKDANQSKLHDYANKYWSGLLEDYYLPRAETYFGFLVNSLLEK  767

Query  173  NENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             + +E ++E WR+ WIA S +WQR S+LYPV A+G+ LAI+  L++KYF+
Sbjct  768  KQRLELELESWRRGWIAISNEWQRSSKLYPVTARGETLAISKRLFRKYFA  817



>gb|EMT10178.1| hypothetical protein F775_30738 [Aegilops tauschii]
Length=945

 Score =   354 bits (909),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 222/301 (74%), Gaps = 21/301 (7%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDGIADHN+DYIVEFPD   S  + S       + + V  H R  
Sbjct  543  IQKAWAILYHTIYNCTDGIADHNRDYIVEFPD--ISPSSFSSQYSKRRSISVVRKHPR--  598

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTY----------------RY  570
             FL E S+SLPQPHLWYST + +K+L+LFL AG +L+ SLTY                RY
Sbjct  599  -FLGEVSASLPQPHLWYSTAEAVKSLELFLKAGDDLSESLTYSSGYDSQLLINGNAHRRY  657

Query  569  DLVDLTRQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLG  390
            DLVDL RQSLSKLAN+VYLD++ ++  +D+  L+ H++KFL++I DI+ LLA+DD  LLG
Sbjct  658  DLVDLARQSLSKLANKVYLDAMDSYQMRDSSDLNFHTKKFLEVIMDIETLLASDDNFLLG  717

Query  389  TWLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPR  210
             WLE+AKSL    +E KQYEWNARTQVTMW+D TK  QSKLHDYANKFWSGLL+SYY PR
Sbjct  718  PWLETAKSLATTEDERKQYEWNARTQVTMWYDDTKTEQSKLHDYANKFWSGLLKSYYHPR  777

Query  209  ASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            AS YF  LSRSL EN  F++EEWR++WI++S +WQ G ELYPVKA GDALAI+ +L+ KY
Sbjct  778  ASKYFTRLSRSLQENRSFQLEEWRRDWISYSNEWQSGKELYPVKATGDALAISRSLFAKY  837

Query  29   F  27
            F
Sbjct  838  F  838



>ref|XP_004158231.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase-like 
[Cucumis sativus]
Length=567

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 202/285 (71%), Gaps = 28/285 (10%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAW ILYHT+YNCTDGIA+HN D+IV+ PDWDPS       P                
Sbjct  310  VDAAWNILYHTIYNCTDGIANHNTDFIVKLPDWDPSSTFDLKKP----------------  353

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                        PHLWYST++V+ AL+L +     L  S TYRYDLVDLTRQ L KLAN+
Sbjct  354  ------------PHLWYSTQEVINALQLLVNVDDNLVHSATYRYDLVDLTRQVLGKLANE  401

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             YL ++ AF  ++ KA ++HS++F+QLI+DID LLA++   LLGTWLESAK L  N  E 
Sbjct  402  EYLKAVTAFRRQNVKAQNLHSKRFIQLIRDIDKLLASNSNFLLGTWLESAKKLATNPAEM  461

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANK+WSGLLE YYLPRA  YF +LS+SL +N 
Sbjct  462  KQYEWNARTQVTMWYDNTKVNQSKLHDYANKYWSGLLEGYYLPRALTYFYYLSKSLRKNE  521

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +E+WR+EWI FS KWQ  SELYPVKA+G+A+AI+ ALY+KYF
Sbjct  522  SFHLEDWRREWILFSNKWQAASELYPVKAEGNAVAISKALYEKYF  566



>ref|XP_008461320.1| PREDICTED: alpha-N-acetylglucosaminidase [Cucumis melo]
Length=774

 Score =   341 bits (874),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 204/286 (71%), Gaps = 28/286 (10%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAW ILYHT+YNCTDGIA+HN D+IV+ PDWDPS  +    P                
Sbjct  517  VDAAWNILYHTIYNCTDGIANHNTDFIVKLPDWDPSSSSDLKKP----------------  560

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                        PHLWYST++V+ AL+L +     L  S TYRYDLVDLTRQ L KLAN+
Sbjct  561  ------------PHLWYSTQEVINALQLLVNVDDNLVHSATYRYDLVDLTRQVLGKLANE  608

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             YL ++ AF  ++ KA ++HS++F+QLI+DID LLA++   LLGTWLESAK L  N +E 
Sbjct  609  EYLKAVTAFRRQNVKAQNLHSKRFIQLIRDIDRLLASNSNFLLGTWLESAKKLATNPSEM  668

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANK+WSGLLE YYLPRA  YF +LS+SL +N 
Sbjct  669  KQYEWNARTQVTMWYDNTKVNQSKLHDYANKYWSGLLEGYYLPRALTYFYYLSKSLRKNE  728

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F +E+WR+EWI FS KWQ  SELYPVKA+G+A+AI+ ALY+KYF 
Sbjct  729  SFHLEDWRREWILFSNKWQAASELYPVKAKGNAVAISKALYEKYFG  774



>ref|XP_002465249.1| hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
 gb|EER92247.1| hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
Length=777

 Score =   340 bits (872),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 204/268 (76%), Gaps = 4/268 (1%)
 Frame = -1

Query  827  IADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLLETSSSLPQPHLWYS  648
            + DHNKDYIVEFPD        S   +    +   +    RRFFL E S SLP PHLWYS
Sbjct  513  VEDHNKDYIVEFPD----ISPSSISSQLSKRRGMSIMRNHRRFFLSEVSGSLPHPHLWYS  568

Query  647  TEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKALS  468
            T++ +KAL+LFL AG+  + SLTYRYDLVDLTRQ LSKLAN+VYLD+++++  KD+  L+
Sbjct  569  TKEAIKALELFLDAGSTFSKSLTYRYDLVDLTRQCLSKLANEVYLDAMSSYQKKDSNGLN  628

Query  467  VHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFDTT  288
             H++KFL++I DID LLAADD  LLG WLESAKSL     E +QYEWNARTQVTMW+D T
Sbjct  629  SHTRKFLEIIMDIDTLLAADDNFLLGPWLESAKSLAITEKERQQYEWNARTQVTMWYDNT  688

Query  287  KYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKW  108
            +  QSKLHDYANKFWSGLL+SYYLPRAS YF +L+RSL EN  F++EEWRK+WI++S +W
Sbjct  689  ETEQSKLHDYANKFWSGLLKSYYLPRASKYFAYLTRSLQENQSFQLEEWRKDWISYSNEW  748

Query  107  QRGSELYPVKAQGDALAIANALYQKYFS  24
            Q G E+Y VKA GDALAIA +LY+KY S
Sbjct  749  QSGKEVYAVKATGDALAIARSLYRKYLS  776



>ref|XP_004135943.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus]
Length=774

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 202/285 (71%), Gaps = 28/285 (10%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAW ILYHT+YNCTDGIA+HN D+IV+ PDWDPS       P                
Sbjct  517  VDAAWNILYHTIYNCTDGIANHNTDFIVKLPDWDPSSTFDLKKP----------------  560

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                        PHLWYST++V+ AL+L +     L  S TYRYDLVDLTRQ L KLAN+
Sbjct  561  ------------PHLWYSTQEVINALQLLVNVDDNLVHSATYRYDLVDLTRQVLGKLANE  608

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             YL ++ AF  ++ KA ++HS++F+QLI+DID LLA++   LLGTWLESAK L  N  E 
Sbjct  609  EYLKAVTAFRRQNVKAQNLHSKRFIQLIRDIDKLLASNSNFLLGTWLESAKKLATNPAEM  668

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQVTMW+D TK  QSKLHDYANK+WSGLLE YYLPRA  YF +LS+SL +N 
Sbjct  669  KQYEWNARTQVTMWYDNTKVNQSKLHDYANKYWSGLLEGYYLPRALTYFYYLSKSLRKNE  728

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +E+WR+EWI FS KWQ  SELYPVKA+G+A+AI+ ALY+KYF
Sbjct  729  SFHLEDWRREWILFSNKWQAASELYPVKAEGNAVAISKALYEKYF  773



>gb|KGN45103.1| hypothetical protein Csa_7G425950 [Cucumis sativus]
Length=765

 Score =   323 bits (829),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 198/285 (69%), Gaps = 37/285 (13%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+AAW ILYHT+YNCTDGIA+HN D+IV+ PDWDPS       P                
Sbjct  517  VDAAWNILYHTIYNCTDGIANHNTDFIVKLPDWDPSSTFDLKKP----------------  560

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                        PHLWYST++V+ AL+L +     L  S TYRYDLVDLTRQ L KLAN+
Sbjct  561  ------------PHLWYSTQEVINALQLLVNVDDNLVHSATYRYDLVDLTRQVLGKLANE  608

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             YL ++ AF  ++ KA ++HS++F+QLI+DID LLA++   LLGTWLESAK L       
Sbjct  609  EYLKAVTAFRRQNVKAQNLHSKRFIQLIRDIDKLLASNSNFLLGTWLESAKKL-------  661

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
              YEWNARTQVTMW+D TK  QSKLHDYANK+WSGLLE YYLPRA  YF +LS+SL +N 
Sbjct  662  --YEWNARTQVTMWYDNTKVNQSKLHDYANKYWSGLLEGYYLPRALTYFYYLSKSLRKNE  719

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +E+WR+EWI FS KWQ  SELYPVKA+G+A+AI+ ALY+KYF
Sbjct  720  SFHLEDWRREWILFSNKWQAASELYPVKAEGNAVAISKALYEKYF  764



>gb|EPS59043.1| hypothetical protein M569_15767 [Genlisea aurea]
Length=239

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 179/222 (81%), Gaps = 0/222 (0%)
 Frame = -1

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T +    PH WY+ E+ + ALKLFL AG EL G  TYRYDLVDLTRQ+LSKLAN+VYL 
Sbjct  18   DTITCFSLPHSWYNNEEAINALKLFLDAGKELDGIPTYRYDLVDLTRQTLSKLANEVYLS  77

Query  509  SIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYE  330
            ++ A+ ++D+ +L+ HS+KFLQLI+DID LL +DD  LLGTWLESAK L  N NE++QYE
Sbjct  78   AVLAYGSRDSNSLNSHSRKFLQLIEDIDELLGSDDNFLLGTWLESAKRLAVNENESEQYE  137

Query  329  WNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKV  150
            WNARTQVTMW+D TKY QS+LHDYANKFWSGLL+ YYLPRASMY   +++SL E  EF++
Sbjct  138  WNARTQVTMWYDNTKYKQSQLHDYANKFWSGLLKGYYLPRASMYLGGMAKSLEEKREFEL  197

Query  149  EEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             +WR+EWI +S +WQR  + Y V+A+GDALAIAN+LY+KYF+
Sbjct  198  TKWRREWIEYSNRWQRSRDSYSVEARGDALAIANSLYRKYFA  239



>ref|XP_008793800.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Phoenix dactylifera]
Length=821

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 200/285 (70%), Gaps = 3/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW+ILY T+YNCTDG++D N+D IV FPD DPS      +PE      ++      R
Sbjct  518  LQVAWKILYSTIYNCTDGVSDKNRDVIVAFPDVDPSIIM---IPEVSAKHQYINRRLSER  574

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E S S  QPHLWYST DV+ ALKLFL  G E++ S T+RYDLVDLTRQ+L K ANQ
Sbjct  575  GHLKEISKSYDQPHLWYSTTDVIYALKLFLDNGDEVSDSQTFRYDLVDLTRQALVKYANQ  634

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            V+L+ I  + + D K ++ +SQ FL L+KD+D+LL++ DG LLG+WLESAK L ++S + 
Sbjct  635  VFLEVIEGYQHNDIKQVTFYSQHFLDLVKDLDILLSSHDGFLLGSWLESAKRLAKDSEQE  694

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL+ YY PRA++YF +L  S+ +  
Sbjct  695  KQFEWNARTQITMWFDNTETEASLLRDYGNKYWSGLLQDYYGPRAAIYFKYLLASMVKGE  754

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +E+WR+EWI+ + KWQ   +++ VKA GDAL I+  LY KY 
Sbjct  755  TFPLEDWRREWISLTNKWQSSRKVFTVKASGDALNISRWLYDKYL  799



>ref|XP_010112589.1| hypothetical protein L484_010094 [Morus notabilis]
 gb|EXC34224.1| hypothetical protein L484_010094 [Morus notabilis]
Length=856

 Score =   308 bits (789),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 191/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDG  D N+D IV FPD DPS  +      + H K        R 
Sbjct  559  IQDAWNILYHTVYNCTDGAYDKNRDVIVAFPDVDPSFISIPQGKFSQHEK-----QVSRG  613

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E + S  QPHLWYST +V++AL+LFL  G EL+ S +YRYDLVDLTRQ L+K ANQ
Sbjct  614  SVIQEITESFEQPHLWYSTSEVMRALELFLVCGGELSKSNSYRYDLVDLTRQVLAKYANQ  673

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+ + D K ++  SQKFL+L++DID LLA  DG LLG WLESAK L +N  E 
Sbjct  674  LFLEIIEAYQSNDVKGVTRRSQKFLELVEDIDTLLACHDGFLLGPWLESAKKLAQNEEEK  733

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQVTMWFD +    S L DY NK+WSGLL  YY PRA +YF  L +SL E  
Sbjct  734  KQFEWNARTQVTMWFDNSDDEPSLLRDYGNKYWSGLLRDYYRPRAEIYFKFLIKSLEEGD  793

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+++ WR+EWI  +  WQR    +P+K  G+AL I+  LY KY 
Sbjct  794  DFQLKGWRREWIKLTNDWQRSRNAFPIKGAGNALNISKWLYNKYL  838



>gb|KDO69793.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
 gb|KDO69794.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
 gb|KDO69795.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
Length=545

 Score =   300 bits (767),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 195/285 (68%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        + 
Sbjct  258  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKE  312

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  313  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  372

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  373  LFLNIIEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  432

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF ++  SL    
Sbjct  433  KQYEWNARTQITMWFDNTQEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYMIESLESGD  492

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++++WR+EWI  +  WQ G  +YPV++ GDAL  +  LY KY 
Sbjct  493  GFRLKDWRREWIKLTNDWQNGRNVYPVESNGDALITSQWLYNKYL  537



>gb|KDO69790.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
Length=542

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 195/285 (68%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        + 
Sbjct  255  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKE  309

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  310  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  369

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  370  LFLNIIEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  429

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF ++  SL    
Sbjct  430  KQYEWNARTQITMWFDNTQEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYMIESLESGD  489

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++++WR+EWI  +  WQ G  +YPV++ GDAL  +  LY KY 
Sbjct  490  GFRLKDWRREWIKLTNDWQNGRNVYPVESNGDALITSQWLYNKYL  534



>gb|KDO69789.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
Length=575

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 195/285 (68%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        + 
Sbjct  288  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKE  342

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  343  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  402

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  403  LFLNIIEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  462

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF ++  SL    
Sbjct  463  KQYEWNARTQITMWFDNTQEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYMIESLESGD  522

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++++WR+EWI  +  WQ G  +YPV++ GDAL  +  LY KY 
Sbjct  523  GFRLKDWRREWIKLTNDWQNGRNVYPVESNGDALITSQWLYNKYL  567



>ref|XP_010663217.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Vitis vinifera]
Length=813

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 194/287 (68%), Gaps = 5/287 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPS-DPTGS-DMPENDHTKAFVLTHQR  708
            ++ AW ILYHTVYNCTDG  D N+D IV FPD DPS  PT    MP   H     ++   
Sbjct  522  IQDAWNILYHTVYNCTDGSYDKNRDVIVAFPDIDPSFIPTPKLSMPGGYHRYGKSVS---  578

Query  707  RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLA  528
            RR  L E ++S  QPHLWYST +V  AL LF+A+G +L GS TYRYDLVDLTRQ+L+K A
Sbjct  579  RRTVLKEITNSFEQPHLWYSTSEVKDALGLFIASGGQLLGSNTYRYDLVDLTRQALAKYA  638

Query  527  NQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            NQ++L+ I A+   D +  + HSQKFL+L++D+D LLA  DG LLG WLESAK L ++  
Sbjct  639  NQLFLEVIEAYQLNDVRGAACHSQKFLELVEDMDTLLACHDGFLLGPWLESAKQLAQDEQ  698

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            +  Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L  SL  
Sbjct  699  QEIQFEWNARTQITMWFDNTEDEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLLESLET  758

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              EF +++WR+EWI  +  WQ     YPV++ G+A+  +  LY KY 
Sbjct  759  GNEFALKDWRREWIKLTNDWQNSRNAYPVRSSGNAIDTSRRLYNKYL  805



>emb|CBI15090.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   305 bits (780),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 194/287 (68%), Gaps = 5/287 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPS-DPTGS-DMPENDHTKAFVLTHQR  708
            ++ AW ILYHTVYNCTDG  D N+D IV FPD DPS  PT    MP   H     ++   
Sbjct  555  IQDAWNILYHTVYNCTDGSYDKNRDVIVAFPDIDPSFIPTPKLSMPGGYHRYGKSVS---  611

Query  707  RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLA  528
            RR  L E ++S  QPHLWYST +V  AL LF+A+G +L GS TYRYDLVDLTRQ+L+K A
Sbjct  612  RRTVLKEITNSFEQPHLWYSTSEVKDALGLFIASGGQLLGSNTYRYDLVDLTRQALAKYA  671

Query  527  NQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            NQ++L+ I A+   D +  + HSQKFL+L++D+D LLA  DG LLG WLESAK L ++  
Sbjct  672  NQLFLEVIEAYQLNDVRGAACHSQKFLELVEDMDTLLACHDGFLLGPWLESAKQLAQDEQ  731

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            +  Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L  SL  
Sbjct  732  QEIQFEWNARTQITMWFDNTEDEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLLESLET  791

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              EF +++WR+EWI  +  WQ     YPV++ G+A+  +  LY KY 
Sbjct  792  GNEFALKDWRREWIKLTNDWQNSRNAYPVRSSGNAIDTSRRLYNKYL  838



>ref|XP_010318943.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum lycopersicum]
Length=474

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 196/291 (67%), Gaps = 13/291 (4%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQR--  708
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DP+  +      ND        H+R  
Sbjct  183  MQDAWNILYHTIYNCTDGAYDKNRDVIVSFPDVDPNSISTLQTVLND-------VHERYG  235

Query  707  ----RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSL  540
                RR  L E + S  +PHLWYST +V+ ALKLFL +G +L+   T+RYDL+DLTRQ L
Sbjct  236  KRYLRRAILEEPNDSYDKPHLWYSTSEVIHALKLFLESGNQLSDIRTFRYDLIDLTRQVL  295

Query  539  SKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLT  360
            +K AN+++LD+I A+   D  A++  SQKFL L++D+D+LL   DG LLG W+ESAK L 
Sbjct  296  AKYANELFLDAIEAYKLDDLHAVAHLSQKFLGLVEDLDMLLGCHDGFLLGPWIESAKELA  355

Query  359  ENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSR  180
            ++ ++ +Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L  
Sbjct  356  QDEDQERQFEWNARTQITMWFDNTELEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLIE  415

Query  179  SLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            SL E   F ++ WR+EWI  +  WQ    ++P+K++G+AL ++  L+QKY 
Sbjct  416  SLEEGKGFNLKAWRREWIKLTNSWQSSRNVFPIKSRGNALNVSQWLFQKYL  466



>ref|XP_010928215.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Elaeis guineensis]
Length=823

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 196/287 (68%), Gaps = 5/287 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQR--  708
            ++ AW+ILYHT+YNCTDG+ D N+D IV FPD DPS      +PE           +R  
Sbjct  518  LQVAWKILYHTIYNCTDGVNDKNRDVIVAFPDVDPSIIM---IPEVSKAAKHQYIDRRLS  574

Query  707  RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLA  528
             R  + E S S  QPHLWYST DV+ ALKLFL  G E +   T+RYDLVDLTRQ+L+K A
Sbjct  575  ERGHMKEISDSYDQPHLWYSTIDVIYALKLFLDNGDEASDIQTFRYDLVDLTRQALAKYA  634

Query  527  NQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            NQV+L  I  + + D K ++ +SQ FL L+KD+D+LLA+ DG LLG  LESAK L E+S 
Sbjct  635  NQVFLKVIEGYQHNDIKQVTFYSQHFLDLVKDLDILLASHDGFLLGPCLESAKRLAEDSE  694

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            + KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL+ YY PRA++YF +L  S+ +
Sbjct  695  QEKQFEWNARTQITMWFDNTETEASLLRDYGNKYWSGLLQDYYGPRAAIYFKYLLASMVK  754

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               F +E WR+EWI+ + KWQR  +L+ VKA GDAL I+  L+ KY 
Sbjct  755  GESFPLEHWRREWISLTNKWQRSRKLFSVKASGDALNISRWLFDKYL  801



>ref|XP_006856885.1| hypothetical protein AMTR_s00055p00202230 [Amborella trichopoda]
 gb|ERN18352.1| hypothetical protein AMTR_s00055p00202230 [Amborella trichopoda]
Length=727

 Score =   300 bits (767),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 202/288 (70%), Gaps = 7/288 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDM---PENDHTKAFVLTHQ  711
            ++ AW ILYHTVYNCTDG  D N+D IV FPD DP   + S++    E+  +KA  L   
Sbjct  439  LQDAWNILYHTVYNCTDGKYDKNRDVIVAFPDVDPVMISTSEIFVIEEHKPSKAEGLC--  496

Query  710  RRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKL  531
              R  L E + S  +PH+WY T DV+ ALKLFL++ +E++ S  +RYDL+DLTRQ+++K 
Sbjct  497  --RASLKEITESYDRPHIWYPTSDVINALKLFLSSASEVSESCNFRYDLIDLTRQAVAKH  554

Query  530  ANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS  351
            ANQ++L  IAA+ +KD   ++++SQ FL ++ D+D LLA  +G LLG WLESAK L +N 
Sbjct  555  ANQIFLKVIAAYQSKDLHGVALYSQLFLDIVNDLDTLLACHEGFLLGPWLESAKELAQNE  614

Query  350  NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLN  171
             + KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL+ YY PRA++YF++L  SL 
Sbjct  615  EQEKQYEWNARTQITMWFDNTEVEASLLRDYGNKYWSGLLQDYYGPRAAIYFSYLLESLE  674

Query  170  ENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               +F++ +WR++WIA + KWQ   +++P K +GDAL IA  LY+KY 
Sbjct  675  TGEDFRLIDWRRDWIALTNKWQNSRKIFPSKGEGDALNIALQLYEKYL  722



>ref|XP_006476679.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Citrus sinensis]
Length=814

 Score =   299 bits (766),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 195/285 (68%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        + 
Sbjct  527  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKE  581

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  582  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  641

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  642  LFLNIIEAYQLNDAHGVFQLSRRFLELVEDMDSLLACHDGFLLGPWLESAKQLAQNEEQE  701

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF ++  SL    
Sbjct  702  KQYEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYMIESLESGD  761

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++++WR+EWI  +  WQ G  +YPV++ GDAL  +  LY KY 
Sbjct  762  GFRLKDWRREWIKLTNDWQNGRNVYPVESNGDALITSQWLYNKYL  806



>gb|KJB08355.1| hypothetical protein B456_001G078400 [Gossypium raimondii]
Length=838

 Score =   299 bits (765),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 196/287 (68%), Gaps = 9/287 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGS-DM-PENDHTKAFVLTHQR  708
            +  AW ILYHT+YNCTDG  D N+D IV FPD +PS  +   +M P N    +       
Sbjct  555  IRDAWNILYHTIYNCTDGAYDKNRDVIVAFPDVNPSLISSPLEMYPHNGKPTS-------  607

Query  707  RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLA  528
            RR    E +++  QPHLWYST +V+KAL+LF+A+G EL+ S TY YDLVDLTRQSL+K A
Sbjct  608  RRAVQREKTNAYEQPHLWYSTSEVIKALELFIASGNELSASNTYSYDLVDLTRQSLAKYA  667

Query  527  NQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            N+++L  I A+  KD   ++  SQKFL L++D+D LLA  DG LLG WLESAK L +N  
Sbjct  668  NELFLKIIDAYKFKDVDKVTSLSQKFLDLVEDMDTLLACHDGFLLGPWLESAKQLAQNEE  727

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF  L  S+  
Sbjct  728  EEKQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKILIESVEN  787

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              +FK+ +WR+EWI  +  WQ   +L+PVK+ G+A++I+ +LY KY 
Sbjct  788  GEDFKLHKWRREWIKLTNNWQSSRKLFPVKSSGNAVSISRSLYNKYL  834



>ref|XP_006439738.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52978.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=814

 Score =   298 bits (764),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 196/285 (69%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        ++
Sbjct  527  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKK  581

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  582  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  641

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ + A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  642  LFLNILEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  701

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF ++  SL    
Sbjct  702  KQYEWNARTQITMWFDNTQEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYMIESLESGD  761

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++++WR+EWI  +  WQ G  +YPV++ GDAL  +  LY KY 
Sbjct  762  GFRLKDWRREWIKLTNYWQNGRNVYPVESNGDALITSQWLYNKYL  806



>ref|XP_002318632.2| hypothetical protein POPTR_0012s07760g, partial [Populus trichocarpa]
 gb|EEE96852.2| hypothetical protein POPTR_0012s07760g, partial [Populus trichocarpa]
Length=760

 Score =   297 bits (760),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 199/286 (70%), Gaps = 5/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDG  D N+D IV FPD +P+    S +    HT   +++   RR
Sbjct  473  IQNAWNILYHTVYNCTDGAYDKNRDVIVAFPDVNPN--LVSMLQGRHHTDVKLVS---RR  527

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L++ + S   PHLWYST +V++AL+LF+A G EL+GS TY YDLVDLTRQ L+K AN+
Sbjct  528  AALIKNTDSYEHPHLWYSTTEVVRALELFIAGGDELSGSSTYSYDLVDLTRQVLAKYANE  587

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+  KD+  ++  SQ FL L++DID LLA  +G LLG WLESAK L ++  + 
Sbjct  588  LFLKVIEAYRLKDSHGVAHQSQMFLDLVEDIDTLLACHEGFLLGPWLESAKQLAQDEEQQ  647

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             Q+EWNARTQ+TMW+D T+   S L DY NK+WSGLL+ YY PRA++YFN L++SL    
Sbjct  648  IQFEWNARTQITMWYDNTEVEASLLRDYGNKYWSGLLKDYYGPRAAIYFNFLTQSLENGH  707

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F+++ WR+EWI  + KWQ+  +++PV++ G+AL I+  LY KY  
Sbjct  708  GFQLKAWRREWIKLTNKWQKSRKIFPVESNGNALNISRWLYHKYLG  753



