BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051O21

Length=731
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    331   2e-107   Cucumis melo [Oriental melon]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    330   4e-107   Cucumis sativus [cucumbers]
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    329   5e-107   Sesamum indicum [beniseed]
gb|AFK48886.1|  unknown                                                 316   8e-106   Lotus japonicus
gb|KJB14025.1|  hypothetical protein B456_002G107300                    327   8e-106   Gossypium raimondii
gb|KHN21386.1|  Phosphoglycerate kinase, chloroplastic                  315   9e-106   Glycine soja [wild soybean]
gb|KJB14026.1|  hypothetical protein B456_002G107300                    326   1e-105   Gossypium raimondii
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    326   1e-105   Sesamum indicum [beniseed]
gb|KHG01489.1|  hypothetical protein F383_22605                         325   4e-105   Gossypium arboreum [tree cotton]
gb|KDP25067.1|  hypothetical protein JCGZ_22602                         325   4e-105   Jatropha curcas
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    323   2e-104   Fragaria vesca subsp. vesca
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    322   3e-104   Malus domestica [apple tree]
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    322   3e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    322   3e-104   Nicotiana tomentosiformis
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    322   4e-104   Nicotiana sylvestris
sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    322   4e-104   Nicotiana tabacum [American tobacco]
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    322   5e-104   Cicer arietinum [garbanzo]
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    321   8e-104   
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    321   9e-104   
gb|ADR71054.1|  phosphoglycerate kinase                                 320   2e-103   Nicotiana benthamiana
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    320   3e-103   Prunus mume [ume]
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  319   4e-103   Ricinus communis
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             319   5e-103   Citrus clementina [clementine]
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    319   5e-103   Solanum lycopersicum
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    319   5e-103   Glycine max [soybeans]
gb|AAC26785.1|  phosphoglycerate kinase precursor                       319   5e-103   Solanum tuberosum [potatoes]
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   319   5e-103   Citrus sinensis [apfelsine]
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  319   6e-103   Solanum tuberosum [potatoes]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    319   7e-103   
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        319   7e-103   Solanum tuberosum [potatoes]
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    319   8e-103   Phoenix dactylifera
ref|NP_001055937.1|  Os05g0496200                                       308   8e-103   
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    318   9e-103   Eucalyptus grandis [rose gum]
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    319   1e-102   Elaeis guineensis
emb|CBI24182.3|  unnamed protein product                                316   1e-102   Vitis vinifera
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             318   1e-102   Prunus persica
ref|XP_010094703.1|  Phosphoglycerate kinase                            318   1e-102   Morus notabilis
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    318   1e-102   
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    318   2e-102   Phoenix dactylifera
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    317   2e-102   Vitis vinifera
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          317   3e-102   
ref|XP_003596091.1|  Phosphoglycerate kinase                            317   3e-102   Medicago truncatula
gb|ACJ85441.1|  unknown                                                 310   3e-102   Medicago truncatula
gb|EMT12348.1|  Phosphoglycerate kinase, chloroplastic                  313   4e-102   
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                316   8e-102   Erythranthe guttata [common monkey flower]
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   315   2e-101   Helianthus annuus
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    315   3e-101   Elaeis guineensis
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    314   4e-101   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           314   5e-101   
emb|CDP13574.1|  unnamed protein product                                311   5e-101   Coffea canephora [robusta coffee]
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    314   6e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA79705.1|  phosphoglycerate kinase                                 305   7e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             313   7e-101   Phaseolus vulgaris [French bean]
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    311   1e-100   Oryza brachyantha
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  312   1e-100   Triticum urartu
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          313   1e-100   Sorghum bicolor [broomcorn]
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    312   3e-100   Setaria italica
dbj|BAH57185.1|  AT1G79550                                              303   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    312   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  311   6e-100   Genlisea aurea
ref|NP_001117503.1|  phosphoglycerate kinase                            308   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    310   2e-99    Populus euphratica
ref|NP_176015.1|  phosphoglycerate kinase                               309   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             309   4e-99    
gb|ACN32155.1|  unknown                                                 306   6e-99    Zea mays [maize]
gb|AFW78533.1|  phosphoglycerate kinase                                 308   1e-98    
gb|AFW78532.1|  phosphoglycerate kinase                                 308   1e-98    
ref|NP_178073.1|  phosphoglycerate kinase                               305   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             305   2e-98    
ref|XP_006858226.1|  hypothetical protein AMTR_s00062p00189550          307   2e-98    Amborella trichopoda
ref|NP_001147628.1|  phosphoglycerate kinase                            307   2e-98    
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    307   3e-98    
gb|AAM61185.1|  phosphoglycerate kinase, putative                       304   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ABK96267.1|  unknown                                                 306   4e-98    Populus trichocarpa x Populus deltoides
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    306   6e-98    
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    306   6e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    303   7e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    306   8e-98    Tarenaya hassleriana [spider flower]
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             305   1e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             305   1e-97    Populus trichocarpa [western balsam poplar]
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             305   2e-97    Capsella rubella
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      302   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             302   3e-97    
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      301   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    304   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             301   4e-97    Eutrema salsugineum [saltwater cress]
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    303   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    307   9e-97    
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    300   9e-97    Glycine max [soybeans]
gb|AAB60303.1|  phosphoglycerate kinase                                 300   9e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDX67989.1|  BnaA07g20290D                                          298   1e-96    
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    303   1e-96    Camelina sativa [gold-of-pleasure]
emb|CDX87375.1|  BnaA07g34980D                                          300   2e-96    
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      300   2e-96    Fragaria vesca subsp. vesca
ref|NP_187884.1|  phosphoglycerate kinase 1                             302   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             300   2e-96    
gb|KEH15368.1|  phosphoglycerate kinase-like protein                    293   3e-96    Medicago truncatula
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             302   3e-96    Eutrema salsugineum [saltwater cress]
emb|CDX73803.1|  BnaA03g32440D                                          301   3e-96    
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      299   4e-96    Sesamum indicum [beniseed]
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       299   4e-96    Helianthus annuus
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      298   5e-96    
emb|CDY49746.1|  BnaA02g19260D                                          298   5e-96    Brassica napus [oilseed rape]
emb|CDY00798.1|  BnaC03g37820D                                          301   6e-96    
emb|CDX88547.1|  BnaC06g39910D                                          296   6e-96    
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    301   9e-96    Setaria italica
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    298   9e-96    Brassica rapa
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    300   1e-95    Setaria italica
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      298   1e-95    Brassica rapa
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic      298   1e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010094705.1|  Phosphoglycerate kinase                            298   1e-95    Morus notabilis
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  297   1e-95    
gb|KCW71393.1|  hypothetical protein EUGRSUZ_F04463                     295   1e-95    Eucalyptus grandis [rose gum]
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      297   2e-95    Eucalyptus grandis [rose gum]
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                   297   2e-95    Citrus sinensis [apfelsine]
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             298   4e-95    
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic      296   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic      296   5e-95    Nicotiana sylvestris
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic      296   5e-95    Nicotiana tomentosiformis
gb|KJB14020.1|  hypothetical protein B456_002G107200                    294   6e-95    Gossypium raimondii
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic      296   7e-95    Populus euphratica
emb|CDY43401.1|  BnaA01g30320D                                          298   8e-95    Brassica napus [oilseed rape]
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      295   9e-95    
gb|AIZ68220.1|  phosphoglycerate kinase                                 295   1e-94    Ornithogalum longebracteatum [sea-onion]
emb|CDX79326.1|  BnaC06g19770D                                          293   1e-94    
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg             295   1e-94    Citrus clementina [clementine]
emb|CDY70232.1|  BnaC02g46710D                                          295   1e-94    Brassica napus [oilseed rape]
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase             295   1e-94    Pisum sativum [garden pea]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    297   2e-94    Brassica rapa
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic      295   2e-94    Malus domestica [apple tree]
gb|KJB14019.1|  hypothetical protein B456_002G107200                    295   2e-94    Gossypium raimondii
emb|CDY24247.1|  BnaC01g38270D                                          297   2e-94    Brassica napus [oilseed rape]
gb|KDP25066.1|  hypothetical protein JCGZ_22601                         294   2e-94    Jatropha curcas
ref|XP_003596093.1|  Phosphoglycerate kinase                            294   2e-94    Medicago truncatula
gb|AAX57302.1|  putative phospho-glycerate kinase                       288   2e-94    Solanum peruvianum [Peruvian tomato]
gb|ABS19535.1|  CT114                                                   288   2e-94    Solanum chilense
gb|AIZ74346.1|  phosphoglycerate kinase 1                               298   3e-94    Pinus massoniana [Chinese red pine]
emb|CBL95264.1|  phosphoglycerate kinase 1                              298   3e-94    Pinus pinaster [cluster pine]
gb|ABS19537.1|  CT114                                                   288   3e-94    [Lycopersicon] peruvianum var. humifusum
gb|AAX57323.1|  putative phospho-glycerate kinase                       288   3e-94    Solanum habrochaites
gb|ABS19544.1|  CT114                                                   287   4e-94    [Lycopersicon] peruvianum var. humifusum
ref|XP_003596092.1|  Phosphoglycerate kinase                            293   5e-94    Medicago truncatula
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                    293   6e-94    Populus nigra [black poplar]
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    293   7e-94    Elaeis guineensis
gb|AAZ85273.1|  putative phosphoglycerate kinase                        286   8e-94    Solanum chmielewskii
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                294   8e-94    Erythranthe guttata [common monkey flower]
gb|ABS19556.1|  CT114                                                   286   9e-94    [Lycopersicon] peruvianum var. humifusum
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    293   9e-94    Sesamum indicum [beniseed]
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    293   9e-94    
emb|CBI24183.3|  unnamed protein product                                291   1e-93    Vitis vinifera
gb|AAO63774.1|  3-phosphoglycerate kinase                               293   1e-93    Populus tremuloides
gb|ABS19536.1|  CT114                                                   286   1e-93    Solanum chilense
ref|XP_002513352.1|  phosphoglycerate kinase, putative                  292   1e-93    Ricinus communis
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic      292   1e-93    Prunus mume [ume]
gb|ABK92531.1|  unknown                                                 292   1e-93    Populus trichocarpa [western balsam poplar]
gb|ABS19538.1|  CT114                                                   286   2e-93    [Lycopersicon] peruvianum var. humifusum
gb|ACJ11718.1|  phosphoglycerate kinase                                 292   2e-93    Gossypium hirsutum [American cotton]
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            292   2e-93    Solanum tuberosum [potatoes]
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    295   2e-93    Brassica rapa
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg             293   2e-93    