>gb|KHN19340.1| Alpha-N-acetylglucosaminidase [Glycine soja]
Length=339

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 188/286 (66%), Gaps = 6/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS  +      + + K +  T     
Sbjct  47   IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLISVQHEQSHHNDKPYSGT-----  101

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E + S  QPHLWY T +V+ AL+LF+ +G EL+   TYRYDLVDLTRQ L+K AN+
Sbjct  102  -IIKEITDSFDQPHLWYPTSEVIYALELFITSGDELSRCNTYRYDLVDLTRQVLAKYANE  160

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I A+ ++D   +++ SQ+FL L++D+D LLA  DG LLG WLESAK L  N  + 
Sbjct  161  LFFKVIEAYQSRDIHGMTLLSQRFLDLVEDLDTLLACHDGFLLGPWLESAKQLALNEEQE  220

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+W+GLL  YY PRA++YF +L  SL    
Sbjct  221  RQFEWNARTQITMWFDNSDEEASLLRDYGNKYWNGLLHDYYGPRAAIYFKYLRESLESGE  280

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+  WR+EWI  + +WQ+   ++PV++ GDAL  +  L+ KY +
Sbjct  281  DFKLRGWRREWIKLTNEWQKRRNIFPVESSGDALNTSRWLFNKYLN  326



>ref|XP_007036097.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 2 
[Theobroma cacao]
 gb|EOY20598.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 2 
[Theobroma cacao]
Length=572

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 192/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +  AW ILY T+YNCTDG  D N+D IV FPD  PS  +   +P   +      T   RR
Sbjct  288  ISDAWSILYRTLYNCTDGAYDKNRDVIVAFPDVSPSFIS---LPRERYHHYGKPTS--RR  342

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E + +  QPHLWYST +V++AL+LF+ +G  L+ S TYRYDLVDLTRQ+L+K AN+
Sbjct  343  AVLSEKTDAYDQPHLWYSTSEVIRALELFITSGDALSASNTYRYDLVDLTRQALAKYANE  402

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+  KD   ++  SQKFL+L++D+D LLA  DG LLG WLESAK L +N  E 
Sbjct  403  LFLEIIDAYELKDVNRVTTLSQKFLELVEDMDTLLACHDGFLLGPWLESAKQLAQNKEEE  462

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD TK   S L DY NK+WSG++  YY PRA++YF  L  SL    
Sbjct  463  KQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGVVGDYYGPRATIYFKVLIESLENGE  522

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +FKV++WR EWI  +  WQ   ++YPV++ G+AL I+  LY KY 
Sbjct  523  DFKVKKWRGEWIKLTNDWQTSRKVYPVESNGNALTISRWLYNKYL  567



>ref|XP_007210354.1| hypothetical protein PRUPE_ppa001642mg [Prunus persica]
 gb|EMJ11553.1| hypothetical protein PRUPE_ppa001642mg [Prunus persica]
Length=787

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 192/289 (66%), Gaps = 11/289 (4%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPS---DPTGSDMPENDHTKAFVLTHQ  711
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DPS    P  +  P  +          
Sbjct  489  IQDAWNILYHTLYNCTDGAYDKNRDVIVAFPDVDPSFISIPPEAFQPNENPVAG------  542

Query  710  RRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKL  531
              R  L E + S  QPHLWYST +V+ AL +F+A+G EL+ S  YRYDLVDLTRQ+L+K 
Sbjct  543  --RAVLKEITDSFDQPHLWYSTSEVIHALDIFIASGDELSESSAYRYDLVDLTRQALAKY  600

Query  530  ANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS  351
            ANQ++L  I A+   DA  ++  SQKFL L++D+D LLA  DG LLG WLESAK L ++ 
Sbjct  601  ANQLFLKVIEAYQFNDAIGVARRSQKFLGLVEDMDTLLACHDGFLLGPWLESAKKLAQDE  660

Query  350  NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLN  171
             + KQ+EWNARTQ+TMWFD TK   S L DY NK+WSGLL  YY PRA++YF +L++SL 
Sbjct  661  EQEKQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLTQSLE  720

Query  170  ENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
               EF++++WR+EWI  +  WQ   + +PVK+ G+AL  +  L+ KY  
Sbjct  721  WGSEFRLKDWRREWIKLTNDWQNSRKEFPVKSSGNALNTSRWLFDKYLG  769



>ref|XP_002511461.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
 gb|EEF52063.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Length=809

 Score =   295 bits (756),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 144/285 (51%), Positives = 192/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW+ILYHTVYNCTDG  D N+D IV FPD +P   + S    + + K        RR
Sbjct  521  IQDAWDILYHTVYNCTDGAYDKNRDVIVAFPDVNPFYFSVSQKRHHLNGKPV-----SRR  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E S S   PHLWYST +VL AL+LF+ +G EL+GS TY YDLVDLTRQ+L+K  N+
Sbjct  576  AVLKENSDSYDHPHLWYSTSEVLHALELFITSGEELSGSSTYSYDLVDLTRQALAKYGNE  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I ++   D   ++  SQKFL L++D+D LL   +G LLG WLESAK L ++  + 
Sbjct  636  LFLKIIESYQANDGNGVASRSQKFLDLVEDMDTLLGCHEGFLLGPWLESAKQLAQDQEQE  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD T+   S LHDY NK+WSGLL+ YY PRA++YF +L +SL    
Sbjct  696  KQFEWNARTQITMWFDNTEDEASLLHDYGNKYWSGLLQDYYGPRAAIYFKYLIKSLENGK  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +++WR+EWI  + +WQR    +PVK+ G+AL I+  LY KY 
Sbjct  756  VFPLKDWRREWIKLTNEWQRSRNKFPVKSNGNALIISKWLYDKYL  800



>ref|XP_006345181.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum tuberosum]
Length=819

 Score =   296 bits (757),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 198/285 (69%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DP+  +      ND  + +   + RR 
Sbjct  528  MQDAWNILYHTIYNCTDGAYDKNRDVIVSFPDVDPNSISTLQTVLNDVHEQYGKRYLRRA  587

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E + S  +PHLWYST +V+ ALKLFL +G +L+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  588  I-LEEPNDSYDKPHLWYSTSEVIHALKLFLESGNQLSDSSTYRYDLIDLTRQALAKYANE  646

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++LD+I A+   D  A++  S+KFL L++D+D+LL   DG LLG W+ESAK L ++ ++ 
Sbjct  647  LFLDAIEAYKLDDLHAVAHLSEKFLGLVEDLDMLLGCHDGFLLGPWIESAKELAQDEDQE  706

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L+ SL E  
Sbjct  707  RQFEWNARTQITMWFDNTELEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLTESLEEGK  766

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F ++ WR+EWI  +  WQ    ++PVK+ G+AL ++  L++KY 
Sbjct  767  GFDLKAWRREWIKLTNSWQSSRNVFPVKSTGNALNVSQWLFEKYL  811



>gb|KHG03421.1| Alpha-N-acetylglucosaminidase [Gossypium arboreum]
Length=804

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 192/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +  AW ILYHTVYNCTD   D N+D IV FPD +PS    S +    H          RR
Sbjct  521  IRDAWNILYHTVYNCTDEAYDKNRDVIVAFPDVNPSL-ISSPLEMYPHYG----KPTSRR  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E  ++  QPHLWYST +V+KAL+LF+A+G EL+ S TY YDLVDLTRQSL+K AN+
Sbjct  576  AILREKKNAYEQPHLWYSTSEVIKALELFIASGKELSASNTYGYDLVDLTRQSLAKYANE  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+  KD   ++  SQKFL L++D+D LLA  DG LLG WLESAK L +N  E 
Sbjct  636  LFLKIIDAYKFKDVDKVTSLSQKFLDLVEDMDTLLACHDGFLLGPWLESAKQLAQNEEEE  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF  L  S+    
Sbjct  696  KQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAVYFKILIESVENGE  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F++ +WR+EWI  +  WQ   +L+PVK+ G+A++I+ +LY KY 
Sbjct  756  DFRLHKWRREWIKLTNNWQSSRKLFPVKSSGNAVSISRSLYNKYL  800



>ref|XP_008239708.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Prunus mume]
Length=819

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 192/289 (66%), Gaps = 11/289 (4%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPS---DPTGSDMPENDHTKAFVLTHQ  711
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DPS    P  +  P  +          
Sbjct  521  IQDAWNILYHTLYNCTDGAYDKNRDVIVAFPDVDPSFISIPPEAFQPNENPVAG------  574

Query  710  RRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKL  531
              R  L E + S  QPHLWYST +V+ AL +F+A+G EL+ S  YRYDLVDLTRQ+L+K 
Sbjct  575  --RAVLKEITDSFDQPHLWYSTSEVIHALDIFIASGDELSESNAYRYDLVDLTRQALAKY  632

Query  530  ANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS  351
            ANQ++L  I A+   DA  ++  SQKFL L++D+D LLA  DG LLG WLESAK L ++ 
Sbjct  633  ANQLFLKVIEAYQFNDAIGVARRSQKFLGLVEDMDTLLACHDGFLLGPWLESAKKLAQDE  692

Query  350  NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLN  171
             + KQ+EWNARTQ+TMWFD TK   S L DY NK+WSGLL  YY PRA++YF +L++SL 
Sbjct  693  EQEKQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLTQSLE  752

Query  170  ENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
               EF++++WR+EWI  +  WQ   + +PVK+ G+AL  +  L+ KY  
Sbjct  753  WGSEFRLKDWRREWIKLTNDWQNSRKEFPVKSSGNALNTSRWLFDKYLG  801



>ref|XP_010027888.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Eucalyptus 
grandis]
Length=673

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 190/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+HT+YNCTDG+ D N+D IV FPD DPS  + S +  + + K        R 
Sbjct  386  IKEAWNILHHTIYNCTDGLYDKNRDVIVAFPDADPSSISFSQLRYHRYGKPLF-----RG  440

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E +    +PH+WYST +V++AL+LFLA G +L  S TYRYDLVDLTRQ+L+K AN+
Sbjct  441  AVLNEKTGLTDEPHMWYSTSEVVRALELFLAGGDQLQSSDTYRYDLVDLTRQALAKFANE  500

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  +  +DA  ++ HSQKFL L++D+D LLA  +G LLG WLESAK L +N  + 
Sbjct  501  LFLKVIEDYQRQDAYGVAFHSQKFLNLVEDMDTLLACHEGFLLGPWLESAKQLAQNKEQE  560

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+WSGLL  YY PRA++YF  L  SL E  
Sbjct  561  RQFEWNARTQITMWFDNSVEEASLLRDYGNKYWSGLLRDYYGPRAALYFKFLKESLAEGH  620

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+++EWR+EW+  +  WQ    L+P ++ G A   +  LY KY 
Sbjct  621  DFRLKEWRREWVKLTNDWQNSRNLFPTQSVGHAFHTSQWLYDKYL  665



>ref|XP_011008329.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Populus 
euphratica]
Length=813

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 198/286 (69%), Gaps = 5/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDG  D N+D IV FPD +P+    S +    HT   +++   RR
Sbjct  526  IQNAWNILYHTVYNCTDGAYDKNRDVIVAFPDVNPN--LVSMLQGRHHTNVKLVS---RR  580

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L++ + S   PHLWYST +V++AL+LF+A G EL+GS TY YDLVDLTRQ L+K AN+
Sbjct  581  ADLVKNTDSYEHPHLWYSTTEVVRALELFIAGGDELSGSGTYSYDLVDLTRQVLAKYANE  640

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+  KD+  ++  SQ FL L++DID LLA  +G LLG WLESAK L ++  + 
Sbjct  641  LFLKVIEAYQLKDSHGVAHQSQMFLDLVEDIDTLLACHEGFLLGPWLESAKQLAQDEEQQ  700

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             Q+EWNARTQ+TMW+D T+   S L DY NK+WSGLL+ YY PRA++YFN L++SL    
Sbjct  701  IQFEWNARTQITMWYDNTEVEASLLRDYGNKYWSGLLKDYYGPRAAIYFNFLTQSLENGH  760

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F+++ WR+EWI  +  WQ+  +++PV++ G+AL I+  L+ KY  
Sbjct  761  GFQLKAWRREWIELTNNWQKSRKIFPVESNGNALNISRRLFHKYLG  806



>ref|XP_011008330.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Populus 
euphratica]
Length=812

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 198/286 (69%), Gaps = 5/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDG  D N+D IV FPD +P+    S +    HT   +++   RR
Sbjct  525  IQNAWNILYHTVYNCTDGAYDKNRDVIVAFPDVNPN--LVSMLQGRHHTNVKLVS---RR  579

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L++ + S   PHLWYST +V++AL+LF+A G EL+GS TY YDLVDLTRQ L+K AN+
Sbjct  580  ADLVKNTDSYEHPHLWYSTTEVVRALELFIAGGDELSGSGTYSYDLVDLTRQVLAKYANE  639

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+  KD+  ++  SQ FL L++DID LLA  +G LLG WLESAK L ++  + 
Sbjct  640  LFLKVIEAYQLKDSHGVAHQSQMFLDLVEDIDTLLACHEGFLLGPWLESAKQLAQDEEQQ  699

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             Q+EWNARTQ+TMW+D T+   S L DY NK+WSGLL+ YY PRA++YFN L++SL    
Sbjct  700  IQFEWNARTQITMWYDNTEVEASLLRDYGNKYWSGLLKDYYGPRAAIYFNFLTQSLENGH  759

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             F+++ WR+EWI  +  WQ+  +++PV++ G+AL I+  L+ KY  
Sbjct  760  GFQLKAWRREWIELTNNWQKSRKIFPVESNGNALNISRRLFHKYLG  805



>ref|XP_004166229.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Cucumis 
sativus]
Length=336

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/289 (48%), Positives = 184/289 (64%), Gaps = 15/289 (5%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSD----PTGSDMPENDHTKAFVLTH  714
            ++ AW++LYHTVYNCTDG  D N+D IV FPD DPS     P GS+   N  +    L  
Sbjct  51   IQDAWDVLYHTVYNCTDGANDKNRDVIVAFPDVDPSAILVLPEGSNRHGNLDSSVDRLQ-  109

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
                       ++  +PHLWY T +V+ ALKLF+A G +L+ S TYRYDLVDLTRQ+L+K
Sbjct  110  ----------DATFDRPHLWYPTSEVISALKLFIAGGDQLSSSNTYRYDLVDLTRQALAK  159

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
             +N+++   + A+   D + ++  SQ+FL+L+ DID LLA  +G LLG WL+SAK L  +
Sbjct  160  YSNELFFRIVKAYQLHDVQTMASLSQEFLELVNDIDTLLACHEGFLLGPWLQSAKQLARS  219

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
              E KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++Y   L  S 
Sbjct  220  EEEEKQYEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLGDYYCPRAAIYLKFLKESS  279

Query  173  NENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
                 F +  WR+EWI  +  WQ   ++YPV++ GDAL  ++ LY KY 
Sbjct  280  ENGYRFPLSNWRREWIKLTNDWQSSRKIYPVESNGDALDTSHWLYNKYL  328



>ref|XP_011087174.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Sesamum indicum]
Length=944

 Score =   296 bits (758),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 190/285 (67%), Gaps = 0/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDG+ D N+D IV FPD DP+    S +               RR
Sbjct  652  IQDAWNILYHTVYNCTDGLNDKNRDVIVAFPDVDPNSIFTSSLLSLPRKHRHSNNRSLRR  711

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                ++S+S   PHLWYST +V++AL+LFL +G +L+ S T+RYDL+DLTRQ+L+K ANQ
Sbjct  712  AIYQQSSNSYTHPHLWYSTSEVIRALQLFLTSGNQLSESNTFRYDLIDLTRQALAKYANQ  771

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            + L  + A+   D  A+   SQKFL L++D+D LLA  DG LLG WL+SAK L +N  + 
Sbjct  772  LLLKVVEAYQLGDLHAVIHRSQKFLSLVEDLDTLLACHDGFLLGPWLKSAKQLAQNDEQK  831

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF  L +SL    
Sbjct  832  KQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKFLIQSLESGD  891

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++ +WRKEWI  +  WQ  S ++P K+ GDAL ++  LY+KY 
Sbjct  892  GFRLRQWRKEWIKLTNDWQNRSNVFPTKSTGDALNVSRRLYKKYL  936



>gb|KDP31153.1| hypothetical protein JCGZ_11529 [Jatropha curcas]
Length=808

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+ AW ILYHTVYNCTDG  D N+D IV FPD DP         +   +K     H  RR
Sbjct  521  VQDAWNILYHTVYNCTDGAYDKNRDVIVAFPDVDPFFILARQKQQQHSSK-----HVARR  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E S S   PHLWYST  VL+AL+LF+ +G EL+GS T+ YDLVDLTRQ+L+K AN+
Sbjct  576  AVMNENSDSYDHPHLWYSTSQVLRALELFITSGEELSGSNTFSYDLVDLTRQALAKYANE  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I ++ + DA  ++  SQKFL L++D+D LLA  +G LLG WLESAK L  ++ + 
Sbjct  636  LFLKVIESYQSNDANMVASLSQKFLDLVEDMDTLLACHEGFLLGPWLESAKQLARDNEQE  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L  SL    
Sbjct  696  RQFEWNARTQITMWFDNTEDEASLLRDYGNKYWSGLLLDYYGPRAAIYFKYLINSLETGQ  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F++++WR+EWI  +  WQ+   ++PVK+ G+ L I+  LY KY 
Sbjct  756  GFQLQDWRREWIKLTNDWQKSRNIFPVKSNGNPLIISKWLYDKYL  800



>ref|XP_008393079.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Malus 
domestica]
Length=822

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DPS    S + E  H     +      
Sbjct  525  IQDAWNILYHTIYNCTDGAYDKNRDVIVAFPDVDPS--LISTLSEGRHQNEKPVAGSA--  580

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E + S  +PHLWYST +V+ AL+LF+A+G EL+ S  YRYDLVDLTRQ+LSK ANQ
Sbjct  581  -VLKEVTDSFDRPHLWYSTSEVIHALELFIASGDELSESSAYRYDLVDLTRQALSKYANQ  639

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+ + D   ++  S+KFL L++D+D LLA  DG LLG WLESAK L ++  + 
Sbjct  640  LFLKVIEAYHSNDVLGVARDSKKFLDLVEDMDXLLACHDGFLLGPWLESAKKLAQDXEQE  699

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L++SL E  
Sbjct  700  KQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLTKSLEEGG  759

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +++WR+EWI  +  WQ   + +PVK+ G+A   +  L+ KY 
Sbjct  760  XFGLKDWRREWIKLTNDWQNSRKXFPVKSTGNAJNTSRWLFDKYL  804



>ref|XP_008393078.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Malus 
domestica]
Length=823

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 191/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DPS    S + E  H     +      
Sbjct  526  IQDAWNILYHTIYNCTDGAYDKNRDVIVAFPDVDPS--LISTLSEGRHQNEKPVAGSA--  581

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E + S  +PHLWYST +V+ AL+LF+A+G EL+ S  YRYDLVDLTRQ+LSK ANQ
Sbjct  582  -VLKEVTDSFDRPHLWYSTSEVIHALELFIASGDELSESSAYRYDLVDLTRQALSKYANQ  640

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+ + D   ++  S+KFL L++D+D LLA  DG LLG WLESAK L ++  + 
Sbjct  641  LFLKVIEAYHSNDVLGVARDSKKFLDLVEDMDXLLACHDGFLLGPWLESAKKLAQDXEQE  700

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L++SL E  
Sbjct  701  KQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLTKSLEEGG  760

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +++WR+EWI  +  WQ   + +PVK+ G+A   +  L+ KY 
Sbjct  761  XFGLKDWRREWIKLTNDWQNSRKXFPVKSTGNAJNTSRWLFDKYL  805



>ref|XP_007036096.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
 gb|EOY20597.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
Length=798

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 192/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +  AW ILY T+YNCTDG  D N+D IV FPD  PS  +   +P   +      T   RR
Sbjct  514  ISDAWSILYRTLYNCTDGAYDKNRDVIVAFPDVSPSFIS---LPRERYHHYGKPT--SRR  568

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E + +  QPHLWYST +V++AL+LF+ +G  L+ S TYRYDLVDLTRQ+L+K AN+
Sbjct  569  AVLSEKTDAYDQPHLWYSTSEVIRALELFITSGDALSASNTYRYDLVDLTRQALAKYANE  628

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+  KD   ++  SQKFL+L++D+D LLA  DG LLG WLESAK L +N  E 
Sbjct  629  LFLEIIDAYELKDVNRVTTLSQKFLELVEDMDTLLACHDGFLLGPWLESAKQLAQNKEEE  688

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            KQ+EWNARTQ+TMWFD TK   S L DY NK+WSG++  YY PRA++YF  L  SL    
Sbjct  689  KQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGVVGDYYGPRATIYFKVLIESLENGE  748

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +FKV++WR EWI  +  WQ   ++YPV++ G+AL I+  LY KY 
Sbjct  749  DFKVKKWRGEWIKLTNDWQTSRKVYPVESNGNALTISRWLYNKYL  793



>ref|XP_007138122.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
 gb|ESW10116.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
Length=594

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 191/286 (67%), Gaps = 7/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS  +     + D +  +   ++   
Sbjct  303  IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLIS----VQYDQSHHY---YRPSG  355

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E +    +PHLWYST +V+ AL+LF+  G EL+ S TYRYDLVDLTRQ L+K AN+
Sbjct  356  TVIKEITDPFDRPHLWYSTSEVIYALELFITIGDELSRSKTYRYDLVDLTRQVLAKYANE  415

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I A+ + D   +++ SQ+FL L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  416  LFFKVIEAYKSHDVHGMTLLSQRFLDLVEDLDTLLACHDGFLLGPWLESAKQLAQNEEQE  475

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD TK   S L DY NK+WSGLL  YY PRA++YF +L  SL    
Sbjct  476  RQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGLLHDYYGPRAAIYFKYLRESLERGE  535

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+ EWR+EWI  + +WQ+    +PV+++GDAL  +  L+ KY +
Sbjct  536  DFKLIEWRREWIKLTNEWQKSRNTFPVESKGDALNTSRWLFNKYLN  581



>ref|XP_010027879.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Eucalyptus 
grandis]
Length=816

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 190/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+HT+YNCTDG+ D N+D IV FPD DPS  + S +  + + K        R 
Sbjct  529  IKEAWNILHHTIYNCTDGLYDKNRDVIVAFPDADPSSISFSQLRYHRYGKPLF-----RG  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E +    +PH+WYST +V++AL+LFLA G +L  S TYRYDLVDLTRQ+L+K AN+
Sbjct  584  AVLNEKTGLTDEPHMWYSTSEVVRALELFLAGGDQLQSSDTYRYDLVDLTRQALAKFANE  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  +  +DA  ++ HSQKFL L++D+D LLA  +G LLG WLESAK L +N  + 
Sbjct  644  LFLKVIEDYQRQDAYGVAFHSQKFLNLVEDMDTLLACHEGFLLGPWLESAKQLAQNKEQE  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+WSGLL  YY PRA++YF  L  SL E  
Sbjct  704  RQFEWNARTQITMWFDNSVEEASLLRDYGNKYWSGLLRDYYGPRAALYFKFLKESLAEGH  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+++EWR+EW+  +  WQ    L+P ++ G A   +  LY KY 
Sbjct  764  DFRLKEWRREWVKLTNDWQNSRNLFPTQSVGHAFHTSQWLYDKYL  808



>ref|XP_010027872.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Eucalyptus 
grandis]
Length=817

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 190/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+HT+YNCTDG+ D N+D IV FPD DPS  + S +  + + K        R 
Sbjct  530  IKEAWNILHHTIYNCTDGLYDKNRDVIVAFPDADPSSISFSQLRYHRYGKPLF-----RG  584

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E +    +PH+WYST +V++AL+LFLA G +L  S TYRYDLVDLTRQ+L+K AN+
Sbjct  585  AVLNEKTGLTDEPHMWYSTSEVVRALELFLAGGDQLQSSDTYRYDLVDLTRQALAKFANE  644

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  +  +DA  ++ HSQKFL L++D+D LLA  +G LLG WLESAK L +N  + 
Sbjct  645  LFLKVIEDYQRQDAYGVAFHSQKFLNLVEDMDTLLACHEGFLLGPWLESAKQLAQNKEQE  704

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+WSGLL  YY PRA++YF  L  SL E  
Sbjct  705  RQFEWNARTQITMWFDNSVEEASLLRDYGNKYWSGLLRDYYGPRAALYFKFLKESLAEGH  764

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+++EWR+EW+  +  WQ    L+P ++ G A   +  LY KY 
Sbjct  765  DFRLKEWRREWVKLTNDWQNSRNLFPTQSVGHAFHTSQWLYDKYL  809



>gb|KCW83402.1| hypothetical protein EUGRSUZ_B00338 [Eucalyptus grandis]
Length=822

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 190/285 (67%), Gaps = 5/285 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+HT+YNCTDG+ D N+D IV FPD DPS  + S +  + + K        R 
Sbjct  535  IKEAWNILHHTIYNCTDGLYDKNRDVIVAFPDADPSSISFSQLRYHRYGKPLF-----RG  589

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E +    +PH+WYST +V++AL+LFLA G +L  S TYRYDLVDLTRQ+L+K AN+
Sbjct  590  AVLNEKTGLTDEPHMWYSTSEVVRALELFLAGGDQLQSSDTYRYDLVDLTRQALAKFANE  649

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  +  +DA  ++ HSQKFL L++D+D LLA  +G LLG WLESAK L +N  + 
Sbjct  650  LFLKVIEDYQRQDAYGVAFHSQKFLNLVEDMDTLLACHEGFLLGPWLESAKQLAQNKEQE  709

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+WSGLL  YY PRA++YF  L  SL E  
Sbjct  710  RQFEWNARTQITMWFDNSVEEASLLRDYGNKYWSGLLRDYYGPRAALYFKFLKESLAEGH  769

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F+++EWR+EW+  +  WQ    L+P ++ G A   +  LY KY 
Sbjct  770  DFRLKEWRREWVKLTNDWQNSRNLFPTQSVGHAFHTSQWLYDKYL  814



>ref|XP_011464528.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Fragaria vesca 
subsp. vesca]
Length=827

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/285 (51%), Positives = 191/285 (67%), Gaps = 3/285 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+ AW IL HT YNCTDG  D N+D IV FPD DPS           + K+ V    RR 
Sbjct  531  VQDAWSILRHTTYNCTDGAYDKNRDVIVAFPDVDPSFIARPPQGYYQNEKSLV---SRRA  587