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      292   2e-93    Elaeis guineensis
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    292   2e-93    Nicotiana sylvestris
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      291   2e-93    Vitis vinifera
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    293   3e-93    Spinacia oleracea
gb|AFK46712.1|  unknown                                                 291   3e-93    Medicago truncatula
ref|NP_001167912.1|  phosphoglycerate kinase                            290   3e-93    Zea mays [maize]
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g             291   3e-93    Phaseolus vulgaris [French bean]
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...    291   5e-93    
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic      291   6e-93    Tarenaya hassleriana [spider flower]
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    290   9e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             290   1e-92    
gb|ABS19547.1|  CT114                                                   284   1e-92    [Lycopersicon] peruvianum var. humifusum
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      292   1e-92    Phaseolus vulgaris [French bean]
ref|XP_006858233.1|  hypothetical protein AMTR_s00062p00191350          290   1e-92    Amborella trichopoda
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    290   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP13576.1|  unnamed protein product                                290   2e-92    Coffea canephora [robusta coffee]
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    292   2e-92    Brassica rapa
gb|EEC71648.1|  hypothetical protein OsI_04088                          291   2e-92    Oryza sativa Indica Group [Indian rice]
gb|ABK24564.1|  unknown                                                 292   2e-92    Picea sitchensis
gb|ABB86242.1|  phosphoglycerate kinase-like                            289   3e-92    Solanum tuberosum [potatoes]
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      288   4e-92    Phoenix dactylifera
gb|EPS64076.1|  phosphoglycerate kinase                                 288   5e-92    Genlisea aurea
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    288   6e-92    Cucumis sativus [cucumbers]
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    288   6e-92    Nicotiana tomentosiformis
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      288   7e-92    Cucumis melo [Oriental melon]
gb|ABF69999.1|  phosphoglycerate kinase, putative                       288   9e-92    Musa acuminata [banana]
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    290   1e-91    Populus euphratica
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    287   2e-91    Populus euphratica
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                    287   2e-91    Populus nigra [black poplar]
gb|AGT16255.1|  phosphoglycerate kinase                                 290   2e-91    Saccharum hybrid cultivar R570
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    286   3e-91    Cicer arietinum [garbanzo]
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    285   6e-91    Tarenaya hassleriana [spider flower]
emb|CDP16886.1|  unnamed protein product                                285   7e-91    Coffea canephora [robusta coffee]
dbj|BAJ88371.1|  predicted protein                                      284   1e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      285   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     285   1e-90    Helianthus annuus
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    285   2e-90    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    284   2e-90    Brassica rapa
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      285   3e-90    Tarenaya hassleriana [spider flower]
emb|CDY52872.1|  BnaCnng23600D                                          295   3e-90    Brassica napus [oilseed rape]
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    283   7e-90    Setaria italica
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic      281   2e-89    Phoenix dactylifera
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      280   5e-89    Brachypodium distachyon [annual false brome]
ref|NP_001058317.1|  Os06g0668200                                       280   6e-89    
ref|NP_001142404.1|  uncharacterized protein LOC100274579               279   2e-88    Zea mays [maize]
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116             279   2e-88    Selaginella moellendorffii
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    278   4e-88    Setaria italica
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742              278   4e-88    Selaginella moellendorffii
gb|ABR25550.1|  phosphoglycerate kinase                                 269   2e-87    Oryza sativa Indica Group [Indian rice]
gb|AFW70281.1|  phosphoglycerate kinase                                 281   2e-87    
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                      276   2e-87    
gb|ABR16231.1|  unknown                                                 278   2e-87    Picea sitchensis
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    275   8e-87    Oryza brachyantha
dbj|BAJ85222.1|  predicted protein                                      272   1e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    273   1e-85    Populus euphratica
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    271   2e-85    Oryza brachyantha
ref|WP_015184203.1|  phosphoglycerate kinase                            270   6e-85    Microcoleus sp. PCC 7113
ref|WP_035992253.1|  phosphoglycerate kinase                            270   7e-85    Leptolyngbya sp. KIOST-1
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      273   8e-85    
ref|WP_017300589.1|  phosphoglycerate kinase                            268   2e-84    Nodosilinea nodulosa
ref|NP_001046020.1|  Os02g0169300                                       267   7e-84    
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase              267   9e-84    Synechococcus
gb|AAC32142.1|  phosphoglycerate kinase                                 258   1e-83    Picea mariana [black spruce]
gb|ABI74567.1|  phosphoglycerate kinase                                 267   1e-83    Oryza sativa Indica Group [Indian rice]
dbj|BAA21478.1|  phosphoglycerate kinase                                260   2e-83    Robinia pseudoacacia [black locust]
ref|WP_011242745.1|  phosphoglycerate kinase                            265   4e-83    Synechococcus elongatus
ref|WP_016865730.1|  phosphoglycerate kinase                            265   5e-83    Fischerella muscicola
ref|WP_041032823.1|  phosphoglycerate kinase                            265   6e-83    Tolypothrix campylonemoides
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase              265   7e-83    Lyngbya confervoides
gb|ABI74568.1|  phosphoglycerate kinase                                 265   8e-83    Oryza sativa Indica Group [Indian rice]
ref|WP_029637902.1|  phosphoglycerate kinase [                          264   1e-82    [Scytonema hofmanni] UTEX B 1581
ref|WP_015166011.1|  phosphoglycerate kinase                            264   1e-82    Pseudanabaena sp. PCC 7367
ref|WP_011936642.1|  phosphoglycerate kinase                            264   2e-82    Synechococcus sp. RCC307
ref|WP_026734580.1|  phosphoglycerate kinase                            263   4e-82    Fischerella sp. PCC 9605
ref|WP_016924803.1|  phosphoglycerate kinase                            263   4e-82    Prochlorothrix hollandica
ref|WP_026097925.1|  phosphoglycerate kinase                            263   4e-82    Geitlerinema sp. PCC 7105
gb|KIZ02489.1|  phosphoglycerate kinase                                 255   4e-82    Monoraphidium neglectum