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E + S  +PHLWYST +V+ AL+LF+A+G EL+GS TYRYDLVDLTRQ+L+K AN+
Sbjct  588  ELLEEVTDSFERPHLWYSTSEVVHALELFIASGDELSGSNTYRYDLVDLTRQALAKYANE  647

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I A+   D   +   SQKFL+L++D+D LLA  DG LLG WLESAK L ++  + 
Sbjct  648  LFLKVIEAYHLNDTLEVVGLSQKFLELVEDMDTLLACHDGFLLGPWLESAKKLAQDKEQE  707

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L +SL+E  
Sbjct  708  IQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKYLIKSLDEGS  767

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            +F ++ WR+EWI  +  WQ     +PVK+ G+A+  +  L++KY 
Sbjct  768  DFDLKNWRREWIKLTNDWQSSRNTFPVKSTGNAVTTSRLLFEKYL  812



>ref|XP_009625152.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=824

 Score =   291 bits (744),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 191/291 (66%), Gaps = 13/291 (4%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQR--  708
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DP   +   +  ND        H++  
Sbjct  523  MQDAWNILYHTIYNCTDGAYDKNRDVIVAFPDVDPKFISTLQIALND-------IHEQDG  575

Query  707  ----RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSL  540
                 R  L E + S  +PHLWYS  DV+ ALKLFL +G +L  S TYRYDL+DLTRQ+L
Sbjct  576  KRYLGRAILEEANDSYDKPHLWYSNSDVIHALKLFLESGNQLTDSSTYRYDLIDLTRQAL  635

Query  539  SKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLT  360
            +K AN+++LD I A+   D  A+S  SQKFL L+KD+D+LL   DG LLG W+ESAK L 
Sbjct  636  AKYANELFLDVIEAYKLDDLHAVSHLSQKFLGLVKDMDMLLGCHDGFLLGPWIESAKKLA  695

Query  359  ENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSR  180
            ++ ++ +Q+EWNARTQ+TMWFD ++   S L DY NK+WSGLL  YY PRA++YF  L  
Sbjct  696  QDEDQERQFEWNARTQITMWFDNSEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKFLIA  755

Query  179  SLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            SL E   F +  WR+EWI  +  WQ    ++PVK+ GDAL ++  L++KY 
Sbjct  756  SLEEGKGFSLRGWRREWIKLTNNWQNSRNVFPVKSTGDALKVSQWLFEKYL  806



>ref|XP_009625151.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=832

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 191/291 (66%), Gaps = 13/291 (4%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQR--  708
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DP   +   +  ND        H++  
Sbjct  531  MQDAWNILYHTIYNCTDGAYDKNRDVIVAFPDVDPKFISTLQIALND-------IHEQDG  583

Query  707  ----RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSL  540
                 R  L E + S  +PHLWYS  DV+ ALKLFL +G +L  S TYRYDL+DLTRQ+L
Sbjct  584  KRYLGRAILEEANDSYDKPHLWYSNSDVIHALKLFLESGNQLTDSSTYRYDLIDLTRQAL  643

Query  539  SKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLT  360
            +K AN+++LD I A+   D  A+S  SQKFL L+KD+D+LL   DG LLG W+ESAK L 
Sbjct  644  AKYANELFLDVIEAYKLDDLHAVSHLSQKFLGLVKDMDMLLGCHDGFLLGPWIESAKKLA  703

Query  359  ENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSR  180
            ++ ++ +Q+EWNARTQ+TMWFD ++   S L DY NK+WSGLL  YY PRA++YF  L  
Sbjct  704  QDEDQERQFEWNARTQITMWFDNSEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKFLIA  763

Query  179  SLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            SL E   F +  WR+EWI  +  WQ    ++PVK+ GDAL ++  L++KY 
Sbjct  764  SLEEGKGFSLRGWRREWIKLTNNWQNSRNVFPVKSTGDALKVSQWLFEKYL  814



>gb|KEH35072.1| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=786

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 189/286 (66%), Gaps = 6/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS  +        + K F       R
Sbjct  479  IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLLSVQHEHSRPYGKPF------SR  532

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                E + S  +PHLWYST +V+ AL+LF+++G EL  S TYRYDLVDLTRQ L+K ANQ
Sbjct  533  AVSKEITDSFDRPHLWYSTSEVIYALELFISSGNELPKSSTYRYDLVDLTRQVLAKYANQ  592

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I A+ ++D   +++ SQ+FL L++D+D LLA  DG LLG WL+SA  L +N  + 
Sbjct  593  LFFKVIEAYQSRDIHEVTLLSQRFLDLVEDLDTLLACHDGFLLGPWLDSAIQLAQNEEQK  652

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF +L  SL    
Sbjct  653  RQFEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLSDYYGPRAAIYFKYLRESLEAGE  712

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK++EWRKEWI  +  WQ    ++PV ++GDAL  +  L+ KY +
Sbjct  713  DFKLKEWRKEWIKLTNDWQSRRNIFPVVSRGDALNTSRWLFNKYLN  758



>ref|XP_007138123.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
 gb|ESW10117.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
Length=777

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 191/286 (67%), Gaps = 7/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS  +     + D +  +   ++   
Sbjct  486  IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLIS----VQYDQSHHY---YRPSG  538

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E +    +PHLWYST +V+ AL+LF+  G EL+ S TYRYDLVDLTRQ L+K AN+
Sbjct  539  TVIKEITDPFDRPHLWYSTSEVIYALELFITIGDELSRSKTYRYDLVDLTRQVLAKYANE  598

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I A+ + D   +++ SQ+FL L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  599  LFFKVIEAYKSHDVHGMTLLSQRFLDLVEDLDTLLACHDGFLLGPWLESAKQLAQNEEQE  658

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD TK   S L DY NK+WSGLL  YY PRA++YF +L  SL    
Sbjct  659  RQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGLLHDYYGPRAAIYFKYLRESLERGE  718

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+ EWR+EWI  + +WQ+    +PV+++GDAL  +  L+ KY +
Sbjct  719  DFKLIEWRREWIKLTNEWQKSRNTFPVESKGDALNTSRWLFNKYLN  764



>ref|XP_009799801.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Nicotiana 
sylvestris]
Length=814

 Score =   285 bits (729),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 192/286 (67%), Gaps = 3/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDG  D N+D IV FPD +P   +   +  N+  + +   +  R 
Sbjct  523  MQDAWNILYHTIYNCTDGAYDKNRDVIVSFPDVEPKSISTLQIALNNIHEQYGKRYLGRA  582

Query  701  FFLLETSS-SLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              +LE ++ S  +PHLWYS  DV+ ALKLFL +G +L+ S TYRYDL+DLTRQ+L+K AN
Sbjct  583  --ILEVANDSYDKPHLWYSNSDVIHALKLFLESGNQLSDSSTYRYDLIDLTRQALAKYAN  640

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            +++LD I A+   D  A+S  SQKFL L+KD+D+LL   DG LLG W+E AK L ++ ++
Sbjct  641  ELFLDVIEAYKLDDLYAVSHLSQKFLGLVKDMDMLLGCHDGFLLGPWIERAKKLAQDEDQ  700

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             +Q+EWNARTQ+TMWFD ++   S L DY NK+WSGLL  YY PRA++YF  L  SL E 
Sbjct  701  ERQFEWNARTQITMWFDNSEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKFLIESLEEG  760

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              F +  WR+EWI  +  WQ     +PVK+ GDAL ++  L++KY 
Sbjct  761  NGFNLRGWRREWIKLTNNWQNSRNGFPVKSTGDALNVSQWLFEKYL  806



>ref|XP_009799792.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Nicotiana 
sylvestris]
Length=822

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 192/286 (67%), Gaps = 3/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDG  D N+D IV FPD +P   +   +  N+  + +   +  R 
Sbjct  531  MQDAWNILYHTIYNCTDGAYDKNRDVIVSFPDVEPKSISTLQIALNNIHEQYGKRYLGRA  590

Query  701  FFLLETSS-SLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              +LE ++ S  +PHLWYS  DV+ ALKLFL +G +L+ S TYRYDL+DLTRQ+L+K AN
Sbjct  591  --ILEVANDSYDKPHLWYSNSDVIHALKLFLESGNQLSDSSTYRYDLIDLTRQALAKYAN  648

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            +++LD I A+   D  A+S  SQKFL L+KD+D+LL   DG LLG W+E AK L ++ ++
Sbjct  649  ELFLDVIEAYKLDDLYAVSHLSQKFLGLVKDMDMLLGCHDGFLLGPWIERAKKLAQDEDQ  708

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             +Q+EWNARTQ+TMWFD ++   S L DY NK+WSGLL  YY PRA++YF  L  SL E 
Sbjct  709  ERQFEWNARTQITMWFDNSEEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKFLIESLEEG  768

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              F +  WR+EWI  +  WQ     +PVK+ GDAL ++  L++KY 
Sbjct  769  NGFNLRGWRREWIKLTNNWQNSRNGFPVKSTGDALNVSQWLFEKYL  814



>ref|XP_008453133.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis melo]
Length=808

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 188/291 (65%), Gaps = 19/291 (7%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW++LYHT+YNCTDG  D N+D IV FPD DPS                VL     +
Sbjct  523  IQDAWDVLYHTIYNCTDGANDKNRDVIVAFPDVDPS-------------SILVLPEGSDQ  569

Query  701  FFLLETS------SSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSL  540
              +L++S      ++  +PHLWY T  V+ ALKLF+  G +L+GS TYRYDLVDLTRQ+L
Sbjct  570  HGILDSSMDGLQDATFDRPHLWYPTSKVISALKLFIVGGDQLSGSNTYRYDLVDLTRQAL  629

Query  539  SKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLT  360
            +K +N+++  ++ A+   DA+ ++  SQ+FL+L+ DID LLA  +G LLG WL+SAK L 
Sbjct  630  AKYSNELFFRTVKAYQLYDAQTMASLSQEFLELVNDIDTLLACHEGFLLGPWLQSAKQLA  689

Query  359  ENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSR  180
            ++  E KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF  L  
Sbjct  690  QSEEEEKQYEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLGDYYGPRAAIYFKFLKE  749

Query  179  SLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            S      F +  WR+EWI  +  WQ   ++YPV++ GDAL  ++ LY KY 
Sbjct  750  SSENGYRFPLSNWRREWIKLTNDWQSSRKIYPVESNGDALHTSHWLYNKYL  800



>gb|KFK25596.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=363

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 163/213 (77%), Gaps = 7/213 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLT----H  714
            +EAAWEILYHTVY+CTDGIADHN D+IV+ PDWDPS        E+  T +++++     
Sbjct  152  IEAAWEILYHTVYSCTDGIADHNTDFIVKLPDWDPSSYV---QDESKQTDSYMISTDPYE  208

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
             +RRF   + SS  P+ HLWYST++V+KAL+LFL AG +L GSLTYRYD+VDLTRQ LSK
Sbjct  209  TKRRFLFQDKSSVFPKAHLWYSTKEVIKALQLFLEAGDDLFGSLTYRYDMVDLTRQVLSK  268

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
            LANQVY++++ A+  KD  +L   S KFL+LIKDIDVLLA+DD  LLGTWL+SAK L  N
Sbjct  269  LANQVYIEAVTAYVKKDISSLRRLSGKFLELIKDIDVLLASDDNFLLGTWLDSAKKLARN  328

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYA  255
            S+E KQYEWNARTQVTMW+D+    QSKLHDY 
Sbjct  329  SDERKQYEWNARTQVTMWYDSKDVNQSKLHDYG  361



>gb|KCW66077.1| hypothetical protein EUGRSUZ_G03358 [Eucalyptus grandis]
Length=696

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 156/209 (75%), Gaps = 0/209 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAWEILYHT+YNCTDGIADHN D+IV+FPDWDPS  + S   + +           RR
Sbjct  457  VEAAWEILYHTIYNCTDGIADHNTDFIVKFPDWDPSTISASSFGKQEKMLLPFHLSPGRR  516

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F    T S  PQ HLWYST  V+ AL+LFL AG  L  SL +RYDLVDLTRQ LSKLAN+
Sbjct  517  FLSQATGSDFPQAHLWYSTRFVVDALELFLQAGNHLKESLPFRYDLVDLTRQVLSKLANK  576

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY+D++ AF  KDAKAL +HSQKFLQLIKDID+LLA DD  LLGTWLESAK+L    +E 
Sbjct  577  VYVDAMTAFQQKDAKALHLHSQKFLQLIKDIDLLLACDDNFLLGTWLESAKALAATPSEM  636

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYA  255
            +QYEWNARTQVTMW+DT +  QSKLHDY 
Sbjct  637  RQYEWNARTQVTMWYDTNRTAQSKLHDYG  665



>ref|XP_006581937.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Glycine 
max]
Length=813

 Score =   280 bits (717),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 187/286 (65%), Gaps = 6/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS  +      + + K +  T     
Sbjct  521  IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLISVQHEQSHHNDKPYSGT-----  575

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E + S  +PHLWY T +V+ AL+LF+ +G EL+   TYRYDLVDLTRQ L+K AN+
Sbjct  576  -IIKEITDSFDRPHLWYPTSEVIYALELFITSGDELSRCNTYRYDLVDLTRQVLAKYANE  634

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I A+ + D   +++ SQ+FL L++D+D LLA  DG LLG WLESAK L  N  + 
Sbjct  635  LFFKVIEAYQSHDIHGMTLLSQRFLDLVEDLDTLLACHDGFLLGPWLESAKQLALNEEQE  694

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+W+GLL  YY PRA++YF +L  SL    
Sbjct  695  RQFEWNARTQITMWFDNSDEEASLLRDYGNKYWNGLLHDYYGPRAAIYFKYLRESLESGE  754

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+  WR+EWI  + +WQ+   ++PV++ GDAL  +  L+ KY +
Sbjct  755  DFKLRGWRREWIKLTNEWQKRRNIFPVESSGDALNTSRWLFNKYLN  800



>ref|XP_006581936.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Glycine 
max]
Length=814

 Score =   280 bits (717),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 187/286 (65%), Gaps = 6/286 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS  +      + + K +  T     
Sbjct  522  IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLISVQHEQSHHNDKPYSGT-----  576

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              + E + S  +PHLWY T +V+ AL+LF+ +G EL+   TYRYDLVDLTRQ L+K AN+
Sbjct  577  -IIKEITDSFDRPHLWYPTSEVIYALELFITSGDELSRCNTYRYDLVDLTRQVLAKYANE  635

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I A+ + D   +++ SQ+FL L++D+D LLA  DG LLG WLESAK L  N  + 
Sbjct  636  LFFKVIEAYQSHDIHGMTLLSQRFLDLVEDLDTLLACHDGFLLGPWLESAKQLALNEEQE  695

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            +Q+EWNARTQ+TMWFD +    S L DY NK+W+GLL  YY PRA++YF +L  SL    
Sbjct  696  RQFEWNARTQITMWFDNSDEEASLLRDYGNKYWNGLLHDYYGPRAAIYFKYLRESLESGE  755

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +FK+  WR+EWI  + +WQ+   ++PV++ GDAL  +  L+ KY +
Sbjct  756  DFKLRGWRREWIKLTNEWQKRRNIFPVESSGDALNTSRWLFNKYLN  801



>ref|XP_004138287.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus]
Length=808

 Score =   280 bits (715),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 138/289 (48%), Positives = 184/289 (64%), Gaps = 15/289 (5%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSD----PTGSDMPENDHTKAFVLTH  714
            ++ AW++LYHTVYNCTDG  D N+D IV FPD DPS     P GS+   N  +    L  
Sbjct  523  IQDAWDVLYHTVYNCTDGANDKNRDVIVAFPDVDPSAILVLPEGSNRHGNLDSSVDRLQ-  581

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
                       ++  +PHLWY T +V+ ALKLF+A G +L+ S TYRYDLVDLTRQ+L+K
Sbjct  582  ----------DATFDRPHLWYPTSEVISALKLFIAGGDQLSSSNTYRYDLVDLTRQALAK  631

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
             +N+++   + A+   D + ++  SQ+FL+L+ DID LLA  +G LLG WL+SAK L  +
Sbjct  632  YSNELFFRIVKAYQLHDVQTMASLSQEFLELVNDIDTLLACHEGFLLGPWLQSAKQLARS  691

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
              E KQYEWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++Y   L  S 
Sbjct  692  EEEEKQYEWNARTQITMWFDNTEEEASLLRDYGNKYWSGLLGDYYCPRAAIYLKFLKESS  751

Query  173  NENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
                 F +  WR+EWI  +  WQ   ++YPV++ GDAL  ++ LY KY 
Sbjct  752  ENGYRFPLSNWRREWIKLTNDWQSSRKIYPVESNGDALDTSHWLYNKYL  800



>emb|CDP16996.1| unnamed protein product [Coffea canephora]
Length=842

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 192/289 (66%), Gaps = 9/289 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILY T+YNCTDG  D N+D IV FPD    DP    +P+   ++ +     R R
Sbjct  551  LQDAWTILYGTLYNCTDGSQDKNRDVIVAFPD---VDPYSIAIPQVTISRRY--QDNRIR  605

Query  701  FFLL----ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
            F       E + S  +PHLWYST +V++ALKLFL++G E+  +  YRYDL+DLTRQ+L+K
Sbjct  606  FLSRTVREELTDSFSKPHLWYSTSEVIEALKLFLSSGDEVPETSIYRYDLIDLTRQALAK  665

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
             ANQ++L  I ++   D  A++  SQ+FL L++D+D+LL   DG LLG WLESAK L ++
Sbjct  666  YANQLFLKVIESYQLADLPAVAHFSQEFLGLVEDMDILLGCHDGFLLGPWLESAKRLAQD  725

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
              + +Q+EWNARTQ+TMWFD T+   S L DY NK+WSGLL  YY PRA++YF  L  SL
Sbjct  726  EEQERQFEWNARTQITMWFDNTQEEASLLRDYGNKYWSGLLRDYYGPRAAIYFKFLIESL  785

Query  173  NENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +   F+++ WR+EWI  +  WQ    ++PVK+ G+AL ++  LY+KY 
Sbjct  786  EKGDGFRLQHWRREWIKLTNDWQSSRNIFPVKSTGNALNVSRWLYKKYL  834



>ref|XP_006653830.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oryza brachyantha]
Length=833

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 185/286 (65%), Gaps = 3/286 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW+ILYHT+YNCTDG  D N+D IV FPD +P       +     T    LT     
Sbjct  530  LQDAWQILYHTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL--YISTSQTYLTKSSMN  587

Query  701  FFLLETSSS-LPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +  L+ S++   QPHLWY T  V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K AN
Sbjct  588  YIALDPSNNEYEQPHLWYDTNAVIRALELFLRYGDEVSDSSTFRYDLVDLTRQTLAKYAN  647

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            QV++  I ++ + +A  +S   Q F+ L+ D+D LL + +G LLG WLESAK L  +  +
Sbjct  648  QVFVRIIESYKSNNANHVSTLCQHFMDLVNDLDTLLTSHEGFLLGPWLESAKGLARDKEQ  707

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
              QYEWNARTQ+TMWFD T    S L DYANK+WSGLL  YY PRA++YF +L  S+   
Sbjct  708  QIQYEWNARTQITMWFDNTNTKASLLRDYANKYWSGLLRDYYGPRAAIYFKYLILSMERK  767

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              F +EEWRKEWI+ +  WQ   +++P  A GDAL I+  LY KY 
Sbjct  768  EPFALEEWRKEWISLTNNWQSDRKIFPTTATGDALNISRTLYTKYL  813



>ref|XP_010240531.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Brachypodium 
distachyon]
Length=639

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 185/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+ T+YNCTDG  D N+D IV FPD +P       +     +K F     +  
Sbjct  335  LQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL-HTSASKMFSTMSAKSY  393

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                E++ +  QPHLWY T  V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  394  LVKDESNDAYEQPHLWYDTNVVIRALQLFLQYGDEVSDSSTFRYDLVDLTRQALAKYANQ  453

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I ++ + +   ++  S+ FL L+ D+D+LLA+ +G LLG WLESAK L  +  + 
Sbjct  454  IFAKIIQSYKSNNMNQVTTLSECFLDLVNDLDMLLASHEGFLLGPWLESAKGLARDQEQE  513

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL  YY PRA++YF +L  SL +  
Sbjct  514  IQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLGDYYGPRAAIYFKYLILSLEKKE  573

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +EEWR+EWI+ +  WQ   +++   A GDAL IA +LY KY 
Sbjct  574  PFALEEWRREWISLTNNWQSDRKVFATAATGDALNIARSLYMKYL  618



>ref|XP_010453461.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Camelina 
sativa]
Length=742

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            +EAAW+ILYHTVYNCTDGIADHN D+IV+ PDWDPS        + D          +RR
Sbjct  520  IEAAWDILYHTVYNCTDGIADHNTDFIVKLPDWDPSSSIQDKWKQTDSISTGSY-ETKRR  578

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   + SS LP+ HLWYST++V+KALKLFL AG +L+ SLTYRYD+VDLTRQ LSKLANQ
Sbjct  579  FLFQDKSSGLPKAHLWYSTKEVIKALKLFLEAGDDLSRSLTYRYDMVDLTRQVLSKLANQ  638

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY++++ AF  +D  +L   S+K+L++IKD+DVLLA+DD  LLGTWLESAK L  N++E 
Sbjct  639  VYIEAVTAFVKQDVGSLRRLSEKYLEIIKDMDVLLASDDNFLLGTWLESAKKLARNNDER  698

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANK  249
            KQYEWNARTQVTMW+D+    QSKLHDY N+
Sbjct  699  KQYEWNARTQVTMWYDSKDLNQSKLHDYENR  729



>ref|XP_008667109.1| PREDICTED: uncharacterized protein LOC100192858 isoform X1 [Zea 
mays]
 tpg|DAA35663.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=831

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/287 (48%), Positives = 185/287 (64%), Gaps = 3/287 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILY T+YNCTDG  D N+D IV FPD +P       +  N  T+    T   + 
Sbjct  527  LQDAWWILYRTLYNCTDGKNDKNRDVIVAFPDVEPFVIATPGLHVN--TRQMYSTVPSKN  584

Query  701  FFLLETSS-SLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +   + SS +   PHLWY T  V+ AL+LFL  G E++ S T+RYDLVDLTRQ L+K AN
Sbjct  585  YIRKDVSSDAYEHPHLWYDTNAVIHALELFLQHGDEVSDSNTFRYDLVDLTRQVLAKYAN  644

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             V+L  I ++ + +   +++  Q FL L+ D+D LL++ +G LLG WLESAK L  NS +
Sbjct  645  DVFLKIIESYKSNNMNQVTILCQHFLSLVNDLDTLLSSHEGFLLGPWLESAKGLARNSEQ  704

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
              QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL+ YY PRA++YF HL  S+  N
Sbjct  705  EIQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLQDYYGPRAAIYFKHLLLSMENN  764

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
              F ++EWR+EWI+ +  WQ   +++   A GD L I+ +LY KY S
Sbjct  765  APFALKEWRREWISLTNNWQSDRKVFSTTATGDPLNISQSLYTKYLS  811



>dbj|BAD94027.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
Length=182

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = -1

Query  566  LVDLTRQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGT  387
            +VDLTRQ LSKLANQVY +++ AF  KD  +L   S+KFL+LIKD+DVLLA+DD CLLGT
Sbjct  1    MVDLTRQVLSKLANQVYTEAVTAFVKKDIGSLGQLSEKFLELIKDMDVLLASDDNCLLGT  60

Query  386  WLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRA  207
            WLESAK L +N +E KQYEWNARTQVTMW+D+    QSKLHDYANKFWSGLLE YYLPRA
Sbjct  61   WLESAKKLAKNGDERKQYEWNARTQVTMWYDSNDVNQSKLHDYANKFWSGLLEDYYLPRA  120

Query  206  SMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQR-GSELYPVKAQGDALAIANALYQKY  30
             +YFN + +SL +   FKVE+WR+EWI  S KWQ+  SE+YPVKA+GDALAI+  L  KY
Sbjct  121  RLYFNEMLKSLRDKKIFKVEKWRREWIMMSHKWQQSSSEVYPVKAKGDALAISRHLLSKY  180

Query  29   F  27
            F
Sbjct  181  F  181



>gb|KFK25594.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=733

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 163/213 (77%), Gaps = 7/213 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLT----H  714
            +EAAWEILYHTVY+CTDGIADHN D+IV+ PDWDPS        E+  T +++++     
Sbjct  522  IEAAWEILYHTVYSCTDGIADHNTDFIVKLPDWDPSSYV---QDESKQTDSYMISTDPYE  578

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
             +RRF   + SS  P+ HLWYST++V+KAL+LFL AG +L GSLTYRYD+VDLTRQ LSK
Sbjct  579  TKRRFLFQDKSSVFPKAHLWYSTKEVIKALQLFLEAGDDLFGSLTYRYDMVDLTRQVLSK  638

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
            LANQVY++++ A+  KD  +L   S KFL+LIKDIDVLLA+DD  LLGTWL+SAK L  N
Sbjct  639  LANQVYIEAVTAYVKKDISSLRRLSGKFLELIKDIDVLLASDDNFLLGTWLDSAKKLARN  698

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYA  255
            S+E KQYEWNARTQVTMW+D+    QSKLHDY 
Sbjct  699  SDERKQYEWNARTQVTMWYDSKDVNQSKLHDYG  731



>ref|XP_003580702.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Brachypodium 
distachyon]
Length=829

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 185/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+ T+YNCTDG  D N+D IV FPD +P       +     +K F     +  
Sbjct  525  LQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL-HTSASKMFSTMSAKSY  583

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                E++ +  QPHLWY T  V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  584  LVKDESNDAYEQPHLWYDTNVVIRALQLFLQYGDEVSDSSTFRYDLVDLTRQALAKYANQ  643

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++   I ++ + +   ++  S+ FL L+ D+D+LLA+ +G LLG WLESAK L  +  + 
Sbjct  644  IFAKIIQSYKSNNMNQVTTLSECFLDLVNDLDMLLASHEGFLLGPWLESAKGLARDQEQE  703

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL  YY PRA++YF +L  SL +  
Sbjct  704  IQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLGDYYGPRAAIYFKYLILSLEKKE  763

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +EEWR+EWI+ +  WQ   +++   A GDAL IA +LY KY 
Sbjct  764  PFALEEWRREWISLTNNWQSDRKVFATAATGDALNIARSLYMKYL  808



>ref|XP_001782392.1| predicted protein [Physcomitrella patens]
 gb|EDQ52786.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/287 (49%), Positives = 177/287 (62%), Gaps = 28/287 (10%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
            AW++L+ ++YNC+DGIADHN D IVEFPD DP                      +R  F 
Sbjct  522  AWKMLHESIYNCSDGIADHNGDVIVEFPDIDP----------------------KRSLFQ  559

Query  692  LETSSSLPQP------HLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKL  531
            +    SL Q       H+WYS +D   AL+  L++   L  S  YRYD+VDLTRQ LSKL
Sbjct  560  IRPRQSLGQQILGHPQHIWYSPQDAAVALQYLLSSADALGLSKPYRYDVVDLTRQVLSKL  619

Query  530  ANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS  351
            ANQ++   +  F   + + +   S + L+L+ D+D LL A +  LLGTWLESAK L  + 
Sbjct  620  ANQLHSQVLDQFRMFNVEKMDNISSRLLELLSDMDDLLGASEEFLLGTWLESAKDLATSD  679

Query  350  NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLN  171
             E K YEWNARTQ+TMWFD T    S LHDYANK WSGL   YYLPRAS+Y  +L +SL+
Sbjct  680  EERKLYEWNARTQITMWFDNTLDKPSPLHDYANKMWSGLTRDYYLPRASIYIKYLKQSLH  739

Query  170  ENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            EN  F  +EWR+EWIA + +WQ  S LYP  A+GDAL IA  LY+KY
Sbjct  740  ENTSFAFQEWRREWIALTNEWQVASNLYPTVAKGDALEIATTLYEKY  786



>gb|EEC78143.1| hypothetical protein OsI_17702 [Oryza sativa Indica Group]
Length=829

 Score =   270 bits (691),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/285 (47%), Positives = 185/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW+ILY T+YNCTDG  D N+D IV FPD +P       +     +K +     +  
Sbjct  524  LQDAWKILYQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL-YTSSSKTYSTKLSKNY  582

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              +  ++     PHLWY T+ V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  583  IAVDASNDEYEHPHLWYDTDAVIRALELFLRYGDEVSDSNTFRYDLVDLTRQTLAKYANQ  642

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            V++  I ++ + +   +S   Q F+ L+ D+D LLA+ +G LLG WLESAK L  +  + 
Sbjct  643  VFVKIIESYKSNNVNQVSNLCQHFIDLVNDLDTLLASHEGFLLGPWLESAKGLARDKEQE  702

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQ+TMWFD TK   S L DYANK+WSGLL  YY PRA++YF +L  S+ +  
Sbjct  703  MQYEWNARTQITMWFDNTKTKASLLRDYANKYWSGLLRDYYGPRAAIYFKYLILSMEKKE  762

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +EEWR+EWI+ +  WQ   +++P  A GDAL I+  LY+KY 
Sbjct  763  PFALEEWRREWISLTNNWQSDWKVFPTTATGDALNISRTLYKKYL  807



>dbj|BAK03902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=829

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/285 (47%), Positives = 184/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+ T+YNCTDG  D N+D IV FPD +PS      +     +K +        
Sbjct  526  LQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPSVIQTPGLYART-SKNYSTMLSENY  584

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                  + +  QPH+WY T  V+ AL+LFL +G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  585  VMKDAPNDAYEQPHIWYDTIAVIHALELFLESGDEVSDSSTFRYDLVDLTRQALAKYANQ  644

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  + + +   ++   ++FL L+KD+D+LLA+ +G LLG WLESAK L  +  + 
Sbjct  645  IFLKIIQGYKSNNVNQVTTLCERFLNLVKDLDMLLASHEGFLLGPWLESAKGLARSQEQE  704

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL  YY PRA++YF HL  SL +  
Sbjct  705  IQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLRDYYGPRAAIYFKHLISSLKKKE  764

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +EEWR+EWI+ +  WQ   +++   A GDAL I+ AL+ KY 
Sbjct  765  PFALEEWRREWISLTNNWQSDRKVFATTATGDALNISRALFTKYL  809



>dbj|BAK07078.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=829

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/285 (47%), Positives = 184/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+ T+YNCTDG  D N+D IV FPD +PS      +     +K +        
Sbjct  526  LQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPSVIQTPGLYART-SKNYSTMLSENY  584

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                  + +  QPH+WY T  V+ AL+LFL +G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  585  VMKDAPNDAYEQPHIWYDTIAVIHALELFLESGDEVSDSSTFRYDLVDLTRQALAKYANQ  644

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  + + +   ++   ++FL L+KD+D+LLA+ +G LLG WLESAK L  +  + 
Sbjct  645  IFLKIIQGYKSNNVNQVTTLCERFLNLVKDLDMLLASHEGFLLGPWLESAKGLARSQEQE  704

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL  YY PRA++YF HL  SL +  
Sbjct  705  IQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLRDYYGPRAAIYFKHLISSLKKKE  764

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +EEWR+EWI+ +  WQ   +++   A GDAL I+ AL+ KY 
Sbjct  765  PFALEEWRREWISLTNNWQSDRKVFATTATGDALNISRALFTKYL  809



>tpg|DAA35665.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=1202

 Score =   273 bits (699),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/287 (48%), Positives = 185/287 (64%), Gaps = 3/287 (1%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILY T+YNCTDG  D N+D IV FPD +P       +  N  T+    T   + 
Sbjct  435  LQDAWWILYRTLYNCTDGKNDKNRDVIVAFPDVEPFVIATPGLHVN--TRQMYSTVPSKN  492

Query  701  FFLLETSS-SLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +   + SS +   PHLWY T  V+ AL+LFL  G E++ S T+RYDLVDLTRQ L+K AN
Sbjct  493  YIRKDVSSDAYEHPHLWYDTNAVIHALELFLQHGDEVSDSNTFRYDLVDLTRQVLAKYAN  552

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             V+L  I ++ + +   +++  Q FL L+ D+D LL++ +G LLG WLESAK L  NS +
Sbjct  553  DVFLKIIESYKSNNMNQVTILCQHFLSLVNDLDTLLSSHEGFLLGPWLESAKGLARNSEQ  612

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
              QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL+ YY PRA++YF HL  S+  N
Sbjct  613  EIQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLQDYYGPRAAIYFKHLLLSMENN  672

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
              F ++EWR+EWI+ +  WQ   +++   A GD L I+ +LY KY S
Sbjct  673  APFALKEWRREWISLTNNWQSDRKVFSTTATGDPLNISQSLYTKYLS  719



>emb|CAE04506.2| OSJNBb0059K02.16 [Oryza sativa Japonica Group]
Length=829

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/285 (47%), Positives = 185/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW+ILY T+YNCTDG  D N+D IV FPD +P       +     +K +     +  
Sbjct  524  LQDAWKILYQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL-YTSSSKTYSTKLSKNY  582

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              +  ++     PHLWY T+ V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  583  IAVDASNDEYEHPHLWYDTDAVIRALELFLRYGDEVSDSNTFRYDLVDLTRQTLAKYANQ  642

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            V++  I ++ + +   +S   Q F+ L+ D+D LLA+ +G LLG WLESAK L  +  + 
Sbjct  643  VFVKIIESYKSNNVNQVSNLCQHFIDLVNDLDTLLASHEGFLLGPWLESAKGLARDKEQE  702

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
             QYEWNARTQ+TMWFD TK   S L DYANK+WSGLL  YY PRA++YF +L  S+ +  
Sbjct  703  MQYEWNARTQITMWFDNTKTKASLLRDYANKYWSGLLRDYYGPRAAIYFKYLILSMEKKE  762

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             F +EEWR+EWI+ +  WQ   +++P  A GDAL I+  LY+KY 
Sbjct  763  PFALEEWRREWISLTNNWQSDWKVFPTTATGDALNISRTLYKKYL  807



>gb|EEE61812.1| hypothetical protein OsJ_16433 [Oryza sativa Japonica Group]
Length=1129

 Score =   271 bits (692),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/285 (47%), Positives = 185/285 (65%), Gaps = 1/285 (0%)
 Frame = -1

Query  881   VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
             ++ AW+ILY T+YNCTDG  D N+D IV FPD +P       +     +K +     +  
Sbjct  824   LQDAWKILYQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL-YTSSSKTYSTKLSKNY  882

Query  701   FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               +  ++     PHLWY T+ V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  883   IAVDASNDEYEHPHLWYDTDAVIRALELFLRYGDEVSDSNTFRYDLVDLTRQTLAKYANQ  942

Query  521   VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             V++  I ++ + +   +S   Q F+ L+ D+D LLA+ +G LLG WLESAK L  +  + 
Sbjct  943   VFVKIIESYKSNNVNQVSNLCQHFIDLVNDLDTLLASHEGFLLGPWLESAKGLARDKEQE  1002

Query  341   KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
              QYEWNARTQ+TMWFD TK   S L DYANK+WSGLL  YY PRA++YF +L  S+ +  
Sbjct  1003  MQYEWNARTQITMWFDNTKTKASLLRDYANKYWSGLLRDYYGPRAAIYFKYLILSMEKKE  1062

Query  161   EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              F +EEWR+EWI+ +  WQ   +++P  A GDAL I+  LY+KY 
Sbjct  1063  PFALEEWRREWISLTNNWQSDWKVFPTTATGDALNISRTLYKKYL  1107



>ref|XP_004977055.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Setaria italica]
Length=830

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 181/296 (61%), Gaps = 24/296 (8%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDP-----------SDPTGSDMPENDHT  735
            ++ AW ILY T+YNCTDG  D N+D IV FPD +P           S    S +P  ++ 
Sbjct  528  LQDAWWILYQTLYNCTDGKNDKNRDVIVAFPDVEPFVIKTQGLYMSSGKQYSTIPPKNYE  587

Query  734  KAFVLTHQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDL  555
            K               ++ +   PHLWY+T  V+ AL+LFL  G E++ S T+RYDLVDL
Sbjct  588  KG-------------TSNDAYDHPHLWYNTSVVVHALELFLQYGDEVSDSNTFRYDLVDL  634

Query  554  TRQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLES  375
            TRQ L+K AN +++  I ++ +     +    Q FL L+ D+D LL + +G LLG WL++
Sbjct  635  TRQVLAKYANDIFIKIIKSYKSNSTNQMITLCQHFLGLVNDLDTLLGSHEGFLLGPWLQN  694

Query  374  AKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYF  195
            AK L ++  +  QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL  YY PRA++YF
Sbjct  695  AKGLAQDREQEIQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLRDYYGPRAAIYF  754

Query  194  NHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             HL  S+ +N  F +EEWR+EWI+ +  WQ   +++   A GDAL I+ +LY KY 
Sbjct  755  KHLLLSMEKNAPFSLEEWRREWISLTNNWQSDRKVFATTATGDALNISRSLYMKYL  810



>ref|XP_002977411.1| hypothetical protein SELMODRAFT_107285 [Selaginella moellendorffii]
 gb|EFJ21415.1| hypothetical protein SELMODRAFT_107285 [Selaginella moellendorffii]
Length=761

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 181/283 (64%), Gaps = 12/283 (4%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSD--MPENDHTKAFVLTHQRRRF  699
            AW+IL HT+YNC+DG+ DHN D IV+FPD + S  T     + E   T       Q RR 
Sbjct  483  AWQILSHTLYNCSDGLQDHNTDVIVKFPDLNASSLTTLSRYLAEEGGT-------QTRRL  535

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQV  519
             L E  +S    HLWY   +   AL   L A + L+   TYRYDLVDLTRQ L KLANQ+
Sbjct  536  -LTEGLTSFG--HLWYRPTEAKVALSYMLNASSSLSNVATYRYDLVDLTRQVLMKLANQI  592

Query  518  YLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETK  339
            +L ++ +F   D + L+ +    + +IKD ++LL +++G LLG WLESAK L  NS+ET 
Sbjct  593  HLQALVSFVKGDLEELTKNCDILIGIIKDSELLLRSNNGFLLGPWLESAKKLGTNSDETN  652

Query  338  QYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVE  159
             YEWNARTQVTMWFD T+ + S LHDYANK WSGL E YYLPRAS+Y   L ++L++   
Sbjct  653  LYEWNARTQVTMWFDNTRTLPSALHDYANKMWSGLFEDYYLPRASLYTKLLVKALHDKEP  712

Query  158  FKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            F  + WR  WI  +  +Q G++ YP++A GD++ IA +L+ KY
Sbjct  713  FPYDSWRSSWILLTNTFQNGTKNYPLEAAGDSIEIAKSLFSKY  755



>gb|KJB24983.1| hypothetical protein B456_004G170700 [Gossypium raimondii]
Length=745

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 153/203 (75%), Gaps = 6/203 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHTVYNCTDGIADHN D+IV+FPDWDPS   GS   + +    F L  + RR
Sbjct  535  IKEAWAILYHTVYNCTDGIADHNIDFIVKFPDWDPSINFGSRPSKLNSMHTFRLRTRSRR  594

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F   E SS LPQ HLWYST +V+ ALKLFLAAG +LAGSLTYRYDLVDLTRQ LSKLANQ
Sbjct  595  FSFQERSSDLPQAHLWYSTHEVVSALKLFLAAGNDLAGSLTYRYDLVDLTRQVLSKLANQ  654

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VYLD+I AF  KD KAL++HSQKF+QLIKDIDVLLA+DD  LLGTWLESAK L EN +E 
Sbjct  655  VYLDAINAFRRKDVKALNIHSQKFIQLIKDIDVLLASDDNFLLGTWLESAKLLAENPSEM  714

Query  341  KQ------YEWNARTQVTMWFDT  291
            +Q      ++WNA   + +  D+
Sbjct  715  RQFKPLLDFDWNAAEVIFILCDS  737



>ref|XP_004502129.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cicer arietinum]
Length=808

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/294 (45%), Positives = 180/294 (61%), Gaps = 39/294 (13%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++  W +LYHT+YNCTDG  D N+D IV FPD DPS               F L H+  R
Sbjct  530  IQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPS--------------LFSLQHEHSR  575

Query  701  FF--------LLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQ  546
             +        + E + S  QPHLWYST +V+ AL+LF+++G EL+ S TYRYDLVD+TRQ
Sbjct  576  LYGKPYSRAIIKEVTDSFDQPHLWYSTSEVIHALELFISSGDELSKSSTYRYDLVDVTRQ  635

Query  545  SLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKS  366
             L+K ANQ++   I A+ + D   +++ SQ+FL L++D+D LLA  DG LLG WLESAK 
Sbjct  636  VLAKYANQLFFKVIEAYQSHDVHGVTLLSQRFLDLVEDLDALLACHDGFLLGPWLESAKQ  695

Query  365  LTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHL  186
              +N  + +Q+EWNARTQ+TMWFD T    S LHDY NK+WSGLL  YY PRA++YF +L
Sbjct  696  QAQNEEQKRQFEWNARTQITMWFDNTDEEASLLHDYGNKYWSGLLHDYYGPRAAIYFKYL  755

Query  185  SRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
               L +  +F     R+              ++PV ++GDAL  +  L+ KY +
Sbjct  756  IEKLEKGEDFN----RR-------------NIFPVVSRGDALNTSRWLFNKYLN  792



>gb|EMS67905.1| hypothetical protein TRIUR3_00413 [Triticum urartu]
Length=732

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 183/311 (59%), Gaps = 27/311 (9%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+ T+YNCTDG  D N+D IV FPD +P       +     +K +        
Sbjct  403  LQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGLCTRT-SKNYSTMSSENS  461

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                 ++ +  QPH+WY T  V+ AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  462  VVRDASNDAYDQPHIWYDTIAVIHALELFLEYGDEVSDSNTFRYDLVDLTRQALAKYANQ  521

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  + + +   ++   ++FL +++D+DVLLA+ +G LLG WLESAK L  +  + 
Sbjct  522  IFLKIIQGYKSNNINQVTTLCERFLNIVEDLDVLLASHEGFLLGPWLESAKGLARDHEQE  581

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDY--------------------------ANKFWS  240
             QYEWNARTQ+TMWFD T+   S L DY                          ANK+WS
Sbjct  582  IQYEWNARTQITMWFDNTETKASLLRDYGKTHSTTAFRPLLRVPPCSFLTSSGAANKYWS  641

Query  239  GLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDAL  60
            GLL  YY PRA++YF HL  SL +N  F +EEWR+EWI+ +  WQ   +++   A GD L
Sbjct  642  GLLRDYYGPRAAIYFKHLISSLKKNEPFALEEWRREWISLTNNWQSDMKVFTTTATGDTL  701

Query  59   AIANALYQKYF  27
             I+ ALY KY 
Sbjct  702  NISRALYIKYL  712



>ref|XP_002974994.1| hypothetical protein SELMODRAFT_102402 [Selaginella moellendorffii]
 gb|EFJ23779.1| hypothetical protein SELMODRAFT_102402 [Selaginella moellendorffii]
Length=761

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 179/283 (63%), Gaps = 12/283 (4%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSD--MPENDHTKAFVLTHQRRRF  699
            AW+IL HT+YNC+DG+ DHN D IV+FPD + S  T     + E   T       Q RR 
Sbjct  483  AWQILSHTLYNCSDGLQDHNTDVIVKFPDLNASSLTTLSRYLAEEAGT-------QTRRL  535

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQV  519
             L E  +S    HLWY   +   AL   L A + L+   TYRYDLVDLTRQ L KLANQ+
Sbjct  536  -LTEGLTSFG--HLWYRPTEAKVALSYMLNASSSLSNVATYRYDLVDLTRQVLMKLANQI  592

Query  518  YLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETK  339
            +L ++ +F   D + L+ +    + +IKD ++LL +++G LLG WLESAK L  NS+E  
Sbjct  593  HLQALVSFVKGDLEELTKNCDILIGIIKDSELLLRSNNGFLLGPWLESAKKLGTNSDEKH  652

Query  338  QYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVE  159
             YEWNARTQVTMWFD T+ + S LHDYANK WSGL E YYLPRAS+Y   L ++L++   
Sbjct  653  LYEWNARTQVTMWFDNTRSLPSALHDYANKMWSGLFEDYYLPRASLYTKLLVKALHDKEP  712

Query  158  FKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            F    WR  WI  +  +Q G++ YP++A GD++ IA +L+ KY
Sbjct  713  FPYGSWRSSWILLTNTFQNGTKNYPLEAAGDSIEIAKSLFSKY  755



>gb|EMS50400.1| hypothetical protein TRIUR3_11279 [Triticum urartu]
Length=717

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 162/223 (73%), Gaps = 19/223 (9%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDGIADHNKDYIVEFPD             + ++K  +++H R+ 
Sbjct  499  IQKAWAILYHTIYNCTDGIADHNKDYIVEFPD------ISPSSFSSQYSKRKIISHVRKH  552

Query  701  -FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYR------------YDLV  561
              FL E S+SLPQPHLWYSTE+ +K+L+LFL AG  L+ SLTYR            YDLV
Sbjct  553  PRFLGEVSASLPQPHLWYSTEEAVKSLELFLKAGNGLSESLTYRAQVKSVVLVKKKYDLV  612

Query  560  DLTRQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWL  381
            DLTRQSLSKLAN+VYLD++ ++  +D+  L+ H++KFL+LI DI+ LLA+DD  LLG WL
Sbjct  613  DLTRQSLSKLANKVYLDAMDSYQKRDSSGLNFHTKKFLELIMDIETLLASDDNFLLGPWL  672

Query  380  ESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYAN  252
            E+AKSL    +E KQYEWNARTQVTMW+D TK  QSKLHDY N
Sbjct  673  ETAKSLAMTEDERKQYEWNARTQVTMWYDDTKTEQSKLHDYGN  715



>gb|EMT10385.1| hypothetical protein F775_10757 [Aegilops tauschii]
Length=768

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 182/318 (57%), Gaps = 41/318 (13%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+ T+YNCTDG  D N+D IV FPD +P       +        +  T +   
Sbjct  439  LQDAWRILHQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL--------YARTSKNYS  490

Query  701  FFLLE-------TSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQS  543
               LE       ++ +  QPH+WY T  V+ AL+LFL  G E++ S T+RYDLVDLTRQ+
Sbjct  491  TLALENYVVKDASNDAYEQPHIWYDTVAVIHALELFLEYGDEVSDSSTFRYDLVDLTRQA  550

Query  542  LSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSL  363
            L+K ANQ++L  I  + + +   ++    +FL L+ D+D+LLA+ +G LLG WLESAK L
Sbjct  551  LAKYANQIFLKIIQGYKSNNINQVTTLCDRFLNLVNDLDMLLASHEGFLLGPWLESAKGL  610

Query  362  TENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDY-------------------------  258
              +  +  QYEWNARTQ+TMWFD T    S L DY                         
Sbjct  611  ARDHEQEIQYEWNARTQITMWFDNTNTKASLLRDYGKTHRTTPFCPLLRVPPFSFLKSSG  670

Query  257  -ANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPV  81
             ANK+WSGLL  YY PRA++YF HL  SL +N  F +EEWR+EWI+ +  WQ   +++  
Sbjct  671  AANKYWSGLLRDYYRPRAAIYFKHLISSLKKNEPFALEEWRREWISLTNNWQSDRKVFAT  730

Query  80   KAQGDALAIANALYQKYF  27
             A GDAL I+  LY KY 
Sbjct  731  TATGDALNISRTLYIKYL  748



>ref|XP_008356770.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Malus domestica]
Length=312

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            VEAAW+IL+ T+YNCTDGIADHN D+IV+ PDWDPS    S++ + +  ++F+   ++RR
Sbjct  112  VEAAWDILHQTIYNCTDGIADHNTDFIVKLPDWDPSPNHISNISKQNQMQSFIPLDKKRR  171

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L +TSS+LPQ HLWYST++V+ AL+LFL  G E +GSLTYRYDLVDLTRQ LSKLANQ
Sbjct  172  VLLQKTSSNLPQAHLWYSTQEVVNALRLFLDTGNEFSGSLTYRYDLVDLTRQVLSKLANQ  231

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAK  369
            VYLD++ A+  +D KA S HSQKF+QLI DID LLA+DD  LLGTWLESAK
Sbjct  232  VYLDAVTAYRRRDVKAYSHHSQKFVQLIMDIDELLASDDNFLLGTWLESAK  282



>gb|KGN63614.1| hypothetical protein Csa_1G005750 [Cucumis sativus]
Length=318

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 151/249 (61%), Gaps = 18/249 (7%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSD----PTGSDMPENDHTKAFVLTH  714
            ++ AW++LYHTVYNCTDG  D N+D IV FPD DPS     P GS+   N  +    L  
Sbjct  84   IQDAWDVLYHTVYNCTDGANDKNRDVIVAFPDVDPSAILVLPEGSNRHGNLDSSVDRLQ-  142

Query  713  QRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
                       ++  +PHLWY T +V+ ALKLF+A G +L+ S TYRYDLVDLTRQ+L+K
Sbjct  143  ----------DATFDRPHLWYPTSEVISALKLFIAGGDQLSSSNTYRYDLVDLTRQALAK  192

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
             +N+++   + A+   D + ++  SQ+FL+L+ DID LLA  +G LLG WL+SAK L  +
Sbjct  193  YSNELFFRIVKAYQLHDVQTMASLSQEFLELVNDIDTLLACHEGFLLGPWLQSAKQLARS  252

Query  353  SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSL  174
              E KQYEWNARTQ+TMWFD T+   S L DY  ++  G L    L  +      L R  
Sbjct  253  EEEEKQYEWNARTQITMWFDNTEEEASLLRDYVLEWTLGRL---LLSSSCNILEVLERKF  309

Query  173  NENVEFKVE  147
             E ++  +E
Sbjct  310  GEWIQISIE  318



>ref|XP_006439737.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52977.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=733

 Score =   216 bits (551),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 145/209 (69%), Gaps = 5/209 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        ++
Sbjct  527  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKK  581

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  582  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  641

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ + A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  642  LFLNILEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  701

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYA  255
            KQYEWNARTQ+TMWFD T+   S L DY 
Sbjct  702  KQYEWNARTQITMWFDNTQEEASLLRDYG  730



>ref|XP_010456520.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Camelina 
sativa]
Length=146

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  449  LQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSK  270
            L++IKD+DVLLA+DD  LLGTWLESAK L  N++E KQYEWNARTQVTMW+D+    QSK
Sbjct  4    LEIIKDMDVLLASDDNFLLGTWLESAKKLARNNDERKQYEWNARTQVTMWYDSKDLNQSK  63

Query  269  LHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQR-GSE  93
            LHDYANK+WSGLL+ YYLPRA++YFN + +SL +  +FKVE+WR+EWI  S KWQ+  SE
Sbjct  64   LHDYANKYWSGLLKDYYLPRATLYFNEMLKSLQDKKKFKVEKWRREWIMMSHKWQQSSSE  123

Query  92   LYPVKAQGDALAIANALYQKYF  27
            +YPVKA+GDALAI+  L  KYF
Sbjct  124  IYPVKAKGDALAISRHLLCKYF  145



>ref|XP_002448659.1| hypothetical protein SORBIDRAFT_06g030930 [Sorghum bicolor]
 gb|EES12987.1| hypothetical protein SORBIDRAFT_06g030930 [Sorghum bicolor]
Length=252

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 125/183 (68%), Gaps = 0/183 (0%)
 Frame = -1

Query  572  YDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLL  393
            YDLVDLTRQ L+K AN V+L  I ++ +     +++  + FL L+ D+D LL++ +G LL
Sbjct  51   YDLVDLTRQVLAKYANDVFLKIIESYKSNKMNQVTILCKHFLNLVNDLDTLLSSHEGFLL  110

Query  392  GTWLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLP  213
            G WLESAK L  NS +  QYEWNARTQ+TMWFD T+   S L DYANK+WSGLL  YY P
Sbjct  111  GPWLESAKGLARNSEQEIQYEWNARTQITMWFDNTETKASLLRDYANKYWSGLLRDYYGP  170

Query  212  RASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQK  33
            RA++YF HL  S+ +N  F +EEWR+EWI+ +  WQ   +++     GD+L I+ +LY K
Sbjct  171  RAAIYFKHLLLSMEKNAPFALEEWRREWISLTNNWQSDRKVFSTTPTGDSLNISWSLYIK  230

Query  32   YFS  24
            Y S
Sbjct  231  YLS  233



>emb|CAJ86183.1| H0212B02.15 [Oryza sativa Indica Group]
 emb|CAJ86322.1| OSIGBa0113E10.5 [Oryza sativa Indica Group]
Length=692

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 131/209 (63%), Gaps = 1/209 (0%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW+ILY T+YNCTDG  D N+D IV FPD +P       +     +K +     +  
Sbjct  477  LQDAWKILYQTLYNCTDGKNDKNRDVIVAFPDVEPFVIQTPGL-YTSSSKTYSTKLSKNY  535