ref|WP_035831895.1|  phosphoglycerate kinase                            263   5e-82    
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase              263   5e-82    Hapalosiphonaceae
ref|WP_006105635.1|  phosphoglycerate kinase                            262   6e-82    Coleofasciculus chthonoplastes
gb|AFH41108.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum aestivum subsp. yunnanense
gb|AFH41121.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum spelta [spelt]
ref|WP_016861411.1|  phosphoglycerate kinase                            262   1e-81    Fischerella muscicola
gb|AFH41102.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum aestivum [Canadian hard winter wheat]
gb|AFH41131.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum turgidum subsp. turanicum
gb|AAM51702.1|AF343476_1  3-phosphoglycerate kinase                     258   1e-81    Triticum dicoccoides [wild emmer wheat]
gb|AAM51700.1|AF343474_1  3-phosphoglycerate kinase                     258   1e-81    Triticum urartu
gb|AFH41091.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum compactum
gb|AID16252.1|  phosphoglycerate kinase                                 258   1e-81    Triticum aestivum subsp. yunnanense
gb|AFH41101.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum aestivum [Canadian hard winter wheat]
gb|AID16262.1|  phosphoglycerate kinase                                 258   1e-81    Triticum petropavlovskyi
gb|AID16255.1|  phosphoglycerate kinase                                 258   1e-81    Triticum petropavlovskyi
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase              261   1e-81    Fischerella thermalis
gb|AFH41130.1|  plastid 3-phosphoglycerate kinase                       258   1e-81    Triticum petropavlovskyi
gb|ACO40269.1|  3-phosphoglycerate kinase                               258   1e-81    Leymus akmolinensis
ref|WP_007099195.1|  phosphoglycerate kinase                            261   1e-81    Synechococcus sp. RS9916
gb|ACO40272.1|  3-phosphoglycerate kinase                               258   1e-81    Leymus secalinus
gb|ACO40271.1|  3-phosphoglycerate kinase                               258   1e-81    Leymus pseudoracemosus
gb|ACO40247.1|  3-phosphoglycerate kinase                               258   1e-81    Psathyrostachys fragilis
ref|WP_017289328.1|  phosphoglycerate kinase                            261   1e-81    Leptolyngbya boryana
gb|ACO40274.1|  3-phosphoglycerate kinase                               258   2e-81    Leymus duthiei
ref|WP_026135280.1|  phosphoglycerate kinase                            261   2e-81    Scytonema hofmannii
gb|AFH41149.1|  plastid 3-phosphoglycerate kinase                       258   2e-81    Triticum timopheevii [Sanduri wheat]
dbj|BAA18521.1|  phosphoglycerate kinase                                260   2e-81    Synechocystis sp. PCC 6803
gb|AFH41081.1|  plastid 3-phosphoglycerate kinase                       258   2e-81    Aegilops tauschii subsp. tauschii x Triticum turgidum subsp. polonicum
ref|WP_039739530.1|  phosphoglycerate kinase                            261   2e-81    
ref|WP_013321558.1|  phosphoglycerate kinase                            261   2e-81    Cyanothece sp. PCC 7822
gb|AEQ59408.1|  3-phosphoglycerate kinase                               258   2e-81    Kengyilia rigidula
gb|AGL91125.1|  3-phosphoglycerate kinase                               258   2e-81    Elymus kamoji
gb|AEQ59380.1|  3-phosphoglycerate kinase                               258   2e-81    Kengyilia hirsuta
gb|AEQ59379.1|  3-phosphoglycerate kinase                               258   2e-81    Kengyilia hirsuta
gb|AEQ59377.1|  3-phosphoglycerate kinase                               258   2e-81    Kengyilia kokonorica
gb|ACO40277.1|  3-phosphoglycerate kinase                               258   2e-81    Leymus arenarius
gb|ACO40261.1|  3-phosphoglycerate kinase                               258   2e-81    Heteranthelium piliferum
gb|ACO40268.1|  3-phosphoglycerate kinase                               258   2e-81    Peridictyon sanctum
gb|AEQ59398.1|  3-phosphoglycerate kinase                               258   2e-81    Kengyilia alatavica
ref|WP_028953033.1|  phosphoglycerate kinase                            261   3e-81    Synechococcus sp. CC9616
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase            261   3e-81    Synechocystis sp. PCC 6803 substr. Kazusa
ref|WP_026719925.1|  phosphoglycerate kinase                            261   3e-81    Fischerella sp. PCC 9431
gb|ACO40256.1|  3-phosphoglycerate kinase                               257   3e-81    
ref|WP_010873144.1|  phosphoglycerate kinase                            261   3e-81    
gb|AFH41088.1|  plastid 3-phosphoglycerate kinase                       257   3e-81    
ref|WP_011827369.1|  phosphoglycerate kinase                            261   3e-81    
gb|AFH41155.1|  plastid 3-phosphoglycerate kinase                       257   3e-81    
ref|WP_026098466.1|  phosphoglycerate kinase                            260   3e-81    
gb|ACO40262.1|  3-phosphoglycerate kinase                               257   3e-81    
ref|WP_038552523.1|  phosphoglycerate kinase                            260   3e-81    
ref|WP_027842190.1|  phosphoglycerate kinase                            260   4e-81    
ref|WP_016873269.1|  phosphoglycerate kinase                            260   5e-81    
gb|AFH41074.1|  plastid 3-phosphoglycerate kinase                       257   5e-81    
ref|WP_028089947.1|  phosphoglycerate kinase                            260   5e-81    
ref|WP_011129182.1|  phosphoglycerate kinase                            260   6e-81    
gb|AFH41104.1|  plastid 3-phosphoglycerate kinase                       256   6e-81    
gb|AFH41099.1|  plastid 3-phosphoglycerate kinase                       256   6e-81    
gb|AFH41137.1|  plastid 3-phosphoglycerate kinase                       256   6e-81    
gb|AEQ59383.1|  3-phosphoglycerate kinase                               256   6e-81    
gb|AEQ59407.1|  3-phosphoglycerate kinase                               256   6e-81    
gb|AEQ59375.1|  3-phosphoglycerate kinase                               256   6e-81    
gb|KIE11439.1|  phosphoglycerate kinase                                 260   6e-81    
gb|AFH41084.1|  plastid 3-phosphoglycerate kinase                       256   7e-81    
gb|AFH41144.1|  plastid 3-phosphoglycerate kinase                       256   7e-81    
gb|AEQ59415.1|  3-phosphoglycerate kinase                               256   8e-81    
ref|WP_011620601.1|  phosphoglycerate kinase                            259   8e-81    
gb|AFH41095.1|  plastid 3-phosphoglycerate kinase                       256   9e-81    
gb|ACO40241.1|  3-phosphoglycerate kinase                               256   9e-81    
gb|ACO40276.1|  3-phosphoglycerate kinase                               256   1e-80    
gb|AGL91123.1|  3-phosphoglycerate kinase                               256   1e-80    
ref|WP_015119342.1|  phosphoglycerate kinase                            259   1e-80    
gb|AGL91113.1|  3-phosphoglycerate kinase                               256   1e-80    
gb|AGL91045.1|  3-phosphoglycerate kinase                               256   1e-80    
gb|ACO40239.1|  3-phosphoglycerate kinase                               256   1e-80    
ref|WP_040940054.1|  phosphoglycerate kinase                            259   1e-80    
ref|WP_011058101.1|  phosphoglycerate kinase                            259   1e-80    
gb|AEQ59378.1|  3-phosphoglycerate kinase                               256   1e-80    
gb|ACO40270.1|  3-phosphoglycerate kinase                               256   1e-80    
ref|WP_017294263.1|  phosphoglycerate kinase                            259   1e-80    
gb|ACO40243.1|  3-phosphoglycerate kinase                               256   1e-80    
gb|AGL91127.1|  3-phosphoglycerate kinase                               256   1e-80    
ref|WP_006528046.1|  phosphoglycerate kinase                            259   1e-80    
gb|AFH41073.1|  plastid 3-phosphoglycerate kinase                       256   1e-80    
gb|ACO40264.1|  3-phosphoglycerate kinase                               256   1e-80    
gb|AEQ59384.1|  3-phosphoglycerate kinase                               255   1e-80    
gb|AID16253.1|  phosphoglycerate kinase                                 255   1e-80    
gb|AFH41140.1|  plastid 3-phosphoglycerate kinase                       255   1e-80    
ref|WP_015149149.1|  phosphoglycerate kinase                            259   2e-80    
gb|AGL91112.1|  3-phosphoglycerate kinase                               255   2e-80    
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase              259   2e-80    
gb|AGL91121.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|ACO40254.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59418.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59412.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AHF64875.1|  Phosphoglycerate kinase                                 259   2e-80    
gb|AEQ59435.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|ACO40255.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59432.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59382.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59427.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59386.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|ACO40259.1|  3-phosphoglycerate kinase                               255   2e-80    
ref|WP_012194769.1|  phosphoglycerate kinase                            258   2e-80    
gb|AID16249.1|  phosphoglycerate kinase                                 255   2e-80    
gb|AEQ59417.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59436.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|ACO40267.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59413.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59422.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AEQ59434.1|  3-phosphoglycerate kinase                               255   2e-80    
ref|WP_028085373.1|  phosphoglycerate kinase                            258   2e-80    
ref|WP_011131470.1|  phosphoglycerate kinase                            258   2e-80    
gb|AID16261.1|  phosphoglycerate kinase                                 255   2e-80    
ref|WP_043693415.1|  phosphoglycerate kinase                            258   2e-80    
gb|ACO40260.1|  3-phosphoglycerate kinase                               255   2e-80    
gb|AAM51708.1|AF343482_1  3-phosphoglycerate kinase                     255   2e-80    
gb|AEQ59403.1|  3-phosphoglycerate kinase                               255   3e-80    
ref|WP_011365387.1|  phosphoglycerate kinase                            258   3e-80    
gb|AGL91108.1|  3-phosphoglycerate kinase                               255   3e-80    
gb|AEQ59402.1|  3-phosphoglycerate kinase                               255   3e-80    
ref|WP_024125258.1|  phosphoglycerate kinase                            258   3e-80    
ref|WP_009628155.1|  phosphoglycerate kinase                            258   3e-80    
gb|ACO40273.1|  3-phosphoglycerate kinase                               254   3e-80    
ref|WP_041765481.1|  phosphoglycerate kinase                            258   3e-80    
gb|ACO40251.1|  3-phosphoglycerate kinase                               254   3e-80    
gb|AAM51720.1|AF343494_1  3-phosphoglycerate kinase                     254   3e-80    
gb|ACO40258.1|  3-phosphoglycerate kinase                               254   3e-80    
ref|WP_015190859.1|  phosphoglycerate kinase                            258   3e-80    
gb|AFH41139.1|  plastid 3-phosphoglycerate kinase                       254   3e-80    
ref|WP_040931032.1|  phosphoglycerate kinase                            258   3e-80    
ref|WP_015218887.1|  phosphoglycerate kinase                            258   3e-80    
gb|AGL91128.1|  3-phosphoglycerate kinase                               254   3e-80    
gb|AGL91103.1|  3-phosphoglycerate kinase                               254   4e-80    
ref|WP_008189591.1|  phosphoglycerate kinase                            258   4e-80    
gb|AID16246.1|  phosphoglycerate kinase                                 254   4e-80    
gb|AGL91104.1|  3-phosphoglycerate kinase                               254   4e-80    
gb|KGG29033.1|  Phosphoglycerate kinase                                 259   4e-80    
gb|ACO40249.1|  3-phosphoglycerate kinase                               254   4e-80    
gb|AFY38465.1|  phosphoglycerate kinase                                 258   5e-80    
gb|ACO40263.1|  3-phosphoglycerate kinase                               254   6e-80    
gb|ACO40266.1|  3-phosphoglycerate kinase                               254   6e-80    
gb|AFH41124.1|  plastid 3-phosphoglycerate kinase                       254   6e-80    
gb|ACO40257.1|  3-phosphoglycerate kinase                               254   7e-80    
gb|AEQ59396.1|  3-phosphoglycerate kinase                               254   7e-80    
gb|AGL91129.1|  3-phosphoglycerate kinase                               254   8e-80    
gb|AEQ59411.1|  3-phosphoglycerate kinase                               253   9e-80    
gb|AGL91124.1|  3-phosphoglycerate kinase                               253   9e-80    
gb|AEQ59399.1|  3-phosphoglycerate kinase                               253   9e-80    
ref|WP_011360883.1|  phosphoglycerate kinase                            257   9e-80    
gb|AEQ59414.1|  3-phosphoglycerate kinase                               253   1e-79    
ref|WP_009788740.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_015167138.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_006042911.1|  phosphoglycerate kinase                            256   1e-79    
ref|WP_015204810.1|  phosphoglycerate kinase                            256   1e-79    
gb|AEQ59420.1|  3-phosphoglycerate kinase                               253   1e-79    
gb|AEQ59421.1|  3-phosphoglycerate kinase                               253   1e-79    
ref|WP_015145174.1|  phosphoglycerate kinase                            256   1e-79    
gb|AFH41106.1|  plastid 3-phosphoglycerate kinase                       253   1e-79    
ref|WP_019502041.1|  phosphoglycerate kinase                            256   2e-79    
gb|AEQ59392.1|  3-phosphoglycerate kinase                               253   2e-79    
gb|AAM51719.1|AF343493_1  3-phosphoglycerate kinase                     253   2e-79    
gb|AEQ59393.1|  3-phosphoglycerate kinase                               252   2e-79    
ref|WP_011934238.1|  phosphoglycerate kinase                            256   2e-79    
ref|WP_015198799.1|  phosphoglycerate kinase                            256   3e-79    
gb|AEQ59430.1|  3-phosphoglycerate kinase                               252   3e-79    
ref|WP_006854064.1|  phosphoglycerate kinase                            255   3e-79    
gb|AEQ59387.1|  3-phosphoglycerate kinase                               252   3e-79    
ref|WP_017323648.1|  phosphoglycerate kinase                            255   3e-79    
ref|WP_019495207.1|  phosphoglycerate kinase                            255   4e-79    
gb|AGL91126.1|  3-phosphoglycerate kinase                               252   4e-79    
gb|AEQ59391.1|  3-phosphoglycerate kinase                               252   4e-79    
ref|WP_017303631.1|  phosphoglycerate kinase                            255   5e-79    
ref|WP_036901530.1|  phosphoglycerate kinase                            255   5e-79    