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              +  ++     PHLWY T+ V++AL+LFL  G E++ S T+RYDLVDLTRQ+L+K ANQ
Sbjct  536  IAVDASNDEYEHPHLWYDTDAVIRALELFLRYGDEVSDSNTFRYDLVDLTRQTLAKYANQ  595

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            V++  I ++   +   +S   Q F+ L+ D+D LLA+ +G LLG WLESAK L  +  + 
Sbjct  596  VFVKIIESYKANNVNQVSNLCQHFIDLVNDLDTLLASHEGFLLGPWLESAKGLARDKEQE  655

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYA  255
             QYEWNARTQ+TMWFD TK   S L DY 
Sbjct  656  MQYEWNARTQITMWFDNTKTKASLLRDYG  684



>gb|ACF81735.1| unknown [Zea mays]
Length=173

 Score =   171 bits (434),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = -1

Query  473  LSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFD  294
            +++  Q FL L+ D+D LL++ +G LLG WLESAK L  NS +  QYEWNARTQ+TMWFD
Sbjct  4    VTILCQHFLSLVNDLDTLLSSHEGFLLGPWLESAKGLARNSEQEIQYEWNARTQITMWFD  63

Query  293  TTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSE  114
             T+   S L DYANK+WSGLL+ YY PRA++YF HL  S+  N  F ++EWR+EWI+ + 
Sbjct  64   NTETKASLLRDYANKYWSGLLQDYYGPRAAIYFKHLLLSMENNAPFALKEWRREWISLTN  123

Query  113  KWQRGSELYPVKAQGDALAIANALYQKYFS  24
             WQ   +++   A GD L I+ +LY KY S
Sbjct  124  NWQSDRKVFSTTATGDPLNISQSLYTKYLS  153



>gb|KDO69791.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
 gb|KDO69792.1| hypothetical protein CISIN_1g008173mg [Citrus sinensis]
Length=472

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 124/182 (68%), Gaps = 5/182 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        + 
Sbjct  288  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKE  342

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  343  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  402

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ I A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  403  LFLNIIEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  462

Query  341  KQ  336
            KQ
Sbjct  463  KQ  464



>gb|KCW83403.1| hypothetical protein EUGRSUZ_B00338 [Eucalyptus grandis]
Length=732

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 124/184 (67%), Gaps = 5/184 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW IL+HT+YNCTDG+ D N+D IV FPD DPS  + S +  + + K        R 
Sbjct  534  IKEAWNILHHTIYNCTDGLYDKNRDVIVAFPDADPSSISFSQLRYHRYGKPLF-----RG  588

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L E +    +PH+WYST +V++AL+LFLA G +L  S TYRYDLVDLTRQ+L+K AN+
Sbjct  589  AVLNEKTGLTDEPHMWYSTSEVVRALELFLAGGDQLQSSDTYRYDLVDLTRQALAKFANE  648

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L  I  +  +DA  ++ HSQKFL L++D+D LLA  +G LLG WLESAK L +N  + 
Sbjct  649  LFLKVIEDYQRQDAYGVAFHSQKFLNLVEDMDTLLACHEGFLLGPWLESAKQLAQNKEQE  708

Query  341  KQYE  330
            +Q +
Sbjct  709  RQVQ  712



>ref|XP_006439736.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 ref|XP_006439739.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52976.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52979.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=711

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 125/182 (69%), Gaps = 5/182 (3%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW +LYHTVYNCTDG  D N+D IV FPD DPS  + ++    ++ K        ++
Sbjct  527  IQDAWNVLYHTVYNCTDGATDKNRDVIVAFPDVDPSIISVTEGKYQNYGKPV-----SKK  581

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
              L   +SS   PHLWYST +V++AL+LF+A+G EL+ S TYRYDL+DLTRQ+L+K AN+
Sbjct  582  AVLKSETSSYDHPHLWYSTSEVIRALELFIASGNELSASNTYRYDLIDLTRQALAKYANE  641

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            ++L+ + A+   DA  +   S++FL+L++D+D LLA  DG LLG WLESAK L +N  + 
Sbjct  642  LFLNILEAYQLNDAHGVFQLSRRFLELVEDMDGLLACHDGFLLGPWLESAKQLAQNEEQE  701

Query  341  KQ  336
            KQ
Sbjct  702  KQ  703



>ref|XP_007208776.1| hypothetical protein PRUPE_ppa023629mg [Prunus persica]
 gb|EMJ09975.1| hypothetical protein PRUPE_ppa023629mg [Prunus persica]
Length=143

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -1

Query  431  IDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYAN  252
            +D LLA  DG LLGTWLESAK L ++  + KQ+EWNARTQ+TMWFD TK   S L DY N
Sbjct  1    MDTLLACHDGFLLGTWLESAKKLAQDEEQEKQFEWNARTQITMWFDNTKEEASLLRDYGN  60

Query  251  KFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQ  72
            K+WSGLL++YY PRA++YF +L++SL E  EF++++WR+EWI  +  WQ   + +PVK+ 
Sbjct  61   KYWSGLLQNYYGPRAAIYFKYLTQSLEEGSEFRLKDWRREWIKLTNDWQNSRKAFPVKSS  120

Query  71   GDALAIANALYQKYFS  24
            G+AL+ +  L+ KY  
Sbjct  121  GNALSTSRWLFDKYLG  136



>ref|XP_009625153.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Nicotiana 
tomentosiformis]
Length=734

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 122/188 (65%), Gaps = 13/188 (7%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQR--  708
            ++ AW ILYHT+YNCTDG  D N+D IV FPD DP   +   +  ND        H++  
Sbjct  531  MQDAWNILYHTIYNCTDGAYDKNRDVIVAFPDVDPKFISTLQIALND-------IHEQDG  583

Query  707  ----RRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSL  540
                 R  L E + S  +PHLWYS  DV+ ALKLFL +G +L  S TYRYDL+DLTRQ+L
Sbjct  584  KRYLGRAILEEANDSYDKPHLWYSNSDVIHALKLFLESGNQLTDSSTYRYDLIDLTRQAL  643

Query  539  SKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLT  360
            +K AN+++LD I A+   D  A+S  SQKFL L+KD+D+LL   DG LLG W+ESAK L 
Sbjct  644  AKYANELFLDVIEAYKLDDLHAVSHLSQKFLGLVKDMDMLLGCHDGFLLGPWIESAKKLA  703

Query  359  ENSNETKQ  336
            ++ ++ +Q
Sbjct  704  QDEDQERQ  711



>gb|EYU29515.1| hypothetical protein MIMGU_mgv1a0184372mg, partial [Erythranthe 
guttata]
Length=302

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 119/186 (64%), Gaps = 7/186 (4%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDM---PENDHTKAFVLTHQ  711
            ++ AW ILY T+YNCTDG+ D N+D I+ FPD DP+    S +   P   H+ +    HQ
Sbjct  104  IQEAWNILYRTLYNCTDGLNDKNRDVIMYFPDVDPNSILTSPLLLSPAKHHSYS---NHQ  160

Query  710  RRRFFLLE-TSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK  534
              R  + E  S S   PHLWYST +V++ALKLF+A+G  L+ S TY+YDLVDLTRQ L+K
Sbjct  161  SLRRTIYELRSDSYTHPHLWYSTSEVIRALKLFIASGDYLSDSNTYKYDLVDLTRQVLAK  220

Query  533  LANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN  354
             ANQ++   + A+   D   +   S+KFL L++D+D LL   +G LLG WLESAK L +N
Sbjct  221  YANQLFFKVVEAYQLGDLSLVKQLSEKFLGLVEDLDSLLGCHEGFLLGPWLESAKELAQN  280

Query  353  SNETKQ  336
              + KQ
Sbjct  281  EEQKKQ  286



>ref|XP_009799807.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Nicotiana 
sylvestris]
Length=734

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILYHT+YNCTDG  D N+D IV FPD +P   +   +  N+  + +   +  R 
Sbjct  531  MQDAWNILYHTIYNCTDGAYDKNRDVIVSFPDVEPKSISTLQIALNNIHEQYGKRYLGRA  590

Query  701  FFLLETSS-SLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              +LE ++ S  +PHLWYS  DV+ ALKLFL +G +L+ S TYRYDL+DLTRQ+L+K AN
Sbjct  591  --ILEVANDSYDKPHLWYSNSDVIHALKLFLESGNQLSDSSTYRYDLIDLTRQALAKYAN  648

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            +++LD I A+   D  A+S  SQKFL L+KD+D+LL   DG LLG W+E AK L ++ ++
Sbjct  649  ELFLDVIEAYKLDDLYAVSHLSQKFLGLVKDMDMLLGCHDGFLLGPWIERAKKLAQDEDQ  708

Query  344  TKQ  336
             +Q
Sbjct  709  ERQ  711



>ref|XP_009420879.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Musa acuminata 
subsp. malaccensis]
Length=158

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = -1

Query  425  VLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKF  246
            +LL+  DG LLG  LESAK L  +  + +Q+EWNARTQVTMWFD T+   S L DY NK+
Sbjct  1    MLLSCHDGFLLGPLLESAKRLARDPEQEQQFEWNARTQVTMWFDNTETEASLLRDYGNKY  60

Query  245  WSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGD  66
            WSGLL  YY PRAS+YF ++  SL +   F +E+WR++WI  + KWQ    L+PVKA GD
Sbjct  61   WSGLLLDYYGPRASIYFKYMIDSLVKGESFPLEDWRRDWIGLTNKWQSSRNLFPVKASGD  120

Query  65   ALAIANALYQKYFS  24
            AL I+  LY KY  
Sbjct  121  ALNISRWLYDKYLC  134



>ref|WP_029711569.1| hypothetical protein [BRC1 bacterium SCGC AAA257-C11]
Length=740

 Score =   158 bits (399),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 119/203 (59%), Gaps = 4/203 (2%)
 Frame = -1

Query  638  VLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKALSVHS  459
            +++   L L    E+  + TYR+DLV++ RQ LS L+   Y + I A+  KD K L   S
Sbjct  535  LMQTWNLLLQCAGEIGQTDTYRFDLVNVARQVLSNLSVPRYAEIITAYHEKDYKRLVSAS  594

Query  458  QKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFDTTKYV  279
             ++LQLI+D+D LLAA +  LLG WLE AK    N+ E + YEWNAR  +T+W       
Sbjct  595  DEYLQLIRDLDELLAAREEFLLGKWLEDAKRWGTNNEEKRLYEWNARNVITLWGGR----  650

Query  278  QSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRG  99
            ++ LHDYA K WSGL+  +YL R  M+ N L RSL E   F   E+ ++   + E W   
Sbjct  651  EAGLHDYARKEWSGLISGFYLQRWQMFLNRLERSLAEKKPFNNIEFTRDIQLWEEDWTHQ  710

Query  98   SELYPVKAQGDALAIANALYQKY  30
            +E YP   QGDA+A+A   ++KY
Sbjct  711  TETYPAIPQGDAIALARKFFEKY  733



>ref|XP_001638539.1| predicted protein [Nematostella vectensis]
 gb|EDO46476.1| predicted protein [Nematostella vectensis]
Length=675

 Score =   149 bits (376),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 135/281 (48%), Gaps = 41/281 (15%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
            AW +L  +VY C    ADH     V    W PS                           
Sbjct  432  AWRLLIRSVYQCNGYCADHIHSIFV----WKPS---------------------------  460

Query  692  LETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYL  513
            L+      +P+LWY  EDV  A     +   E     T+RYDLVD+TRQ+L      +Y 
Sbjct  461  LDN-----KPNLWYDPEDVFNAWDELRSTAAEFMHVETFRYDLVDVTRQALHLRVIPIYN  515

Query  512  DSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
            D I+A+ N+ A  +     + L++  D+D LL  +   LLG WL SAK+L     E   Y
Sbjct  516  DLISAYKNRSALNVIHFGSRLLEMFDDLDSLLQTNRNFLLGRWLNSAKALGTTPAEVALY  575

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E+NAR Q+T+W       + ++ DYANK WSGL+++YY PR  ++ + +  ++ +  E  
Sbjct  576  EFNARNQITLWGP-----RGEIEDYANKMWSGLVKAYYKPRWELFIDEMVSAIAQGEELD  630

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
             E ++K+ +     W  G E YP +  GD+LA A  L+ K+
Sbjct  631  YEAFKKKLLEQETAWTHGKEEYPDQPSGDSLAAAEFLHNKW  671



>tpg|DAA35664.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=721

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 3/183 (2%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            ++ AW ILY T+YNCTDG  D N+D IV FPD +P       +  N  T+    T   + 
Sbjct  527  LQDAWWILYRTLYNCTDGKNDKNRDVIVAFPDVEPFVIATPGLHVN--TRQMYSTVPSKN  584

Query  701  FFLLETSS-SLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            +   + SS +   PHLWY T  V+ AL+LFL  G E++ S T+RYDLVDLTRQ L+K AN
Sbjct  585  YIRKDVSSDAYEHPHLWYDTNAVIHALELFLQHGDEVSDSNTFRYDLVDLTRQVLAKYAN  644

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             V+L  I ++ + +   +++  Q FL L+ D+D LL++ +G LLG WLESAK L  NS +
Sbjct  645  DVFLKIIESYKSNNMNQVTILCQHFLSLVNDLDTLLSSHEGFLLGPWLESAKGLARNSEQ  704

Query  344  TKQ  336
              Q
Sbjct  705  EIQ  707



>ref|XP_007558689.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Poecilia formosa]
Length=598

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/287 (32%), Positives = 137/287 (48%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT  G  +HN   +V                             RR
Sbjct  333  LTAAWKLLFTSVYNCTIPGYVNHNHSPLV-----------------------------RR  363

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ +A KLF+ A        T++YDLVD+TRQ L  L +
Sbjct  364  PSFRMRTD-------LWYEPADLFEAWKLFMEAAPSFMSKETFQYDLVDVTRQVLQVLTS  416

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF NK   + L+        L+ +++ LL+++   LLGTWLE A+S   N  
Sbjct  417  SFYQDIADAFANKKMPELLTAGGVLVYDLLPELNRLLSSNQNFLLGTWLERAQSKALNER  476

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   L+ 
Sbjct  477  EAQLYDMNARNQVTLWGPS-----GEILDYANKQWGGLIEDYYAQRWGLFVQTLVECLDR  531

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + +K + + +      + +      YP K QGD   IA+ ++ KY+
Sbjct  532  GLPYKQDTFNQAVFQVEQGFIYNGRKYPTKPQGDTYEIAHRIFLKYY  578



>gb|ELW54978.1| Alpha-N-acetylglucosaminidase [Tupaia chinensis]
Length=724

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 148/286 (52%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGI-ADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+  + + HN+  +V+ P                             
Sbjct  461  EAAWRLLLRSVYNCSGQMCSGHNRSPLVKRPS----------------------------  492

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   LA S T+RYDL+D+TRQ++ +L + 
Sbjct  493  ---LQMNTTV-----WYNRSDVFEAWRLLLTAAPTLAASPTFRYDLLDVTRQAVQELVSL  544

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y ++  A+ NK+  +L       + +L+ D+D LLA D   +LG+WLE A+++  +  E
Sbjct  545  YYEEARTAYLNKELVSLLRAGGILVYELLPDLDNLLATDGRFMLGSWLEQARAVAVSETE  604

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W  T       + DYANK  +GL+  YY PR  ++   L+ SL + 
Sbjct  605  AQFYEQNSRYQLTLWGPT-----GNILDYANKQLAGLVADYYAPRWQLFMEMLANSLTQG  659

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            + F+  ++ +      + +    E YP + QGD + +A  ++ KYF
Sbjct  660  IPFQQHQFDQNAFQLEQAFVLSVERYPSQPQGDTVELAKKIFLKYF  705



>ref|XP_006156074.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Tupaia chinensis]
Length=754

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 148/286 (52%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGI-ADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+  + + HN+  +V+ P                             
Sbjct  491  EAAWRLLLRSVYNCSGQMCSGHNRSPLVKRPS----------------------------  522

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   LA S T+RYDL+D+TRQ++ +L + 
Sbjct  523  ---LQMNTTV-----WYNRSDVFEAWRLLLTAAPTLAASPTFRYDLLDVTRQAVQELVSL  574

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y ++  A+ NK+  +L       + +L+ D+D LLA D   +LG+WLE A+++  +  E
Sbjct  575  YYEEARTAYLNKELVSLLRAGGILVYELLPDLDNLLATDGRFMLGSWLEQARAVAVSETE  634

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W  T       + DYANK  +GL+  YY PR  ++   L+ SL + 
Sbjct  635  AQFYEQNSRYQLTLWGPT-----GNILDYANKQLAGLVADYYAPRWQLFMEMLANSLTQG  689

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            + F+  ++ +      + +    E YP + QGD + +A  ++ KYF
Sbjct  690  IPFQQHQFDQNAFQLEQAFVLSVERYPSQPQGDTVELAKKIFLKYF  735



>ref|XP_007558665.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Poecilia 
formosa]
Length=653

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 137/288 (48%), Gaps = 43/288 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT  G  +HN   +V                             RR
Sbjct  388  LTAAWKLLFTSVYNCTIPGYVNHNHSPLV-----------------------------RR  418

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ +A KLF+ A        T++YDLVD+TRQ L  L +
Sbjct  419  PSFRMRTD-------LWYEPADLFEAWKLFMEAAPSFMSKETFQYDLVDVTRQVLQVLTS  471

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF NK   + L+        L+ +++ LL+++   LLGTWLE A+S   N  
Sbjct  472  SFYQDIADAFANKKMPELLTAGGVLVYDLLPELNRLLSSNQNFLLGTWLERAQSKALNER  531

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   L+ 
Sbjct  532  EAQLYDMNARNQVTLWGPS-----GEILDYANKQWGGLIEDYYAQRWGLFVQTLVECLDR  586

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             + +K + + +      + +      YP K QGD   IA+ ++ KY+ 
Sbjct  587  GLPYKQDTFNQAVFQVEQGFIYNGRKYPTKPQGDTYEIAHRIFLKYYP  634



>ref|XP_005811749.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Xiphophorus maculatus]
Length=670

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/287 (32%), Positives = 138/287 (48%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT  G  +HN   +V                             RR
Sbjct  387  LTAAWKLLFTSVYNCTIAGYVNHNHSPLV-----------------------------RR  417

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ +A +LF+ A        T++YDLVD+TRQ L  L +
Sbjct  418  PSFRMRTD-------LWYDPADLFEAWRLFMEAAPSFMTKETFQYDLVDVTRQVLQVLTS  470

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF NK   + L+V       L+ +++ LL+++   LLGTWLE A+S   N  
Sbjct  471  SFYQDIADAFANKKMPELLTVGGVLVYDLLPELNRLLSSNQNFLLGTWLERAQSKALNER  530

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   L+ 
Sbjct  531  EAQLYDMNARNQVTLWGPS-----GEILDYANKQWGGLIEDYYAQRWGLFVQMLVECLDR  585

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + +K + + +      + +      YP K QGD   IA+ ++ KY+
Sbjct  586  GLPYKQDTFNQAVFQVEQGFIYNGRKYPTKPQGDTYEIAHRIFLKYY  632



>ref|XP_007558657.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Poecilia 
formosa]
Length=763

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/287 (32%), Positives = 137/287 (48%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT  G  +HN   +V                             RR
Sbjct  498  LTAAWKLLFTSVYNCTIPGYVNHNHSPLV-----------------------------RR  528

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ +A KLF+ A        T++YDLVD+TRQ L  L +
Sbjct  529  PSFRMRTD-------LWYEPADLFEAWKLFMEAAPSFMSKETFQYDLVDVTRQVLQVLTS  581

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF NK   + L+        L+ +++ LL+++   LLGTWLE A+S   N  
Sbjct  582  SFYQDIADAFANKKMPELLTAGGVLVYDLLPELNRLLSSNQNFLLGTWLERAQSKALNER  641

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   L+ 
Sbjct  642  EAQLYDMNARNQVTLWGPS-----GEILDYANKQWGGLIEDYYAQRWGLFVQTLVECLDR  696

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + +K + + +      + +      YP K QGD   IA+ ++ KY+
Sbjct  697  GLPYKQDTFNQAVFQVEQGFIYNGRKYPTKPQGDTYEIAHRIFLKYY  743



>ref|WP_012790769.1| alpha-N-acetylglucosaminidase [Chitinophaga pinensis]
 gb|ACU60593.1| Alpha-N-acetylglucosaminidase [Chitinophaga pinensis DSM 2588]
Length=728

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 141/284 (50%), Gaps = 36/284 (13%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V  AW+ILYHTVY    G  +   + I+       + PT                     
Sbjct  477  VNKAWQILYHTVY--IGGPTEGAPESIIV------ARPT---------------------  507

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++   +  L Y    V+ A  LF+ A  +L  +  ++YDLVDLTRQ L   A+ 
Sbjct  508  ---LDIAAERVKTKLEYDPAKVVPAWDLFINAAAQLKPTEGFKYDLVDLTRQVLGNYASP  564

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            +      A+ NKD  A   +S +F+ L+ D+D+LL   +G LLG W+  A+S      E 
Sbjct  565  LQQRVATAYRNKDLAAFKQYSTQFIGLLDDMDMLLGTQEGFLLGKWVSDARSNGITPAEQ  624

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
              YE+NA+  VT+W D      S +H+Y+N+ W+GL++ +Y PR   +F  L  SL +  
Sbjct  625  DLYEFNAKDLVTLWGDK----DSPVHEYSNRQWNGLIKGFYKPRWQQFFTLLESSLKKGE  680

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
               ++ + ++  AF  KW  G + Y VK QGDA+  A  L++KY
Sbjct  681  TADLKAFEEQVKAFEWKWANGHDKYAVKPQGDAVKAAVQLHKKY  724



>ref|XP_005645139.1| hypothetical protein COCSUDRAFT_37819 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20595.1| hypothetical protein COCSUDRAFT_37819 [Coccomyxa subellipsoidea 
C-169]
Length=762

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/281 (33%), Positives = 137/281 (49%), Gaps = 29/281 (10%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
            AW++L  +VYN TDG  DH++D     P   P+                           
Sbjct  490  AWDLLLRSVYNATDGHTDHSRDIPTSRPGLSPA---------------------------  522

Query  692  LETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYL  513
             E      +PHLWY+ + V+ A  L L +  EL     YRYDLVD+ RQ +SK A  ++ 
Sbjct  523  -EVGLWGLKPHLWYNEQQVVDAWGLLLRSAGELQQVEGYRYDLVDVGRQVISKRATDIWK  581

Query  512  DSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
                A+ +  +  +     + LQL+ D++ LLA + G LLG  LE A S      E + Y
Sbjct  582  AVAEAYVDGRSIVVRREGARLLQLLDDLEELLATNRGFLLGPKLEEASSAGHTEAEARLY  641

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            EWN R Q+T+W  T+    S++ DYAN+ W+GL+ SYY PR +++   L   L +   + 
Sbjct  642  EWNLRKQLTVW-GTSDTGGSEIEDYANREWAGLISSYYKPRWALWLLRLETDLAQGRRYD  700

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
             E WR E + F+  W    +  P+  QGD   ++  LY+ Y
Sbjct  701  PEAWRMECLNFTLGWAYLRDQLPLHPQGDTGGVSQRLYEVY  741



>ref|XP_011486876.1| PREDICTED: alpha-N-acetylglucosaminidase, partial [Oryzias latipes]
Length=639

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 136/292 (47%), Gaps = 43/292 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT     +HN   +V                             RR
Sbjct  387  LSAAWKLLFSSVYNCTVPHYRNHNHSPLV-----------------------------RR  417

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+L+  KLF+ A   L    T+RYDLVD+TRQ L  L  
Sbjct  418  PSFNMNTG-------LWYDPADLLETWKLFMEAAPSLMSKETFRYDLVDVTRQVLQDLTT  470

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF +K    L       +  L  +++ LL +D   LLGTWLE A+S   +  
Sbjct  471  YFYQDIKDAFHSKKMPELLTSGGVLIYDLFPELNRLLNSDRNFLLGTWLEQAQSFALDEP  530

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR Q+T+W  +      ++ DYANK W GL+E YY  R S++   L   LN 
Sbjct  531  EARLYDLNARNQLTLWGPS-----GEILDYANKEWGGLVEDYYAQRWSLFVQTLVDCLNS  585

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS*GLE  12
             + FK + + +      + +      YP K QGD   IA+ ++ KY+   L+
Sbjct  586  GLPFKQDAFNQAVFRVEKGFISNGRKYPTKPQGDTYEIAHRIFLKYYPQALK  637



>ref|XP_002156234.2| PREDICTED: alpha-N-acetylglucosaminidase-like [Hydra vulgaris]
Length=646

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 133/284 (47%), Gaps = 37/284 (13%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V  AW IL  T+YNC DG    N  Y    P   P                         
Sbjct  374  VSDAWLILIDTIYNCNDG--RENGGYDGRIPVMRP-------------------------  406

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
                + ++ LP  H+WYS +D+  A KL +     +    T+R DLV L  Q L  L+  
Sbjct  407  ----QLNAKLPV-HMWYSIKDLYNAWKLMVKGSDYMPLIDTFRNDLVRLGTQVLEDLSIV  461

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
             Y   ++ + NK    +  +  K   L+ D+D LLA D   LLG W++SA+S+ +  NET
Sbjct  462  FYTQMVSGYFNKSTLNVEKYGSKITVLLTDMDRLLATDQYSLLGRWIQSARSMGDTLNET  521

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
            K  E+NA+ Q+T+W         ++ DYANK W+GL+ S+Y  R +M+ N LS SL   V
Sbjct  522  KLLEYNAKNQITLWGP-----NGEIRDYANKNWAGLVGSFYFERWNMFINFLSDSLKRGV  576

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
             +    +  + + F +KW    + +     GDA  I++ L + Y
Sbjct  577  PYDDSAFVSKLLQFEKKWNNEIKEFSADPTGDAFGISHQLLRAY  620



>gb|EFB20123.1| hypothetical protein PANDA_011160 [Ailuropoda melanoleuca]
Length=619

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 147/286 (51%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V  P                             
Sbjct  368  EAAWRLLLRSVYNCSGEACSGHNRSPLVRRPS----------------------------  399

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   LA S ++RYDL+D+TRQ+  +L + 
Sbjct  400  ---LQMATAV-----WYNRSDVFEAWRLLLTAAPTLAASPSFRYDLLDVTRQAAQELVSL  451

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y ++ AA+ NK+   L   + + + +L+  +D +LA+D   LLG+WLE A++   +  E
Sbjct  452  YYEEARAAYLNKELVPLLRAAGRLVYELLPALDKVLASDRRFLLGSWLEQARAAAVSEAE  511

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL + 
Sbjct  512  ARFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYAPRWGLFMEMLVESLAQG  566

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            + F+  ++ K      + +   ++ YP + QGD + +A  L+ KY+
Sbjct  567  IPFQQHQFDKNAFQLEQAFVFSTQRYPSQPQGDTVDLAKKLFLKYY  612



>ref|XP_005313977.1| PREDICTED: alpha-N-acetylglucosaminidase [Chrysemys picta bellii]
Length=747

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 134/284 (47%), Gaps = 42/284 (15%)
 Frame = -1

Query  875  AAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFF  696
             AW++L  +VYNC+    +HN   +V                             RR   
Sbjct  493  GAWQLLLRSVYNCSGICVNHNHSPLV-----------------------------RRPSL  523

Query  695  LLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVY  516
             + T        LWY+  DV +A +L L A  EL  S T+RYDLVD+TRQ+  +L ++ Y
Sbjct  524  RMAT-------ELWYNKSDVYEAWRLLLDAAAELGASPTFRYDLVDVTRQAAQQLVSEYY  576

Query  515  LDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETK  339
            L+   AF ++    L       L  L+ ++D LLA+D   LLG WLE A++   +  E +
Sbjct  577  LEIKQAFQSRSLPELLTAGGVLLYDLLPELDALLASDPHFLLGRWLEQARATATSDKEAE  636

Query  338  QYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVE  159
             Y+ NAR QVT+W  +       + DYANK   GL+  YY  R S++ + L  SLN    
Sbjct  637  LYDLNARNQVTLWGPS-----GNILDYANKQLGGLVLDYYRVRWSLFVSALVESLNTGTP  691

Query  158  FKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            F  E++ +        +    + YP +  GD L IA  ++ KY+
Sbjct  692  FHQEQFNQAVFQLERGFVYNGKRYPSQPAGDTLEIARKIFLKYY  735



>ref|XP_008436404.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Poecilia 
reticulata]
Length=763

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 136/287 (47%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT  G  +HN   +V                             RR
Sbjct  498  LTAAWKLLFTSVYNCTIPGYVNHNHSPLV-----------------------------RR  528

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ +A +LF+ A        T++YDLVD+TRQ L  L +
Sbjct  529  PSFQMRTD-------LWYEPADLFEAWRLFMEAAPSFMSKETFQYDLVDVTRQVLQVLTS  581

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF NK   + L+        L+ +++ LL+++   LLG WLE A+S   N  
Sbjct  582  SFYQDIADAFANKKMPELLTAGGVLVYDLLPELNRLLSSNQNFLLGMWLERAQSKALNER  641

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   L+ 
Sbjct  642  EAQLYDMNARNQVTLWGPS-----GEILDYANKQWGGLIEDYYAQRWGLFVQTLVECLDR  696

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + +K + + +      + +      YP K QGD   IA+ ++ KY+
Sbjct  697  GLPYKQDSFNQAVFQVEQGFIYNGRKYPTKPQGDTYEIAHRIFLKYY  743



>ref|XP_011226954.1| PREDICTED: alpha-N-acetylglucosaminidase [Ailuropoda melanoleuca]
Length=660

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/286 (30%), Positives = 147/286 (51%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V  P                             
Sbjct  408  EAAWRLLLRSVYNCSGEACSGHNRSPLVRRPS----------------------------  439

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   LA S ++RYDL+D+TRQ+  +L + 
Sbjct  440  ---LQMATAV-----WYNRSDVFEAWRLLLTAAPTLAASPSFRYDLLDVTRQAAQELVSL  491

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y ++ AA+ NK+   L   + + + +L+  +D +LA+D   LLG+WLE A++   +  E
Sbjct  492  YYEEARAAYLNKELVPLLRAAGRLVYELLPALDKVLASDRRFLLGSWLEQARAAAVSEAE  551

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL + 
Sbjct  552  ARFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYAPRWGLFMEMLVESLAQG  606

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            + F+  ++ K      + +   ++ YP + QGD + +A  L+ KY+
Sbjct  607  IPFQQHQFDKNAFQLEQAFVFSTQRYPSQPQGDTVDLAKKLFLKYY  652



>ref|XP_011333454.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Cerapachys 
biroi]
Length=697

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (54%), Gaps = 7/235 (3%)
 Frame = -1

Query  728  FVLTHQRRRFFLLETSSSLP-QPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLT  552
            F+ T + R  +++    SL   P +WYS E      K+FL A      +  YR D+VD+T
Sbjct  453  FIGTEKIRGHYVITRRPSLKITPWVWYSREGFYSTWKVFLKARYGRRNNTLYRNDVVDIT  512

Query  551  RQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA  372
            RQ+L  +A+ VY + + ++  K+  A   H    L+L  D++ +LA+ +  LLGTWL  A
Sbjct  513  RQALQLMADDVYTNIVDSYKKKNITAFRSHVSALLELFDDLESILASGNNFLLGTWLAQA  572

Query  371  KSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFN  192
            K +  +  E + YE+NAR Q+T+W         ++ DYANK WSG++  Y+ PR  ++  
Sbjct  573  KDMAVDDEERQSYEYNARNQITLWGP-----NGEIRDYANKQWSGVMADYFKPRWELFLK  627

Query  191  HLSRSLNENVEFKVEEWR-KEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
             L  SL E   F + E   + +    + +   ++LYPV+A GD + IA  +  K+
Sbjct  628  ALENSLVERTRFNITEINDRIFREVEQPFTFSTKLYPVEAIGDTIDIATKIMSKW  682



>ref|XP_008436403.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Poecilia 
reticulata]
Length=796

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 136/287 (47%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW++L+ +VYNCT  G  +HN   +V                             RR
Sbjct  531  LTAAWKLLFTSVYNCTIPGYVNHNHSPLV-----------------------------RR  561

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ +A +LF+ A        T++YDLVD+TRQ L  L +
Sbjct  562  PSFQMRTD-------LWYEPADLFEAWRLFMEAAPSFMSKETFQYDLVDVTRQVLQVLTS  614

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF NK   + L+        L+ +++ LL+++   LLG WLE A+S   N  
Sbjct  615  SFYQDIADAFANKKMPELLTAGGVLVYDLLPELNRLLSSNQNFLLGMWLERAQSKALNER  674

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   L+ 
Sbjct  675  EAQLYDMNARNQVTLWGPS-----GEILDYANKQWGGLIEDYYAQRWGLFVQTLVECLDR  729

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + +K + + +      + +      YP K QGD   IA+ ++ KY+
Sbjct  730  GLPYKQDSFNQAVFQVEQGFIYNGRKYPTKPQGDTYEIAHRIFLKYY  776



>ref|XP_005139916.1| PREDICTED: alpha-N-acetylglucosaminidase [Melopsittacus undulatus]
Length=706

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 134/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W +L  +VYNCT    +HN+  +V                             RR    +
Sbjct  458  WRLLLRSVYNCTGVCVNHNRSPLV-----------------------------RRPSLRM  488

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        LWY++ DV +A +L L+AGTEL  S T+RYDLVD+TRQ+  +L +  Y  
Sbjct  489  DT-------ELWYNSSDVFEAWRLLLSAGTELGSSPTFRYDLVDVTRQAAQQLVSSFYRS  541

Query  509  SIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF +     L       L  L+ ++D LL +    LLG WLE A+++   + E +QY
Sbjct  542  IRGAFRSHALPELLAAGGVLLYDLLPELDSLLCSHSLFLLGRWLEGARAMATGAREAEQY  601

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR Q+T+W  +       + DYANK   GL+  YY  R S++ + L  SL+    F 
Sbjct  602  ELNARNQLTLWGPS-----GNILDYANKQLGGLVLDYYGVRWSLFVSALVESLHSGTPFH  656

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GDAL I+  L+ KY+
Sbjct  657  QDQFNQAVFKVERGFVYNKKRYPTVPVGDALEISRKLFLKYY  698



>ref|XP_007236414.1| PREDICTED: alpha-N-acetylglucosaminidase [Astyanax mexicanus]
Length=751

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/292 (32%), Positives = 138/292 (47%), Gaps = 43/292 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW +L+ +VYNCT  G  +HN+D +V                             RR
Sbjct  498  LTAAWRLLFRSVYNCTIPGYKNHNRDPLV-----------------------------RR  528

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
                L+T        +WY   D+ +A KL   A   L    T+RYDLVD+TRQ+L  LA 
Sbjct  529  PSLKLKTD-------VWYDPADLYEAWKLLFEAAPSLVSVETFRYDLVDVTRQALQLLAF  581

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
            + Y +   +F  +    L V     +  LI ++D LL++D   LLG WLE A+S   +  
Sbjct  582  EFYKEIRDSFQAQKLPELLVAGGVLVYDLIPELDRLLSSDQHFLLGVWLEQARSFGLDEQ  641

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR Q+T+W         ++ DYANK W+GL+E YYL R  ++ N L   L+ 
Sbjct  642  EAQLYDINARNQITLWGP-----DGEILDYANKDWAGLMEDYYLQRWGLFVNTLVECLDR  696

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS*GLE  12
               FK + + +        +      YP K +GD   IA  ++ KY+   L+
Sbjct  697  GRPFKQDTFNQAVFQVENGFVYNQRKYPSKPRGDTYEIARLIFLKYYPHALK  748



>ref|XP_011333453.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Cerapachys 
biroi]
 gb|EZA57836.1| Alpha-N-acetylglucosaminidase [Cerapachys biroi]
Length=767

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (54%), Gaps = 7/235 (3%)
 Frame = -1

Query  728  FVLTHQRRRFFLLETSSSLP-QPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLT  552
            F+ T + R  +++    SL   P +WYS E      K+FL A      +  YR D+VD+T
Sbjct  523  FIGTEKIRGHYVITRRPSLKITPWVWYSREGFYSTWKVFLKARYGRRNNTLYRNDVVDIT  582

Query  551  RQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA  372
            RQ+L  +A+ VY + + ++  K+  A   H    L+L  D++ +LA+ +  LLGTWL  A
Sbjct  583  RQALQLMADDVYTNIVDSYKKKNITAFRSHVSALLELFDDLESILASGNNFLLGTWLAQA  642

Query  371  KSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFN  192
            K +  +  E + YE+NAR Q+T+W         ++ DYANK WSG++  Y+ PR  ++  
Sbjct  643  KDMAVDDEERQSYEYNARNQITLWGP-----NGEIRDYANKQWSGVMADYFKPRWELFLK  697

Query  191  HLSRSLNENVEFKVEEWR-KEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
             L  SL E   F + E   + +    + +   ++LYPV+A GD + IA  +  K+
Sbjct  698  ALENSLVERTRFNITEINDRIFREVEQPFTFSTKLYPVEAIGDTIDIATKIMSKW  752



>gb|EFN75548.1| Alpha-N-acetylglucosaminidase [Harpegnathos saltator]
Length=741

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 125/237 (53%), Gaps = 7/237 (3%)
 Frame = -1

Query  728  FVLTHQRRRFFLLETSSSLP-QPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLT  552
            FV   + R  +++    SL   P +WY+ ED      +FL A      +  YR+D+VD+T
Sbjct  493  FVGIERIRGHYVITRRPSLNISPWVWYNREDFYHTWNVFLKARYGRGNNTLYRHDVVDIT  552

Query  551  RQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA  372
            RQ+L  +A+ +Y++ +  +  K+      H+   L L  DI+ +LA+    LLGTWL  A
Sbjct  553  RQALQLMADNIYMNVVDCYKRKNITGFQSHAAALLDLFDDIEAILASGSNFLLGTWLAQA  612

Query  371  KSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFN  192
            K +  +  E + YE+NAR Q+T+W         ++ DYANK WSG++  Y+ PR + +  
Sbjct  613  KDMAVDEKERQSYEYNARNQITLWGP-----NGEIRDYANKQWSGVVADYFKPRWAFFLK  667

Query  191  HLSRSLNENVEFKVEEWR-KEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             L +SL E     + E   + ++   + +   ++LYPV  +GD L IA  +  K+ +
Sbjct  668  ALEKSLVERTRLNMTEINDRMFLEVEQAFTFSTKLYPVGTKGDTLDIAVKIISKWLA  724



>gb|EDM06081.1| rCG33377, isoform CRA_d [Rattus norvegicus]
Length=580

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/285 (29%), Positives = 145/285 (51%), Gaps = 45/285 (16%)
 Frame = -1

Query  875  AAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            AAW +L  +VYNC+ +  + HN+  +V+ P                              
Sbjct  331  AAWRLLLRSVYNCSGEACSGHNRSPLVKRPS-----------------------------  361

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQV  519
              L+ S+++     WY+  DV +A +L L A   L  S  +RYDL+D+TRQ++ +L +  
Sbjct  362  --LQMSTAV-----WYNRSDVFEAWRLLLRAAPNLTASPAFRYDLLDVTRQAVQELVSSC  414

Query  518  YLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            Y ++  AF N+D   L + +   L  +L+  +D LLA++   LLGTWL+ A+ +  + +E
Sbjct  415  YEEARTAFLNQDLDLL-LRAGGLLTYKLLPSLDELLASNSHFLLGTWLDQAREVAVSESE  473

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L+ SL   
Sbjct  474  AQFYEQNSRYQITLWGP-----EGNILDYANKQLAGLVADYYQPRWCLFLGTLAHSLARG  528

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            + F+  ++ K      + +    + YP++ QGD + ++  ++ K+
Sbjct  529  IPFQQHQFEKSVFPLEQAFINNKKRYPIQPQGDTVDLSKKIFLKF  573



>ref|XP_011152868.1| PREDICTED: alpha-N-acetylglucosaminidase [Harpegnathos saltator]
Length=767

 Score =   138 bits (347),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 125/237 (53%), Gaps = 7/237 (3%)
 Frame = -1

Query  728  FVLTHQRRRFFLLETSSSLP-QPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLT  552
            FV   + R  +++    SL   P +WY+ ED      +FL A      +  YR+D+VD+T
Sbjct  519  FVGIERIRGHYVITRRPSLNISPWVWYNREDFYHTWNVFLKARYGRGNNTLYRHDVVDIT  578

Query  551  RQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA  372
            RQ+L  +A+ +Y++ +  +  K+      H+   L L  DI+ +LA+    LLGTWL  A
Sbjct  579  RQALQLMADNIYMNVVDCYKRKNITGFQSHAAALLDLFDDIEAILASGSNFLLGTWLAQA  638

Query  371  KSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFN  192
            K +  +  E + YE+NAR Q+T+W         ++ DYANK WSG++  Y+ PR + +  
Sbjct  639  KDMAVDEKERQSYEYNARNQITLWGP-----NGEIRDYANKQWSGVVADYFKPRWAFFLK  693

Query  191  HLSRSLNENVEFKVEEWR-KEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
             L +SL E     + E   + ++   + +   ++LYPV  +GD L IA  +  K+ +
Sbjct  694  ALEKSLVERTRLNMTEINDRMFLEVEQAFTFSTKLYPVGTKGDTLDIAVKIISKWLA  750



>gb|KEH33327.1| alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=109

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 15/109 (14%)
 Frame = -1

Query  305  MWFDTTKYVQSKLHDY---------------ANKFWSGLLESYYLPRASMYFNHLSRSLN  171
            MWFDT +  +SKLHDY               ANK WSG+LE+YYLPRAS YF+HLS SL 
Sbjct  1    MWFDTNETTESKLHDYVLGLTIFCFRYVFRLANKLWSGILENYYLPRASTYFSHLSESLR  60

Query  170  ENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS  24
            +N +FK+ EWRK+WI  S KWQ  +ELYPVKA+G+ L I+ ALY+K+FS
Sbjct  61   QNKKFKLIEWRKQWIPMSNKWQECNELYPVKAKGEGLTISQALYEKHFS  109



>ref|XP_003131436.1| PREDICTED: alpha-N-acetylglucosaminidase [Sus scrofa]
Length=744

 Score =   138 bits (347),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 146/287 (51%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +G   HN+  +V  P                             
Sbjct  492  EAAWRLLLRSVYNCSGEGCTGHNRSPLVRRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   LA S  +RYDLVD+TRQ++ +L + 
Sbjct  524  ---LQMATTV-----WYNQSDVFEAWRLLLKATPTLASSPAFRYDLVDITRQAVQELVSL  575

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y ++  A+ NK+  +L + +   L  +L+  +D +LA+D   LLG+WLE A+ +  +  
Sbjct  576  YYEEARTAYLNKELVSL-MRAGGILAYELLPALDKVLASDSHFLLGSWLEQARGVAVSEA  634

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E   YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL +
Sbjct  635  EALFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYTPRWRLFMEMLVESLVQ  689

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + F+  ++ +      + +  G+  YP + QGD + +A  L+ KY+
Sbjct  690  GIPFQQHQFDQNVFQLEQTFVLGTRRYPSQPQGDTVDLAKKLFLKYY  736



>ref|XP_006810907.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Neolamprologus 
brichardi]
Length=400

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 134/287 (47%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDG-IADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW +L+ ++YNC+D    +HN   +V                             RR
Sbjct  148  LTAAWRLLFASIYNCSDPHYRNHNHSPLV-----------------------------RR  178

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ KA KL + A   L    T+RYDLVD+TR+ L  L  
Sbjct  179  PSFHMNTG-------LWYDPADLYKAWKLIMDAAPSLMSKETFRYDLVDVTREVLQVLTT  231

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF  ++ ++ L+        L+ +++ LL+++   LLGTWLE A+SL  +  
Sbjct  232  SFYRDIADAFKKQNMSELLTAGGVLVYDLLPELNRLLSSNRNFLLGTWLERARSLAVDDK  291

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR Q+T+W  +      ++ DYA+K W GL+E YY  R  ++   L   LN 
Sbjct  292  EAQLYDMNARNQITLWGPS-----GEILDYASKEWGGLMEDYYAQRWGLFVQTLVECLNS  346

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               FK   + +      + +      YP K QGD   IA  ++ KYF
Sbjct  347  GQPFKQAAFNQAVFQIEKGFIYNGRKYPTKPQGDTYEIAYRIFLKYF  393



>gb|AIG55486.1| secreted protein [Thraustotheca clavata]
Length=746

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 138/287 (48%), Gaps = 39/287 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
             +AW  L H+VYN T G     K+ I   P+W                            
Sbjct  478  RSAWNRLAHSVYNVTKGFGGVTKNVITRRPNWH---------------------------  510

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQV  519
              L  S  +P   + Y+ +DV+ AL   L A ++L+ S TY +DLVD+ RQ LS L    
Sbjct  511  --LTKSPFMPA-EITYNPKDVVAALHDLLNAASDLSKSTTYLHDLVDVARQILSDLLLHE  567

Query  518  YLDSIAAFTNKDAKA----LSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS  351
            Y     AF  K AK     ++  S++ L L  D+D LLA  +  LLG WL  AK+L   +
Sbjct  568  YKSLRDAF--KAAKVSPSVITGISERILILGADLDRLLATHEDYLLGRWLYDAKALGNTT  625

Query  350  NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLN  171
               + YE+ AR QVT W D      + + DYA+K W+GL+ SYYLPR  ++ + +  +  
Sbjct  626  ALRQYYEYEARNQVTRWGDGN---NNAITDYASKQWAGLVGSYYLPRWRIWLDEVCAAYE  682

Query  170  ENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +  +      +  W AF   WQ+ +  YP+ A GD +AIA  +Y KY
Sbjct  683  DKRQVDENAVKLAWEAFELGWQKETTSYPIHAHGDTIAIAKEIYHKY  729



>ref|WP_013992396.1| alpha-N-acetylglucosaminidase [Zobellia galactanivorans]
 ref|YP_004735475.1| alpha-N-acetylglucosaminidase [Zobellia galactanivorans]
 emb|CAZ95084.1| Alpha-N-acetylglucosaminidase, family GH89 [Zobellia galactanivorans]
Length=747

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V+ AW++L  +VY  T  +             W P   T   M   + +K  +  H R+ 
Sbjct  479  VKKAWQLLGESVYGRTRTM-------------WSPLITTPRLMIFEEGSKEDI-RHVRKD  524

Query  701  FFLLETSSSLPQPHLW-YSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
            F + ET      P  W +    + KA  L L    EL    TY +DL ++ R+ L  L +
Sbjct  525  FKITETD-----PFAWDFDVYKLAKAAGLLLGEANELQDVETYNFDLTNVYRELLFSLTH  579

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            +   D   A+  KD +AL   ++   +L+ D++ +  A++  LLG WLE AKS      E
Sbjct  580  KSINDVSVAYQEKDRQALDRSAKSLFKLMDDLEAITGANENFLLGKWLEDAKSWGSTPEE  639

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YEWNART VT+W     Y +  L DYA K W+GL   YY PR  ++ +HL RSL E 
Sbjct  640  KEYYEWNARTIVTIW---QPYPEGGLRDYAGKQWNGLFSGYYKPRWQLFVDHLRRSLTEG  696

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            V+F  + +  E      KW R  ++YP       + +A  +  +Y
Sbjct  697  VDFDPKAYDAEVREMDYKWTRSHQIYPSAPTEKTIDVARRIQTEY  741



>gb|ETP45296.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=684

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSCEPYPTTTVGDTLIVSQRIYDEF  667



>gb|ETI47474.1| hypothetical protein, variant [Phytophthora parasitica P1569]
Length=684

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  667



>gb|ETK87396.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL40813.1| hypothetical protein, variant [Phytophthora parasitica]
Length=684

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  667



>gb|ETP17256.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=684

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  667



>ref|XP_004707539.1| PREDICTED: alpha-N-acetylglucosaminidase [Echinops telfairi]
Length=681

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 142/286 (50%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V+ P                             
Sbjct  429  EAAWRLLLRSVYNCSGEACSGHNRSPLVKRPS----------------------------  460

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   LA S  +RYDL+D+TRQ+  +L + 
Sbjct  461  ---LQMNTTV-----WYNRSDVFEAWRLLLTAAPTLATSPAFRYDLLDVTRQAAQELVSL  512

Query  521  VYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y +   A++NK+    L        +L+ ++D+ LA+D   LLG+WLE A+    +  E
Sbjct  513  YYEEVRTAYSNKELVHVLRAGGLLVYELLPELDMALASDSRFLLGSWLEEARMAAVSEAE  572

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + +E N+R Q+T+W          + DYANK  +GL+  YY PR  ++   L  SL + 
Sbjct  573  GRFFEQNSRYQLTLWGPV-----GNILDYANKQLAGLVADYYAPRWQLFVGELVESLVQG  627

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            V FK  ++ +        +  GS+ YP + QGD + +A  L+ KY+
Sbjct  628  VPFKQRQFDENVFRLEHAFVFGSQRYPSQPQGDTVDLAKRLFLKYY  673



>gb|ETM47210.1| hypothetical protein, variant [Phytophthora parasitica]
Length=684

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  667



>ref|XP_008905155.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETN09322.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=684

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  667



>ref|XP_008301715.1| PREDICTED: alpha-N-acetylglucosaminidase [Stegastes partitus]
Length=585

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 137/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            + AAW +L+ +VYNCT     H +++                    +H     L H  R 
Sbjct  333  ITAAWRLLFASVYNCT---VPHYRNH--------------------NHCP---LVH--RP  364

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
             F + T        LWY  +D+ +A KL + A   L    T+RYDLVD+TRQ L  L   
Sbjct  365  SFHMNTG-------LWYDPKDLHRAWKLIMDAAPSLMSKETFRYDLVDVTRQVLQVLTTS  417

Query  521  VYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y D   AF  K   + L+        L+ ++D LL++D   LLG WLE A+S+  +  E
Sbjct  418  FYQDITDAFQKKKLPELLTAGGVLVYDLLPELDRLLSSDPNFLLGRWLEQARSIALDEKE  477

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + Y+ NAR QVT+W  +      ++ DYANK W GL+E YY  R  ++   L   LN  
Sbjct  478  VQLYDMNARNQVTLWGPS-----GEILDYANKEWGGLMEDYYTQRWGLFVQTLVECLNSG  532

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS*GLE  12
              FK + + +      + +      YP K +GD   IA+ ++ KY+   L+
Sbjct  533  RPFKQDTFNQAVSQVEKGFIFNGRKYPTKPKGDTYEIAHRIFLKYYPQALK  583



>gb|ETI47473.1| hypothetical protein F443_08379 [Phytophthora parasitica P1569]
Length=772

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  755



>gb|ETP45295.1| hypothetical protein F442_08321 [Phytophthora parasitica P10297]
Length=772

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSCEPYPTTTVGDTLIVSQRIYDEF  755



>ref|WP_014217056.1| alpha-N-acetylglucosaminidase [Niastella koreensis]
 gb|AEV97142.1| Alpha-N-acetylglucosaminidase [Niastella koreensis GR20-10]
Length=735

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 118/208 (57%), Gaps = 4/208 (2%)
 Frame = -1

Query  653  YSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKA  474
            Y+  ++L A  LF+ A  +   S  ++YDLVD+TRQ L+  A  +    + AF  KD+ A
Sbjct  527  YAPHELLPAWDLFVQAAGKGVNSDGFQYDLVDVTRQVLANYAAPLQKKWVTAFNAKDSAA  586

Query  473  LSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFD  294
             + +S+ FLQLI D+D+LLA+    +LG WL +A+S      E   YE NAR  +T+W D
Sbjct  587  FNKYSKAFLQLISDMDLLLASRKDFMLGPWLSAARSNGTTPAEKALYEQNARDLITLWGD  646

Query  293  TTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSE  114
                  S LH+Y+N+ WSGLL  +Y PR   +F  L +SL       ++++ +   ++  
Sbjct  647  ----ANSPLHEYSNRQWSGLLNDFYKPRWQQFFTLLQQSLRTGSTPDLKQFEENIRSWEW  702

Query  113  KWQRGSELYPVKAQGDALAIANALYQKY  30
            KW    + YPV   G+++ +A  LY+KY
Sbjct  703  KWVNTQKAYPVVPSGNSVQVAQMLYKKY  730



>gb|ETP17255.1| hypothetical protein F441_08364 [Phytophthora parasitica CJ01A1]
Length=772

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  755



>ref|XP_008312357.1| PREDICTED: alpha-N-acetylglucosaminidase [Cynoglossus semilaevis]
Length=752

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/292 (32%), Positives = 136/292 (47%), Gaps = 43/292 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW +L+ +VYNCT     +HN   +V                             RR
Sbjct  499  LSAAWTLLFRSVYNCTIPHYKNHNHSPLV-----------------------------RR  529