gb|AEQ59409.1|  3-phosphoglycerate kinase                               251   6e-79    
ref|WP_023076270.1|  phosphoglycerate kinase                            254   7e-79    
ref|WP_006173249.1|  phosphoglycerate kinase                            254   7e-79    
gb|ACO40242.1|  3-phosphoglycerate kinase                               251   8e-79    
gb|AEQ59423.1|  3-phosphoglycerate kinase                               251   9e-79    
gb|AGH55660.1|  phosphoglycerate kinase                                 253   9e-79    
gb|ACO40279.1|  3-phosphoglycerate kinase                               251   1e-78    
ref|WP_028947361.1|  phosphoglycerate kinase                            254   1e-78    
ref|WP_015153171.1|  phosphoglycerate kinase                            254   1e-78    
ref|WP_015785332.1|  MULTISPECIES: phosphoglycerate kinase              254   1e-78    
ref|WP_008234716.1|  phosphoglycerate kinase                            254   1e-78    
ref|YP_002049002.1|  Phosphoglycerate kinase                            253   2e-78    
ref|WP_035157181.1|  phosphoglycerate kinase                            253   2e-78    
gb|ACO40245.1|  3-phosphoglycerate kinase                               249   3e-78    
ref|WP_038547249.1|  phosphoglycerate kinase                            253   3e-78    
gb|AEQ59431.1|  3-phosphoglycerate kinase                               249   3e-78    
ref|WP_012598967.1|  phosphoglycerate kinase                            253   3e-78    
ref|WP_006507734.1|  phosphoglycerate kinase                            253   3e-78    
ref|WP_022604954.1|  phosphoglycerate kinase                            253   4e-78    
ref|WP_039715776.1|  phosphoglycerate kinase                            253   4e-78    
ref|WP_017317549.1|  phosphoglycerate kinase                            252   6e-78    
ref|XP_001699523.1|  phosphoglycerate kinase                            254   7e-78    
ref|WP_009631644.1|  phosphoglycerate kinase                            251   9e-78    
ref|WP_006911676.1|  phosphoglycerate kinase                            251   1e-77    
gb|KGG11463.1|  Phosphoglycerate kinase                                 251   1e-77    
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase              251   2e-77    
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  252   2e-77    
gb|AGL76992.1|  phosphoglycerate kinase                                 249   3e-77    
ref|WP_015193656.1|  phosphoglycerate kinase                            250   3e-77    
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase              250   4e-77    
ref|WP_036916478.1|  MULTISPECIES: phosphoglycerate kinase              250   5e-77    
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                     249   6e-77    
ref|WP_019507461.1|  phosphoglycerate kinase                            248   2e-76    
ref|WP_036484843.1|  phosphoglycerate kinase                            247   4e-76    
ref|WP_030007016.1|  phosphoglycerate kinase                            247   4e-76    
ref|WP_036904641.1|  phosphoglycerate kinase                            247   5e-76    
ref|XP_002951648.1|  phosphoglycerate kinase                            249   5e-76    
ref|WP_026101118.1|  phosphoglycerate kinase                            247   6e-76    
ref|WP_012307199.1|  phosphoglycerate kinase                            247   7e-76    
ref|WP_011823052.1|  phosphoglycerate kinase                            247   7e-76    
ref|WP_011429225.1|  phosphoglycerate kinase                            247   9e-76    
ref|WP_006515662.1|  phosphoglycerate kinase                            246   9e-76    
ref|WP_011294195.1|  phosphoglycerate kinase                            245   2e-75    
ref|WP_009343450.1|  phosphoglycerate kinase                            245   2e-75    
ref|WP_034417079.1|  phosphoglycerate kinase                            245   3e-75    
ref|WP_006278490.1|  phosphoglycerate kinase                            245   3e-75    
ref|WP_027404640.1|  phosphoglycerate kinase                            245   4e-75    
ref|WP_038650981.1|  phosphoglycerate kinase                            245   4e-75    
ref|WP_015110302.1|  phosphoglycerate kinase                            244   4e-75    
ref|WP_039205250.1|  phosphoglycerate kinase                            244   5e-75    
ref|WP_008311068.1|  phosphoglycerate kinase                            244   5e-75    
ref|WP_024545807.1|  phosphoglycerate kinase                            244   5e-75    
ref|WP_042152714.1|  phosphoglycerate kinase                            244   6e-75    
ref|XP_005851590.1|  hypothetical protein CHLNCDRAFT_29609              244   8e-75    
ref|WP_011317630.1|  phosphoglycerate kinase                            243   2e-74    
ref|WP_037220338.1|  phosphoglycerate kinase                            243   3e-74    
ref|WP_010305334.1|  phosphoglycerate kinase                            242   4e-74    
dbj|BAD94190.1|  phosphoglycerate kinase like protein                   233   4e-74    
ref|WP_025980179.1|  phosphoglycerate kinase                            236   4e-74    
ref|WP_011433296.1|  phosphoglycerate kinase                            242   5e-74    
ref|WP_025980856.1|  phosphoglycerate kinase                            235   6e-74    
ref|WP_015080710.1|  phosphoglycerate kinase                            242   6e-74    
ref|WP_015162225.1|  phosphoglycerate kinase                            241   7e-74    
ref|WP_010998270.1|  phosphoglycerate kinase                            241   7e-74    
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    243   8e-74    
gb|KIJ83619.1|  phosphoglycerate kinase                                 241   9e-74    
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      242   1e-73    
ref|WP_007101320.1|  phosphoglycerate kinase                            241   1e-73    
ref|WP_015173530.1|  phosphoglycerate kinase                            241   1e-73    
ref|WP_010313479.1|  phosphoglycerate kinase                            241   1e-73    
ref|WP_025942147.1|  phosphoglycerate kinase                            238   1e-73    
ref|WP_012412172.1|  phosphoglycerate kinase                            241   2e-73    
ref|WP_015224558.1|  phosphoglycerate kinase                            240   3e-73    
ref|WP_025943278.1|  phosphoglycerate kinase                            240   4e-73    
ref|WP_025924106.1|  phosphoglycerate kinase                            239   5e-73    
ref|WP_025922800.1|  phosphoglycerate kinase                            239   5e-73    
ref|WP_025906011.1|  MULTISPECIES: phosphoglycerate kinase              239   5e-73    
ref|XP_001777571.1|  predicted protein                                  239   6e-73    
ref|WP_025934740.1|  phosphoglycerate kinase                            239   6e-73    
ref|WP_025925003.1|  MULTISPECIES: phosphoglycerate kinase              239   6e-73    
ref|WP_025913196.1|  MULTISPECIES: phosphoglycerate kinase              239   6e-73    
ref|WP_025943564.1|  MULTISPECIES: phosphoglycerate kinase              239   6e-73    
ref|WP_025934229.1|  phosphoglycerate kinase                            239   6e-73    
ref|WP_025968960.1|  phosphoglycerate kinase                            239   6e-73    
ref|WP_025963501.1|  phosphoglycerate kinase                            239   6e-73    
ref|WP_025962791.1|  phosphoglycerate kinase                            239   6e-73    
ref|WP_011817688.1|  MULTISPECIES: phosphoglycerate kinase              239   6e-73    
ref|WP_032517310.1|  phosphoglycerate kinase                            239   8e-73    
ref|WP_042849696.1|  phosphoglycerate kinase                            239   1e-72    
ref|WP_012007002.1|  phosphoglycerate kinase                            239   1e-72    