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
                + TS       LWY   D+ KA KL + A   L    T+RYDLVD+TRQ+L  L  
Sbjct  530  PSVHMNTS-------LWYDPADLFKAWKLIVEAAPALMSRETFRYDLVDVTRQALQVLTT  582

Query  524  QVYLDSIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D + AF   K ++ L+        L+ ++  LL +D   LLGTWLE A+S   +  
Sbjct  583  SFYQDIVGAFQKQKISELLAAGGVLIYDLLPELSRLLNSDRNFLLGTWLEQARSQALDEG  642

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR Q+T+W  +      ++ DYA+K W GL+E YY  R  ++ + L   L+ 
Sbjct  643  EAQLYDINARNQLTLWGPS-----GEILDYASKEWGGLMEDYYAQRWGLFVHMLVECLDS  697

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS*GLE  12
               FK + + +      + +   S  YP K QGD   IA  ++ KY+   LE
Sbjct  698  GRPFKQDTFNQAVFQVEKGFVYNSRRYPTKPQGDTYEIALRIFLKYYPQALE  749



>gb|ETM47209.1| hypothetical protein L914_08097 [Phytophthora parasitica]
Length=772

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  755



>gb|ETK87395.1| hypothetical protein L915_08211 [Phytophthora parasitica]
 gb|ETL40812.1| hypothetical protein L916_08135 [Phytophthora parasitica]
Length=772

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  755



>ref|XP_006125827.1| PREDICTED: alpha-N-acetylglucosaminidase, partial [Pelodiscus 
sinensis]
Length=614

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 129/283 (46%), Gaps = 42/283 (15%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
            AW++L  + YNC+    DHN   +V  P                        H       
Sbjct  361  AWQLLLRSAYNCSGLCVDHNHSPLVRRPS----------------------LHM------  392

Query  692  LETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYL  513
                     P LWY+  DV +A +L L A  EL  S TYRYDLVD+TRQ+  +L +  YL
Sbjct  393  --------APQLWYNQSDVYEAWRLLLGAAGELGASPTYRYDLVDVTRQAAQQLVSDYYL  444

Query  512  DSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQ  336
            +   AF      + L+        L+ ++D LLA+D   LLG WLE A++   ++ E + 
Sbjct  445  EIQRAFQKGALPELLTAGGVLIYDLLPELDSLLASDGHFLLGRWLEQARATAASAKEAEL  504

Query  335  YEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEF  156
            Y+ +AR QVT+W          + DYANK   GL+  YY  R S++ + L  SL   + F
Sbjct  505  YDRDARNQVTLWGPN-----GNILDYANKQLGGLVLDYYRVRWSLFVSALVESLTSGIPF  559

Query  155  KVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              E++ +        +    + YP +  GD L I   ++ KY+
Sbjct  560  HQEKFNQAVFQVERGFIYNGKRYPTQPAGDTLEIVRRIFLKYY  602



>ref|XP_008905154.1| hypothetical protein PPTG_11754 [Phytophthora parasitica INRA-310]
 gb|ETN09321.1| hypothetical protein PPTG_11754 [Phytophthora parasitica INRA-310]
Length=772

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 136/291 (47%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A++L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARALAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  755



>ref|XP_008147571.1| PREDICTED: alpha-N-acetylglucosaminidase [Eptesicus fuscus]
Length=744

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 144/287 (50%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V  P                             
Sbjct  492  EAAWRLLLRSVYNCSGEACSGHNRSPLVRRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+  +++     WY+  DV +A +L L A   LA S ++RYDLVDLTRQ++ +L + 
Sbjct  524  ---LQMVTTV-----WYNRSDVFEAWRLLLTASPTLATSPSFRYDLVDLTRQAVQELVSL  575

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y +   A+ NK+   L + +   L  +L+  +D +LA+D   LLG+WLE A++   +  
Sbjct  576  YYEEVRTAYLNKELVPL-LRAAGILAYELLPSLDSILASDSHFLLGSWLEQARAAAVSEA  634

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E   YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL +
Sbjct  635  EAHFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYAPRWRLFLETLVDSLVQ  689

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               F+  ++ K+ +   + +   +  YP + QGD + +A  L+ KY+
Sbjct  690  GTPFQQHQFEKQALQLEQTFALSTRRYPSQPQGDTVGLAKKLFLKYY  736



>ref|XP_004655806.1| PREDICTED: alpha-N-acetylglucosaminidase [Jaculus jaculus]
Length=744

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 146/291 (50%), Gaps = 45/291 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ D    HN   +V+ P                             
Sbjct  492  EAAWRLLLRSVYNCSGDACRGHNHSPLVKRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DV +A +L L A   L  S  +RYDL+D+TRQ++ +L + 
Sbjct  524  ---LQMNTTV-----WYNRSDVFEAWRLLLTAAPNLTNSPAFRYDLLDVTRQAVQELVSL  575

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y +  AA+ NKD   L + +   L  +L+  +DV+LA+D   LLG+WL+ A ++  +  
Sbjct  576  YYEEVKAAYMNKDLVPL-LRAGGLLAYELLPALDVVLASDSHFLLGSWLDQAWAVAVSEA  634

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L+ SL +
Sbjct  635  EAQLYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYQPRWCLFLEVLAHSLAQ  689

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYFS*GL  15
             + F+  ++ K      + +  G   YP + QGD + +A  ++ KY   G+
Sbjct  690  GIPFQQHQFDKNVFPLEQAFVLGKRRYPSQPQGDTVDLAKKIFLKYSPRGI  740



>gb|ETL93946.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETO76172.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=684

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 135/291 (46%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A+ L E+   
Sbjct  500  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARVLAEDIET  559

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  560  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  617  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  667



>ref|XP_001081442.1| PREDICTED: alpha-N-acetylglucosaminidase [Rattus norvegicus]
 ref|XP_002727861.2| PREDICTED: alpha-N-acetylglucosaminidase [Rattus norvegicus]
 gb|EDM06079.1| rCG33377, isoform CRA_b [Rattus norvegicus]
Length=739

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/285 (29%), Positives = 145/285 (51%), Gaps = 45/285 (16%)
 Frame = -1

Query  875  AAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            AAW +L  +VYNC+ +  + HN+  +V+ P                              
Sbjct  490  AAWRLLLRSVYNCSGEACSGHNRSPLVKRPS-----------------------------  520

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQV  519
              L+ S+++     WY+  DV +A +L L A   L  S  +RYDL+D+TRQ++ +L +  
Sbjct  521  --LQMSTAV-----WYNRSDVFEAWRLLLRAAPNLTASPAFRYDLLDVTRQAVQELVSSC  573

Query  518  YLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
            Y ++  AF N+D   L + +   L  +L+  +D LLA++   LLGTWL+ A+ +  + +E
Sbjct  574  YEEARTAFLNQDLDLL-LRAGGLLTYKLLPSLDELLASNSHFLLGTWLDQAREVAVSESE  632

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L+ SL   
Sbjct  633  AQFYEQNSRYQITLWGP-----EGNILDYANKQLAGLVADYYQPRWCLFLGTLAHSLARG  687

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            + F+  ++ K      + +    + YP++ QGD + ++  ++ K+
Sbjct  688  IPFQQHQFEKSVFPLEQAFINNKKRYPIQPQGDTVDLSKKIFLKF  732



>ref|XP_007899764.1| PREDICTED: alpha-N-acetylglucosaminidase [Callorhinchus milii]
Length=776

 Score =   135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 90/283 (32%), Positives = 137/283 (48%), Gaps = 42/283 (15%)
 Frame = -1

Query  875  AAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFF  696
            AAW++L  +VYNCT  + +HN+  +V  P                               
Sbjct  515  AAWQLLLRSVYNCTVYMKNHNRSPLVHKPSLS----------------------------  546

Query  695  LLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVY  516
             L TS       LWY+  DV +A     AA ++L  S T++YDL+D+TRQS+  L +  Y
Sbjct  547  -LNTS-------LWYTKTDVYEAWSQMQAAASDLLTSETFKYDLIDVTRQSVQLLVSDFY  598

Query  515  LD-SIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETK  339
             D  +A F N   + L+        L+ ++D LL++D   +LG WLESA+SL     E  
Sbjct  599  EDLKVAFFNNSLEELLTTGGVLVSDLLPELDSLLSSDRHFMLGRWLESARSLGTGEKEAD  658

Query  338  QYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVE  159
             YE+NAR+QVT+W       +  L DYANK W GL+  YY  R  ++ + L+  LN  + 
Sbjct  659  LYEFNARSQVTLWGP-----EGNLLDYANKEWGGLVNDYYTVRWYLFVSTLAECLNSGIP  713

Query  158  FKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            F   ++ +      + +    + YP +  G+   IA  L++KY
Sbjct  714  FHQHQFDQIAFQAEQGFILNKKKYPDQPTGNTFEIAKRLFRKY  756



>ref|XP_003978574.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Takifugu rubripes]
Length=751

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 135/287 (47%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            V AAW+IL+ +VYNCT     +HN   +V  P +              H  +        
Sbjct  499  VSAAWKILFASVYNCTLPHYRNHNHSPLVRRPSF--------------HMNS--------  536

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
                           LWY   D+ +A KL L A        T++YDLVD+TRQ +  L  
Sbjct  537  --------------ELWYDPADLYRAWKLILEAAPSFMSKETFQYDLVDVTRQVMQVLTT  582

Query  524  QVYLDSIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D + AF  +K  + L+        L+ +++ LL+++   LLGTWLE A+SL  +  
Sbjct  583  SYYQDIVDAFQKHKMQELLTAGGVLLYDLLPELNRLLSSNHNFLLGTWLEQARSLALDER  642

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E K Y+ NAR Q+T+W  +      ++ DYANK W GL++ YY  R  ++ + L   L+ 
Sbjct  643  EAKLYDINARNQLTLWGPS-----GEILDYANKQWGGLMQDYYAQRWGLFIHTLVECLDS  697

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               FK + + K      + +      YP K QGD   IA+ ++ KY+
Sbjct  698  GQPFKQDNFNKVVFQVEKGFIYNRRQYPTKPQGDTFEIAHRIFLKYY  744



>gb|ETL93945.1| hypothetical protein L917_08033 [Phytophthora parasitica]
 gb|ETO76171.1| hypothetical protein F444_08438 [Phytophthora parasitica P1976]
Length=772

 Score =   135 bits (340),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 93/291 (32%), Positives = 135/291 (46%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  +   P W                       +  R 
Sbjct  498  ERAWGFLLQSVYNRTLGFGGVTKSLVCLIPHW-----------------------KLVRD  534

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   DV +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  535  GFMPTSIT-------YDPMDVTRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  587

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTEN---  354
             + L  +     + A  +   +++ L  I+ +D +LA ++  LLG W+  A+ L E+   
Sbjct  588  YLQLKDMYEGRKRPADQVCAWTERMLITIERLDEILATNEDFLLGNWIADARVLAEDIET  647

Query  353  ---SNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
               SN    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+F  + 
Sbjct  648  IDSSNLQDYYEYEARNQVTRWGDNNS---EAIHDYAGKEWAGLVKGYYLPRWRMWFGEVC  704

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +S  +  +   +  +K  IAF  KWQ   E YP    GD L ++  +Y ++
Sbjct  705  QSYTQGRKINKDVVKKARIAFELKWQLSREPYPTTTVGDTLIVSQRIYDEF  755



>ref|XP_005429681.1| PREDICTED: alpha-N-acetylglucosaminidase [Geospiza fortis]
Length=528

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/282 (31%), Positives = 134/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W +L  +VYNCT    +HN+  +V                             RR    +
Sbjct  276  WRLLLRSVYNCTGVCVNHNRSPLV-----------------------------RRPSLRM  306

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        LWY+  DV +A +L L+AG EL  S  + YDLVD+TRQ+  +L +  YL 
Sbjct  307  DT-------ELWYNASDVYEAWRLLLSAGAELGSSPAFLYDLVDVTRQAAQQLVSDYYLS  359

Query  509  SIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF ++   + L+        L+ ++D LL +    LLG WLESA+++  +  E +QY
Sbjct  360  IRQAFQSHALPELLTAGGVLVYDLLPELDSLLCSHSLFLLGRWLESARAVATSGREAEQY  419

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR QVT+W  +       + DYANK   GL+  YY  R S++ + L  SLN +  F 
Sbjct  420  ELNARNQVTLWGPS-----GNILDYANKQLGGLVLDYYAVRWSLFVSVLVESLNSSRPFH  474

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GD + I+  L+ KY+
Sbjct  475  QDQFNQAVFQVERGFIYNKKRYPAVPAGDTMEISRKLFLKYY  516



>gb|KFO97538.1| Alpha-N-acetylglucosaminidase, partial [Calypte anna]
Length=558

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 134/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W +L  + YNCT    +HN+  +V                             RR    +
Sbjct  317  WRLLLRSAYNCTGVCVNHNRSPLV-----------------------------RRPSLHM  347

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        LWY+  DV +A +L L+A  EL  S T+RYDLVD+TRQ+  +L +  YL 
Sbjct  348  DT-------ELWYNASDVYEAWRLLLSASPELGSSPTFRYDLVDVTRQAAQQLVSSYYLS  400

Query  509  SIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF ++   + L+        L+ ++D LL++    LLG WLESA+++  ++ E +QY
Sbjct  401  IRQAFQSHALPELLTAGGVLVYDLLPELDNLLSSHRLFLLGRWLESARAMATSNREAEQY  460

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR QVT+W          + DYANK   GL+  YY  R S++ + L  SLN    F 
Sbjct  461  ELNARNQVTLWGPN-----GNILDYANKQLGGLVLDYYGVRWSLFVSTLVESLNSGTPFH  515

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GD L I+  L+ KY+
Sbjct  516  QDQFNQAVFQVERGFIYNQKRYPAVPAGDTLEISRKLFLKYY  557



>ref|XP_008504015.1| PREDICTED: alpha-N-acetylglucosaminidase [Calypte anna]
Length=572

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 134/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W +L  + YNCT    +HN+  +V                             RR    +
Sbjct  320  WRLLLRSAYNCTGVCVNHNRSPLV-----------------------------RRPSLHM  350

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        LWY+  DV +A +L L+A  EL  S T+RYDLVD+TRQ+  +L +  YL 
Sbjct  351  DT-------ELWYNASDVYEAWRLLLSASPELGSSPTFRYDLVDVTRQAAQQLVSSYYLS  403

Query  509  SIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF ++   + L+        L+ ++D LL++    LLG WLESA+++  ++ E +QY
Sbjct  404  IRQAFQSHALPELLTAGGVLVYDLLPELDNLLSSHRLFLLGRWLESARAMATSNREAEQY  463

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR QVT+W          + DYANK   GL+  YY  R S++ + L  SLN    F 
Sbjct  464  ELNARNQVTLWGPN-----GNILDYANKQLGGLVLDYYGVRWSLFVSTLVESLNSGTPFH  518

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GD L I+  L+ KY+
Sbjct  519  QDQFNQAVFQVERGFIYNQKRYPAVPAGDTLEISRKLFLKYY  560



>gb|KFO72136.1| Alpha-N-acetylglucosaminidase, partial [Cuculus canorus]
Length=607

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 134/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W +L  +VYNCT    +HN+  +V                             RR    +
Sbjct  366  WRLLLRSVYNCTGVCVNHNRSPLV-----------------------------RRPSLHM  396

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        LWY+  DV +A +L L+A  +L  S T+RYDLVD+TRQ+  +L +  YL 
Sbjct  397  DT-------ELWYNASDVYEAWRLLLSASADLGSSPTFRYDLVDVTRQAAQQLVSDYYLS  449

Query  509  SIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF ++   + L+        L+ ++D LL +    LLG WLESA+++  +  E +QY
Sbjct  450  IRQAFQSHALPELLTAGGVLVYDLLPELDNLLCSHSLFLLGRWLESARAVATSDREAEQY  509

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR QVT+W  T       + DYANK   GL+  YY  R S++ + L  SLN    F 
Sbjct  510  ELNARNQVTLWGPT-----GNILDYANKQLGGLVLDYYGVRWSLFVSVLVESLNSGTPFH  564

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GD L I+  L+ KY+
Sbjct  565  QDQFNQAVFQVERGFVYNKKRYPAVPAGDTLEISRKLFLKYY  606



>ref|XP_005950306.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Haplochromis burtoni]
Length=751

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 134/287 (47%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDG-IADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW +L+ ++YNC+D    +HN   +V                             RR
Sbjct  499  LTAAWRLLFASIYNCSDPHYRNHNHSPLV-----------------------------RR  529

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ KA KL + A   L    T+RYDLVD+TR+ L  L  
Sbjct  530  PSFHMNTG-------LWYDPADLYKAWKLIMDAAPSLMSKETFRYDLVDVTREVLQVLTT  582

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF  ++ ++ L+        L+ +++ LL+++   LLGTWLE A+SL  +  
Sbjct  583  SFYRDIADAFKKQNLSELLTAGGVLVYDLLPELNRLLSSNRNFLLGTWLERARSLAVDDK  642

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR Q+T+W  +      ++ DYA+K W GL+E YY  R  ++   L   LN 
Sbjct  643  EAQLYDMNARNQITLWGPS-----GEILDYASKEWGGLMEDYYAQRWGLFVQTLVECLNS  697

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               FK   + +      + +      YP K QGD   IA  ++ KYF
Sbjct  698  GQPFKQAAFNQAVFQIEKGFIYNGRKYPTKPQGDTYEIAYRIFLKYF  744



>ref|XP_004571517.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Maylandia zebra]
 ref|XP_005752738.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Pundamilia nyererei]
Length=751

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 134/287 (47%), Gaps = 43/287 (15%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDG-IADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRR  705
            + AAW +L+ ++YNC+D    +HN   +V                             RR
Sbjct  499  LTAAWRLLFASIYNCSDPHYRNHNHSPLV-----------------------------RR  529

Query  704  RFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLAN  525
              F + T        LWY   D+ KA KL + A   L    T+RYDLVD+TR+ L  L  
Sbjct  530  PSFHMNTG-------LWYDPADLYKAWKLIMDAAPSLMSKETFRYDLVDVTREVLQVLTT  582

Query  524  QVYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
              Y D   AF  ++ ++ L+        L+ +++ LL+++   LLGTWLE A+SL  +  
Sbjct  583  SFYRDIADAFKKQNLSELLTAGGVLVYDLLPELNRLLSSNRNFLLGTWLERARSLAVDDK  642

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + Y+ NAR Q+T+W  +      ++ DYA+K W GL+E YY  R  ++   L   LN 
Sbjct  643  EAQLYDMNARNQITLWGPS-----GEILDYASKEWGGLIEDYYAQRWGLFVQTLVECLNS  697

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
               FK   + +      + +      YP K QGD   IA  ++ KYF
Sbjct  698  GQPFKQAAFNQAVFQIEKGFIYNGRKYPTKPQGDTYEIAYRIFLKYF  744



>ref|XP_007177897.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007177906.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Balaenoptera acutorostrata 
scammoni]
Length=725

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 145/287 (51%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +G + HN+  +V  P                             
Sbjct  473  EAAWRLLLRSVYNCSGEGCSGHNRSPLVRRPS----------------------------  504

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ ++++     WY+  DVL+A +L LAA   LA S  + +DLVD+TRQ++ +L + 
Sbjct  505  ---LQMATAV-----WYNRSDVLEAWRLLLAATPTLATSPAFCHDLVDVTRQAVQELVSL  556

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y ++  A+ NK+   L + +   L  +L+  +D +LA+D   LLG+WLE A+    +  
Sbjct  557  YYEEARTAYLNKELVPL-MRAGGVLAYELLPALDKVLASDSHFLLGSWLERARVAAVSET  615

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL  
Sbjct  616  EARFYEQNSRCQLTLWGP-----EGNILDYANKQLAGLVADYYAPRWRLFMETLVESLVR  670

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + F+  ++ K      + +   +  YP + QGD + +A  L+ KY+
Sbjct  671  GIPFQQHQFDKNAFQLEQTFVLSTRRYPSQPQGDTVDLAKKLFLKYY  717



>ref|XP_785272.3| PREDICTED: alpha-N-acetylglucosaminidase [Strongylocentrotus 
purpuratus]
Length=793

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 128/281 (46%), Gaps = 41/281 (15%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
            AW IL  TVYN T  + DH     V  P                                
Sbjct  511  AWVILKETVYNNTGTLQDHQYAVPVRRP--------------------------------  538

Query  692  LETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYL  513
                S++    +WY    V KA +  L A T+L  S  +RYDLVD+TR  L  LA     
Sbjct  539  ----SNIMTSPVWYDYTKVAKAWEFLLEASTKLGTSPVFRYDLVDVTRNVLQDLAFDFQQ  594

Query  512  DSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
              + +F  ++A A+  +      LI D+D + ++ +  LLGTWLE AKSL  N++E   Y
Sbjct  595  KLMVSFRIRNAGAVGGNGTLLCNLILDMDNITSSHEDWLLGTWLEDAKSLATNNDEESLY  654

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E+NA+ Q+T+W       + ++ DYANK W GLL +YY  R  +Y  +L   +  +  + 
Sbjct  655  EYNAKNQITIWGP-----KEEILDYANKQWGGLLRTYYHRRWQLYVQYLEECIQSHQPYD  709

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
               +         +W    E +P +  GD +AI+ ALY KY
Sbjct  710  QNTFNVRSFVAESEWTHSKEKFPTEPVGDTMAISKALYVKY  750



>ref|WP_022353495.1| hypothetical protein [Bacteroides sp. CAG:875]
 emb|CDD47229.1| putative uncharacterized protein [Bacteroides sp. CAG:875]
Length=721

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 129/285 (45%), Gaps = 32/285 (11%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            V  AW+IL + +YNC                      P G++  +  H   F        
Sbjct  466  VAKAWDILANGIYNC----------------------PFGNNQ-QGTHESIFCGRPSLNN  502

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
            F     +SS  +   +Y       A +L L    +  G+  + YDLVD+ RQSLS     
Sbjct  503  F----QASSWSKMENYYDPTTTEDAARLMLEVADKYKGNNNFEYDLVDIVRQSLSDRGRI  558

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNET  342
            VY  ++A F + D K+ + HSQ+FL ++   D LLA      +G W+E A+SL     E 
Sbjct  559  VYNQTVADFKSFDKKSFAAHSQEFLNILLAQDQLLATRSEFRVGRWIEQARSLGTTPEEK  618

Query  341  KQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENV  162
              YEWNAR Q+T W D        L DYA+K W+G+L+ +Y  R + Y+  L   L+   
Sbjct  619  DLYEWNARVQITTWGDRVCANNGGLRDYAHKEWNGILKDFYYKRWAAYWQTLQDVLDGKP  678

Query  161  EFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              ++     ++ A  E W      YP K +GD + +A  ++ K F
Sbjct  679  MVEL-----DYYAMEEPWTLAHNPYPAKGEGDCITVAKEVFNKVF  718



>ref|XP_007102204.1| PREDICTED: alpha-N-acetylglucosaminidase [Physeter catodon]
Length=744

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 143/287 (50%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +G   HN+  +V  P                             
Sbjct  492  EAAWRLLLRSVYNCSGEGCRGHNRSPLVRRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+  +++     WY+  DVL+A +L L A   LA S  + YDLVD+TRQ++ +L + 
Sbjct  524  ---LQMVTAV-----WYNRSDVLEAWRLLLTATPTLATSPAFCYDLVDVTRQAVQELVSL  575

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y +   A+ NK+   L + +   L  +L+  +D +LA+D   LLG+WLE A+    +  
Sbjct  576  YYEEVRTAYLNKELVPL-MRAGGVLAYELLPALDKVLASDSHFLLGSWLEQARVAAVSET  634

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + YE N+R Q+T+W       +  + DYANK  +GL+E YY PR  ++   L  SL +
Sbjct  635  EARFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVEDYYAPRWRLFMETLVESLVQ  689

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             V F+  ++ K      + +   +  YP + QGD + +A  L+ KY+
Sbjct  690  GVPFQQHQFDKNAFQLEQTFVLSTRRYPSQPQGDTVDLAKKLFLKYY  736



>ref|XP_003724005.1| PREDICTED: uncharacterized protein LOC100893810 [Strongylocentrotus 
purpuratus]
Length=1043

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 129/281 (46%), Gaps = 41/281 (15%)
 Frame = -1

Query  872   AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
             AW IL  TVYN T GI   +KD+    P   PS+ T S                      
Sbjct  767   AWAILQATVYNNT-GI---DKDHQHAVPVVRPSNKTKS----------------------  800

Query  692   LETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYL  513
                        +WY   +V KA    L A   L  S  +RYDLVD+TR  L  LA   Y 
Sbjct  801   ----------VIWYDYTEVAKAWGFLLQASETLGTSSLFRYDLVDVTRNVLQDLAFDFYE  850

Query  512   DSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               + +F  K+  A+  +      LI D+D + ++    LLGTWLE AKSL  N  E   Y
Sbjct  851   QIMVSFHAKNITAIRGNGTLLCNLILDMDNITSSHQDWLLGTWLEDAKSLATNHKEESLY  910

Query  332   EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
             E+NAR Q+T+W    +++     DYANK W GLL SYY  R  ++   L   +  +V + 
Sbjct  911   EYNARNQITVWGPRGEHL-----DYANKQWGGLLRSYYYNRWQLFVQFLDGCIELHVPYD  965

Query  152   VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
               ++         +W   +E +P K  GD ++I+ ALY KY
Sbjct  966   QSKFDMRSFIMETEWTNSTEKFPTKPVGDTVSISRALYSKY  1006



>ref|XP_011162675.1| PREDICTED: alpha-N-acetylglucosaminidase [Solenopsis invicta]
Length=820

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 125/236 (53%), Gaps = 7/236 (3%)
 Frame = -1

Query  728  FVLTHQRRRFFLLETSSSLP-QPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLT  552
            FV T + R  +++    SL   P +WY  +      ++FL A      +  YR+D+VD+T
Sbjct  538  FVGTEKIRGHYVITRRPSLNISPWIWYERQLFYGMWEVFLTARYGRGNNTLYRHDVVDIT  597

Query  551  RQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA  372
            RQ+L  +A+ +Y+  +  +  KD  A    +   L+L  D++ +LA+    LLGTWL  A
Sbjct  598  RQALQLMADDIYITILDCYKKKDITAFRSSANALLELFDDLESILASGSNFLLGTWLTQA  657

Query  371  KSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFN  192
            K + +N  E + YE+NAR Q+T+W         ++ DYANK WSG++  Y+ PR  ++  
Sbjct  658  KEMADNEEERRSYEYNARNQITLWGP-----NGEIRDYANKQWSGVVADYFKPRWELFLK  712

Query  191  HLSRSLNENVEFKVEEWR-KEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             L +SL E       E   + +    + +   ++LYP +A+GD + IA  L  K++
Sbjct  713  ALEKSLIERTNLNTTEINDRIFREVEQPFTFSTKLYPTEAKGDPIDIAVKLIAKWY  768



>ref|XP_009553768.1| PREDICTED: alpha-N-acetylglucosaminidase [Cuculus canorus]
Length=709

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 134/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W +L  +VYNCT    +HN+  +V                             RR    +
Sbjct  457  WRLLLRSVYNCTGVCVNHNRSPLV-----------------------------RRPSLHM  487

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        LWY+  DV +A +L L+A  +L  S T+RYDLVD+TRQ+  +L +  YL 
Sbjct  488  DT-------ELWYNASDVYEAWRLLLSASADLGSSPTFRYDLVDVTRQAAQQLVSDYYLS  540

Query  509  SIAAF-TNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF ++   + L+        L+ ++D LL +    LLG WLESA+++  +  E +QY
Sbjct  541  IRQAFQSHALPELLTAGGVLVYDLLPELDNLLCSHSLFLLGRWLESARAVATSDREAEQY  600

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR QVT+W  T       + DYANK   GL+  YY  R S++ + L  SLN    F 
Sbjct  601  ELNARNQVTLWGPT-----GNILDYANKQLGGLVLDYYGVRWSLFVSVLVESLNSGTPFH  655

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GD L I+  L+ KY+
Sbjct  656  QDQFNQAVFQVERGFVYNKKRYPAVPAGDTLEISRKLFLKYY  697



>ref|WP_029284353.1| alpha-N-acetylglucosaminidase [Pedobacter sp. R20-19]
Length=736

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 115/208 (55%), Gaps = 4/208 (2%)
 Frame = -1

Query  653  YSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKA  474
            Y   D+L A   F+ A      S  ++YD+VD+TRQ ++  A  V    + A+  KD+K 
Sbjct  524  YEERDLLPAWDEFIKAAPTCKQSDGFQYDIVDVTRQVMANYALSVQRKVVDAYKKKDSKR  583

Query  473  LSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFD  294
                SQ F+QLI D+D LLA     LLG W+  A+    N+ E   YE NA+  +T+W D
Sbjct  584  FQTESQNFIQLITDMDKLLATRKDFLLGPWVSEARKWGTNAEEKALYEMNAKDLITLWGD  643

Query  293  TTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSE  114
                 ++ L++YA + WSGLL  +Y PR  ++FNH ++SLNE   F ++++ +E   +  
Sbjct  644  ----AKNPLNEYACRQWSGLLNDFYKPRWELFFNHAAQSLNEKTTFDLKKFNEEVSEWEW  699

Query  113  KWQRGSELYPVKAQGDALAIANALYQKY  30
            KW    + Y V+  G+ +  +  +YQKY
Sbjct  700  KWVNQRKDYSVQPIGNPVNTSIKMYQKY  727



>ref|XP_002902563.1| alpha-N-acetylglucosaminidase (NAGLU), putative [Phytophthora 
infestans T30-4]
 gb|EEY56489.1| alpha-N-acetylglucosaminidase (NAGLU), putative [Phytophthora 
infestans T30-4]
Length=684

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 135/291 (46%), Gaps = 41/291 (14%)
 Frame = -1

Query  878  EAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRF  699
            E AW  L  +VYN T G     K  I   P W                       +  R 
Sbjct  410  ERAWGFLLQSVYNRTLGFGGVTKSLICLIPHW-----------------------KLVRD  446

Query  698  FLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSK--LAN  525
              + TS +       Y   D+ +A K  L AG+EL    TYR+DLVD+TRQ LS   +A 
Sbjct  447  GFMPTSIT-------YDPMDITRAWKELLLAGSELHAVDTYRHDLVDVTRQFLSDHFMAQ  499

Query  524  QVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS--  351
             ++L  +     + A  L   +++ L  I+ +D +LA ++  LLG W+  A++L E S  
Sbjct  500  YLHLKEMYEGKTQPAHQLCAWTERMLLTIERMDEILATNEDSLLGNWIADARALAEESES  559

Query  350  ----NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLS  183
                N    YE+ AR QVT W D        +HDYA K W+GL++ YYLPR  M+   + 
Sbjct  560  IESSNLQDYYEYEARNQVTRWGDNNS---ETIHDYAGKEWAGLVKGYYLPRWRMWLGEVC  616

Query  182  RSLNENVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            ++  +      E  +K  IAF  KWQ   E YP    GDAL ++  +Y ++
Sbjct  617  QAYTQGRTINKEVVKKARIAFELKWQLSHEHYPTTTVGDALVVSQRIYDEF  667



>gb|EKC30145.1| Alpha-N-acetylglucosaminidase [Crassostrea gigas]
Length=859

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 148/299 (49%), Gaps = 35/299 (12%)
 Frame = -1

Query  881  VEAAWEILYHTVYNCTDGIADHNKDYIVEFPDWDPS-DP---------TGSDMPENDHTK  732
            ++ AW+ L ++VYN +D + DH+ + I   PD  PS  P           +D   ++   
Sbjct  523  IDLAWQYLKNSVYNNSDNLKDHDSNAI---PDHRPSLSPALHPDLGIYNNTDYLHDNSIN  579

Query  731  AFVLTHQRRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLT  552
              V T        L   + L Q  +WY+ ED+  A  +      E + S  + YD+VD+T
Sbjct  580  IIVTT--------LPRMTPLIQQDVWYNPEDLYVAWDIMTLNLDEFSNSSLFMYDIVDVT  631

Query  551  RQSLSKLANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESA  372
            R SL  L+ + Y D + AF   D  A+  H  + L L+ D+D +L +D   LLG W+++A
Sbjct  632  RNSLQILSIKYYTDLVYAFGRGDIHAVESHGNQLLGLLSDMDTVLGSDSHFLLGRWIKAA  691

Query  371  KSLTENSNETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFN  192
                 +  +    ++NAR Q+T+W       + ++ DYA K WSGL++ YYLPR  ++ N
Sbjct  692  TDNAMDMQDNWFLQFNARNQITLWGP-----RGEIRDYACKQWSGLIKDYYLPRWEIFVN  746

Query  191  HLSRSLNEN-----VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            +    +  N      E  +  + K    FS +  +    YP + QGD++AI  +L++KY
Sbjct  747  YTLDIMAHNKTYNATELDIMIYEKVEFPFSYRLDQ----YPTEPQGDSVAIVKSLHKKY  801



>ref|XP_007424968.1| PREDICTED: alpha-N-acetylglucosaminidase [Python bivittatus]
Length=760

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 136/283 (48%), Gaps = 42/283 (15%)
 Frame = -1

Query  872  AWEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFL  693
            AW++L+ +VYNC+    +HN   +V                             RR  F 
Sbjct  507  AWQLLFQSVYNCSGPCVNHNHSPLV-----------------------------RRPSFR  537

Query  692  LETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYL  513
            + T        LWY+  DV +A +LF  +  EL  S T+ YDLVD+ RQ+L +L +  YL
Sbjct  538  MNT-------ELWYNKSDVYEAWQLFQNSSGELGNSSTFCYDLVDVVRQALQQLVSDYYL  590

Query  512  DSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQ  336
            +   AF  +    L +     +  L+ ++D LL++D   LLG+WLE+A  +  +  E + 
Sbjct  591  EIKQAFQRRVLSQLLITGGVLIYDLLPELDSLLSSDRHFLLGSWLEAAHKIATSKKEEQL  650

Query  335  YEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEF  156
            Y++NAR Q+T+W          + DYANK   GL+  YY  R +++   L + LN    F
Sbjct  651  YDFNARNQLTLWGP-----DGNILDYANKQLGGLMLDYYRTRWNLFIITLVKCLNSGTPF  705

Query  155  KVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              +++ +  I     +    + YP KA G+ L IA  ++ KY+
Sbjct  706  HQDQFNQAVIKVERGFIYNGKQYPTKATGNTLEIATKIFLKYY  748



>ref|XP_006992969.1| PREDICTED: alpha-N-acetylglucosaminidase [Peromyscus maniculatus 
bairdii]
Length=739

 Score =   133 bits (335),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 143/285 (50%), Gaps = 43/285 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V+ P                             
Sbjct  489  EAAWRLLLRSVYNCSGETCSGHNRSPLVKRPS----------------------------  520

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ S+++     WY+  D+ +A +L L A   L  S  +RYDL+D+TRQ++ +L + 
Sbjct  521  ---LQMSTTV-----WYNRSDLFEAWRLLLTAAPNLTASPAFRYDLLDVTRQAVQELVSL  572

Query  521  VYLDSIAAFTNKDAKALSVHSQKFLQ-LIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y ++  A+ NK+   L     +    L+  +D LLA+D   LLG+WL+ A+++  +  E
Sbjct  573  CYEEARTAYLNKELDLLLRAGGRLAHMLLPALDELLASDSRFLLGSWLDQARAVAVSEAE  632

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L+ SL   
Sbjct  633  AQFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYQPRWGLFMETLAHSLASG  687

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            V F+  ++ K+     + +    + YP + QGD + +A  ++ KY
Sbjct  688  VPFQQRKFEKDVFPLEQAFVINKKRYPSQPQGDTVDLAKKIFLKY  732



>ref|XP_548088.2| PREDICTED: alpha-N-acetylglucosaminidase [Canis lupus familiaris]
Length=747

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 141/286 (49%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V  P                             
Sbjct  492  EAAWRLLLRSVYNCSGEACSGHNRSPLVRRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+  +++     WY+  DV +A +L L A   LA S T+RYDL+D+TRQ+  +L + 
Sbjct  524  ---LQMVTTV-----WYNRSDVFEAWRLLLTAAPTLASSPTFRYDLLDVTRQAAQELVSL  575

Query  521  VYLDSIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y+++ +A+  K+    L        +L+  +D +LA+D   LLG WLE A++   +  E
Sbjct  576  YYVEARSAYLRKELVPLLRAAGVLVYELLPALDKVLASDSRFLLGRWLEQARAAAVSEAE  635

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
               YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL + 
Sbjct  636  AHLYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYTPRWRLFMEMLVESLVQG  690

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
            + F+  ++ K      + +  G++ YP +  GD + +A  L+ KY+
Sbjct  691  IPFQQHQFDKNAFQLEQTFIFGTQRYPSQPDGDTVDLAKKLFIKYY  736



>gb|AAK73654.1| lysosomal alpha-N-acetyl glucosaminidase [Dromaius novaehollandiae]
Length=753

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 135/282 (48%), Gaps = 42/282 (15%)
 Frame = -1

Query  869  WEILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLL  690
            W++L  +VYNCT    +HN+  +V                             RR    +
Sbjct  501  WQLLLRSVYNCTGVCVNHNRSPLV-----------------------------RRPSLRM  531

Query  689  ETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLD  510
            +T        +WY+  DV +A +L L+AG EL  S T+ YDL D+TRQ+  +L ++ YL 
Sbjct  532  DT-------EVWYNKSDVYEAWRLLLSAGAELGSSPTFGYDLADVTRQAAQQLVSEYYLS  584

Query  509  SIAAFTNKD-AKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQY  333
               AF ++   + L+        L+ ++D LL++    LLG WLESA+++  +  E +QY
Sbjct  585  IRQAFQSRSLPELLTAGGVLVYDLLPELDGLLSSHRLFLLGRWLESARAVATSDREAEQY  644

Query  332  EWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFK  153
            E NAR QVT+W          + DYANK   GL+  YY  R S++ + L  SLN    F 
Sbjct  645  ELNARNQVTLWGPN-----GNILDYANKQLGGLVLDYYGVRWSLFVSALVESLNSGSPFH  699

Query  152  VEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             +++ +        +    + YP    GD L I+  ++ KY+
Sbjct  700  QDQFNQAVFQVERGFIYNKKRYPTAPVGDTLEISKKIFLKYY  741



>ref|WP_015809205.1| alpha-N-acetylglucosaminidase [Pedobacter heparinus]
 gb|ACU05596.1| Alpha-N-acetylglucosaminidase [Pedobacter heparinus DSM 2366]
Length=734

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 118/211 (56%), Gaps = 10/211 (5%)
 Frame = -1

Query  653  YSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKA  474
            YS+++++KA    L A  EL  S  ++YDLVD+TRQ L+  AN +  D  +++  KD   
Sbjct  515  YSSKELMKAWSYLLTASDELKSSDGFQYDLVDVTRQVLANYANVLQQDFASSYKQKDMAT  574

Query  473  LSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWFD  294
             +  S +FL+LI DID LL      LLG W+ +AK+L +N  E K +E NAR  +T+W D
Sbjct  575  FNKKSAQFLELIDDIDQLLGTRSDFLLGKWINNAKALGDNPAEKKLFERNARDLITLWLD  634

Query  293  TTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHL---SRSLNENVEFKVEEWRKEWIA  123
                    +H+YA K W+G+++ +Y PR   +F+ +   + +  E  + K E   K+W  
Sbjct  635  K----DCNIHEYACKEWAGMMKGFYKPRWQQFFDEVRLQASAGKEIDQIKFENTIKDW--  688

Query  122  FSEKWQRGSELYPVKAQGDALAIANALYQKY  30
               KW   +E Y  K  G+ + +A ALY KY
Sbjct  689  -EWKWVNANEAYTDKPTGNPVTVAKALYAKY  718



>ref|XP_005070217.1| PREDICTED: alpha-N-acetylglucosaminidase [Mesocricetus auratus]
Length=739

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/285 (30%), Positives = 141/285 (49%), Gaps = 43/285 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +  + HN+  +V+ P                             
Sbjct  489  EAAWRLLLRSVYNCSGEMCSGHNRSPLVKRPS----------------------------  520

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ S+++     WY+  DV +A +L L A   L  S  +RYDL+D+TRQ++ +L + 
Sbjct  521  ---LQISTTI-----WYNRSDVFEAWRLLLTAAPNLTVSAAFRYDLLDVTRQAVQELVSL  572

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL-QLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y ++  AF  K+   L         +L+  +D LLA+D   LLGTWL+ A+++  +  E
Sbjct  573  CYEEARTAFLKKELDLLLRAGGLLAYKLLPALDELLASDSRFLLGTWLDQARAVAVSEAE  632

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
             + YE N+R Q+T+W          + DYANK  +GL+ +YY PR  ++   L+ SL   
Sbjct  633  AQFYEQNSRYQLTLWGPG-----GNILDYANKQLAGLVSNYYQPRWGLFMETLTHSLARG  687

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKY  30
            + F+  E+ K      + +    + YP + QGD + +A  ++ KY
Sbjct  688  IPFEQHEFEKNVFPLEQAFVINKKRYPSQPQGDTVDLAKKIFLKY  732



>ref|XP_005111892.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Aplysia californica]
Length=792

 Score =   132 bits (333),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 134/279 (48%), Gaps = 42/279 (15%)
 Frame = -1

Query  863  ILYHTVYNCTDGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRRFFLLET  684
            I+  TVYNC+DG   H+ D                                  R FL   
Sbjct  494  IMQGTVYNCSDG--HHDND----------------------------------RVFLTRR  517

Query  683  SSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSI  504
             S+     +WY   D+  A + F+ A  +LAGS  ++YD+ D+TR SL  ++   Y D +
Sbjct  518  PSTKNSYSIWYKPRDLFLAWEGFVNASNDLAGSQLFQYDITDVTRNSLQIISLYYYFDMM  577

Query  503  AAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWN  324
            +AF   D+  +     K   L+ D+D +L+A+D  L+G W+  AKS   +++ETK  E+N
Sbjct  578  SAFQKNDSAGVQAAGVKMSGLLADMDHVLSANDRFLVGGWIADAKSWATDADETKLLEYN  637

Query  323  ARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEE  144
            AR Q+T+W    + V     DYA+K W+G++  YY PR   +   L++ +     F    
Sbjct  638  ARNQITLWGPDGEIV-----DYASKQWAGVVADYYKPRWEFFSTWLTQLIKNGSRFDGYI  692

Query  143  WRKEWIAFSE-KWQRGSELYPVKAQGDALAIANALYQKY  30
            + K  +A  E  W   +  YP +  GDA+AI+ AL  KY
Sbjct  693  FNKNVMAQVETPWTVSTYPYPTEPTGDAVAISRALLAKY  731



>ref|WP_036890440.1| beta-glucosidase, partial [Prevotella baroniae]
Length=712

 Score =   132 bits (332),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 110/197 (56%), Gaps = 11/197 (6%)
 Frame = -1

Query  632  KALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAKALSVHSQK  453
            +AL LF  A   LA S TYRYDLVDLTRQ ++     VY  ++ A+  KD   L+  S++
Sbjct  522  QALTLFRQAADHLAASATYRYDLVDLTRQVMANHGRTVYRQAMDAYRTKDTLRLAEASRR  581

Query  452  FLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWF--DTTKYV  279
            F+ L+   D LLA D   LLG WL++A++  +N  + +    NARTQ+T W   D T   
Sbjct  582  FVSLVLLQDSLLATDRHFLLGNWLKAAQAYGDNEADRRLSLENARTQITYWGPDDPT---  638

Query  278  QSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFSEKWQRG  99
             +++HDYANK WSGLL  +Y PR + +F+ L+R L        E    ++ A    W + 
Sbjct  639  -TRVHDYANKEWSGLLRDFYAPRWTAFFDGLNRQLRGR-----ETPETDFFAMERAWAKA  692

Query  98   SELYPVKAQGDALAIAN  48
               YP + QGD L + +
Sbjct  693  DNAYPTEPQGDCLKMVD  709



>ref|XP_001366343.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Monodelphis domestica]
Length=741

 Score =   132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 131/286 (46%), Gaps = 43/286 (15%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +    HN   +V+ P                             
Sbjct  489  EAAWRLLLRSVYNCSWENCTGHNHSPLVKRPS----------------------------  520

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+ S       +WY+  DV +A +L L A  +LA S  +RYDL+D+TRQ   +L + 
Sbjct  521  -LHLDFS-------VWYNRSDVFEAWRLLLEAAPQLATSSAFRYDLLDVTRQVAQELVSL  572

Query  521  VYLDSIAAFTNKDAKAL-SVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNE  345
             Y +   AF      AL S        L+  +D LL  D+  LLG WLE A+ +  +  E
Sbjct  573  YYGELKTAFEAGSMPALLSAGGLLVFDLLPSLDELLGTDERFLLGGWLEQAREMAVSEAE  632

Query  344  TKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNEN  165
               YE NAR Q+T+W  T       + DYANK  +GL+  YY PR  ++   L +SL E 
Sbjct  633  AWHYEQNARYQLTLWGPT-----GNILDYANKQLAGLVAGYYAPRWKLFVEMLVKSLAEG  687

Query  164  VEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
              F   ++  E     + +  G E +P + QGD + +A   + KY+
Sbjct  688  TPFHQNQFENEAFLLGQAFVSGREKFPTQPQGDTVDLARKFFLKYY  733



>gb|EPQ13642.1| Alpha-N-acetylglucosaminidase [Myotis brandtii]
Length=587

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 86/287 (30%), Positives = 141/287 (49%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +    HN+  +V  P                             
Sbjct  335  EAAWRLLLRSVYNCSGEACNGHNRSPLVRRPS----------------------------  366

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+  +++     WY+  DV +A +L L A   LA S ++RYDLVDLTRQ++ +L + 
Sbjct  367  ---LQMVTTV-----WYNRSDVFEAWRLLLTATPTLATSPSFRYDLVDLTRQAVQELVSL  418

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y +   A+ NK+   L + +   L  +L+  +D +LA+D   LLG+WL  A++   +  
Sbjct  419  YYEEVRTAYLNKELVPL-LRAAGILAYELLPSLDNILASDSHFLLGSWLAQARAAAVSEA  477

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL  
Sbjct  478  EARFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYTPRWRLFLETLVDSLVR  532

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + F+  ++    +   + +   +  YP   QGDA+ +A  L+ KY+
Sbjct  533  GIPFQQHQFDSHALQLGQTFALSTRRYPSLPQGDAVELAKKLFLKYY  579



>ref|XP_004319191.1| PREDICTED: alpha-N-acetylglucosaminidase [Tursiops truncatus]
Length=744

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 144/287 (50%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +G + HN+  +V  P                             
Sbjct  492  EAAWRLLLRSVYNCSGEGCSGHNRSPLVRRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+  + +     WY+  DVL+A +L L A   LA S  + YDLVD+TRQ++ +L + 
Sbjct  524  ---LQMVTDV-----WYNRSDVLEAWRLLLTATPALASSPAFCYDLVDVTRQAVQELVSL  575

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y     A+ NK+   L + +   L  +L+  +D +LA+D   LLG+WLE A+    +  
Sbjct  576  YYEKVRTAYLNKELVPL-MRAGGVLAYELLPALDKVLASDSHFLLGSWLEQARVAAVSET  634

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L++SL +
Sbjct  635  EARFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYAPRWRLFTETLAKSLVQ  689

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + F+  ++ K      + +   ++ YP + QGD + +A  L+ KY+
Sbjct  690  GIPFQQHQFDKNAFQLEQTFVLSTKRYPSQPQGDTVDLAKKLFLKYY  736



>ref|XP_320760.4| AGAP011750-PA [Anopheles gambiae str. PEST]
 gb|EAA00039.4| AGAP011750-PA [Anopheles gambiae str. PEST]
Length=770

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 124/228 (54%), Gaps = 6/228 (3%)
 Frame = -1

Query  710  RRRFFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKL  531
            R ++      SS  +P  WY      + L+L L+   E + +   +YDLVD TRQ L   
Sbjct  519  RGKYTFNRRPSSKIRPWTWYDVHTFNQGLELLLSFAEEASCNQLCQYDLVDATRQCLQHT  578

Query  530  ANQVYLDSIAAFTNKDAKALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENS  351
            A+ +YL  + +F  +D  +  +HS  FLQL+ D+DVLL  ++  LLG WLESAK+  E +
Sbjct  579  ADALYLTLMDSFKKRDLTSFRLHSSLFLQLLSDLDVLLRTNEHFLLGPWLESAKAHAETT  638

Query  350  NETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLN  171
             E  +YE+NAR Q+T+W       Q ++ DYANK W+G+++ ++LPR  ++   L ++L 
Sbjct  639  LERHKYEYNARIQITLWGP-----QGQIVDYANKQWAGMVQDFFLPRWRVFLGELDQALA  693

Query  170  ENVEFKVEEWRKEWIAFSE-KWQRGSELYPVKAQGDALAIANALYQKY  30
             N      + R +     E  +   S+ Y  +  GD +  A  LY+++
Sbjct  694  TNGTINDLKIRDKIFRTVELPFVSDSKHYATQPSGDTVRTARTLYERW  741



>ref|XP_003488083.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Bombus impatiens]
Length=770

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 116/211 (55%), Gaps = 6/211 (3%)
 Frame = -1

Query  656  WYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQVYLDSIAAFTNKDAK  477
            WY  E       +FL A      S  YR+D+VD+TRQ+L   A+++Y   + +F  KD  
Sbjct  542  WYDPEKFYSTWYIFLQARHGRKNSTLYRHDVVDITRQALQLKADKIYSVLVESFNQKDVT  601

Query  476  ALSVHSQKFLQLIKDIDVLLAADDGCLLGTWLESAKSLTENSNETKQYEWNARTQVTMWF  297
               + + + L+L  D++ +LA+ +  LLGTWLE AK+L  +  E+K YE+NAR Q+T+W 
Sbjct  602  TFKLQAGRLLELFDDLEAILASSEDFLLGTWLEMAKNLATDDAESKLYEYNARNQITLWG  661

Query  296  DTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNENVEFKVEEWRKEWIAFS  117
                  + ++ DYANK WSG++  Y+ PR +++ + L+ SL +     +    +      
Sbjct  662  P-----RGEIRDYANKQWSGIVSDYFKPRWAIFLDGLTTSLTKGTSLNITRINERIFKEV  716

Query  116  EK-WQRGSELYPVKAQGDALAIANALYQKYF  27
            EK +    ++YP  A GD + IA  +  K++
Sbjct  717  EKPFTLSRKIYPTNATGDCIDIAMRILSKWY  747



>ref|XP_007449909.1| PREDICTED: alpha-N-acetylglucosaminidase [Lipotes vexillifer]
Length=744

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 143/287 (50%), Gaps = 45/287 (16%)
 Frame = -1

Query  878  EAAWEILYHTVYNCT-DGIADHNKDYIVEFPDWDPSDPTGSDMPENDHTKAFVLTHQRRR  702
            EAAW +L  +VYNC+ +G + HN+  +V  P                             
Sbjct  492  EAAWRLLLRSVYNCSGEGCSGHNRSPLVRRPS----------------------------  523

Query  701  FFLLETSSSLPQPHLWYSTEDVLKALKLFLAAGTELAGSLTYRYDLVDLTRQSLSKLANQ  522
               L+  + +     WY+  DVL+A +L L A   LA S  + YDLVD+TRQ++ +L + 
Sbjct  524  ---LQMVTDV-----WYNRSDVLEAWRLLLTATPTLATSPAFCYDLVDVTRQAVQELVSL  575

Query  521  VYLDSIAAFTNKDAKALSVHSQKFL--QLIKDIDVLLAADDGCLLGTWLESAKSLTENSN  348
             Y +   A+ NK+   L + +   L  +L+  +D +LA+D   LLG+WLE A+    +  
Sbjct  576  YYEEVRTAYLNKELVPL-MRAGGVLAYELLPALDKVLASDSHFLLGSWLEQARVAAVSET  634

Query  347  ETKQYEWNARTQVTMWFDTTKYVQSKLHDYANKFWSGLLESYYLPRASMYFNHLSRSLNE  168
            E + YE N+R Q+T+W       +  + DYANK  +GL+  YY PR  ++   L  SL +
Sbjct  635  EARFYEQNSRYQLTLWGP-----EGNILDYANKQLAGLVADYYAPRWRLFMETLVESLVQ  689

Query  167  NVEFKVEEWRKEWIAFSEKWQRGSELYPVKAQGDALAIANALYQKYF  27
             + F+  ++ K      + +   ++ YP + QGD + +A  L+ KY+
Sbjct  690  GIPFQQHQFDKNAFQLEQTFVLSTKRYPSQPQGDTVDLAKKLFLKYY  736



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1916371272000