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDV+IADKFAPDANSK+VPASA
Sbjct  310  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVIIADKFAPDANSKIVPASA  369

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  370  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  429

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  430  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  484



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004154567.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   330 bits (845),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDV+IADKFAPDANSK+VPASA
Sbjct  310  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVIIADKFAPDANSKIVPASA  369

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  370  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  429

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  430  VTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  484



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTF+DALETTKTVIWNGPMGVFEFDKFAVGTE++A KLAELSGKG
Sbjct  366  IPDGWMGLDIGPDSVKTFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  426  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEATPVA  480



>gb|AFK48886.1| unknown [Lotus japonicus]
Length=181

 Score =   316 bits (809),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANSK+VP+SA
Sbjct  6    YKAQGLSVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSKIVPSSA  65

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F+DAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  66   IPDGWMGLDIGPDSIKSFSDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  125

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  126  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  180



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   327 bits (837),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  313  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  372

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  373  IPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  432

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAVPVA
Sbjct  433  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  487



>gb|KHN21386.1| Phosphoglycerate kinase, chloroplastic [Glycine soja]
Length=181

 Score =   315 bits (808),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASA
Sbjct  6    YKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASA  65

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  66   IPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  125

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  126  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  180



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  313  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  372

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  373  IPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  432

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAVPVA
Sbjct  433  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  487



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDA SKVVPASA
Sbjct  306  YKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAESKVVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTF+DALETTKTVIWNGPMGVFEFDKFAVGTE++A KLAELSGKG
Sbjct  366  IPDGWMGLDIGPDSVKTFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  426  VTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVLALDEATPVA  480



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  313  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  372

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+T+IWNGPMGVFEF+KFAVGTE++AKKLAELSGKG
Sbjct  373  IPDGWMGLDIGPDSVKTFNEALDTTQTIIWNGPMGVFEFEKFAVGTEAIAKKLAELSGKG  432

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAVPVA
Sbjct  433  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  487



>gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSKVVPASA
Sbjct  312  YKAQGLSVGSSLVEEDKLNLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKVVPASA  371

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVKTF++ALETTKTVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  372  IPDGWMGLDIGPESVKTFSEALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  431

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  432  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEATPVA  486



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG+SVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQGISVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPV
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPV  478



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSL+ KA AKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLMAKANAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA PV
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEATPV  478



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLP+DVV+ADKFAPDANSK+VPASA
Sbjct  311  YKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPSDVVVADKFAPDANSKIVPASA  370

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEFDKFAVGTE+VAKKLA+LSGKG
Sbjct  371  IPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAVAKKLADLSGKG  430

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAV VA
Sbjct  431  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVAVA  485



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 172/176 (98%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  365  IPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  480



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 172/176 (98%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  365  IPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  480



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/176 (94%), Positives = 172/176 (98%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  365  IPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  480



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   322 bits (824),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLP+DVVIADKFAPDANS+VVPASA
Sbjct  304  YKAQGLSVGSSLVEEDKLELATTLLAKAKAKGVSLLLPSDVVIADKFAPDANSQVVPASA  363

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  364  IPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  423

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  424  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEATPVA  478



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   321 bits (823),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+ V
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAILV  478



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   321 bits (823),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+ V
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAILV  478



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  365  IPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVVALDEA  475



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA GTESVAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAEGTESVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK+LPGV+ALDEA PV
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKQLPGVLALDEATPV  478



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   319 bits (818),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLPTDVVIADKFAPDANSKVV ASA
Sbjct  304  YKAQGLSVGSSLVEEDKLDLATSLLAKAKLKGVSLLLPTDVVIADKFAPDANSKVVAASA  363

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GP+SVKTFN+ALETTKTVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  364  IPDGWMGLDVGPESVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  423

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  424  VTTIIGGGDSVAAVEKVGVAEVMSHISTGGGASLELLEGKELPGVLALDEATPVA  478



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG+SVGSSLVEEDKL LAT+LL KAKAKGV+LLLP+DVVIADKFAPDANSKVVPA+A
Sbjct  299  YKAQGISVGSSLVEEDKLDLATTLLAKAKAKGVNLLLPSDVVIADKFAPDANSKVVPATA  358

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  359  IPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  418

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  419  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELPGVVALDEATPVA  473



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKKLA+LSGKG
Sbjct  366  IPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKKLADLSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  426  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  481



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASA
Sbjct  310  YKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASA  369

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  370  IPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  429

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  430  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  484



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKKLA+LSGKG
Sbjct  366  IPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKKLADLSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  426  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  481



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG+SVGSSLVEEDKL LAT+LL KAKAKGV+LLLP+DVVIADKFAPDANSKVVPA+A
Sbjct  299  YKAQGISVGSSLVEEDKLDLATTLLAKAKAKGVNLLLPSDVVIADKFAPDANSKVVPATA  358

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  359  IPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  418

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  419  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELPGVVALDEATPVA  473



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKKLA+LSGKG
Sbjct  366  IPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAIAKKLADLSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  426  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  481



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   319 bits (817),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASA
Sbjct  308  YKAQGLSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASA  367

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F++AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  368  IPDGWMGLDIGPDSVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  427

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  428  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAVPVA  482



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   319 bits (817),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 171/176 (97%), Gaps = 1/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASA
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKTVIWNGPMGVFEFDKFA GTE++AKKLA+LSGKG
Sbjct  366  IPDGWMGLDIGPDSIKTFNDALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLADLSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA-VPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALDEA  PVA
Sbjct  426  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEADAPVA  481



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK++GVSL+LPTDVV+ADKFAPDAN+KVVP++A
Sbjct  316  YKAQGLSVGSSLVEEDKLELATSLLVKAKSRGVSLMLPTDVVVADKFAPDANTKVVPSTA  375

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  376  IPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  435

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  436  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAVPVA  490



>ref|NP_001055937.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|AAU44053.1| putative phosphoglycerate kinase [Oryza sativa Japonica Group]
 dbj|BAF17851.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|EEE64225.1| hypothetical protein OsJ_19058 [Oryza sativa Japonica Group]
Length=181

 Score =   308 bits (789),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DV+IADKFAPDANS+VVPASA
Sbjct  6    YKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVIIADKFAPDANSQVVPASA  65

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +F+  LETT+TVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  66   IPDGWMGLDIGPDSVASFSSTLETTQTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  125

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV VA
Sbjct  126  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVTVA  180



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   318 bits (816),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL+KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  309  YKAQGLSVGSSLVEEDKLDLATSLLKKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  368

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL TTKTVIWNGPMGVFEFDKFA GTE+VAKKLAELS  G
Sbjct  369  IPDGWMGLDIGPDSIKTFNDALGTTKTVIWNGPMGVFEFDKFAAGTEAVAKKLAELSAAG  428

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PV
Sbjct  429  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEATPV  482



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL+KAK+KGVSL+LPTDVVIADKFA DANSKVVP++A
Sbjct  315  YKAQGLSVGSSLVEEDKLELATSLLKKAKSKGVSLMLPTDVVIADKFAADANSKVVPSTA  374

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEF+KFAVGTE++AKKLAELSGKG
Sbjct  375  IPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFEKFAVGTEAIAKKLAELSGKG  434

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTT+IGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  435  VTTVIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAVPVA  489



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  230  YKAQGLSVGSSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K FN+ALETTKTVIWNGPMGVFEFDKFA GT +VAKKLAELSGK 
Sbjct  290  IPDGWMGLDIGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKKLAELSGKD  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PV
Sbjct  350  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEATPV  403



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA GTESVAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAEGTESVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LPGV+ALDEA PV
Sbjct  425  VTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKQLPGVLALDEATPV  478



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLP+DVVIADKFAPDANSK+VP+SA
Sbjct  303  YKAQGLSVGSSLVEEDKLDLATTLLAKAKAKGVSLLLPSDVVIADKFAPDANSKIVPSSA  362

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  363  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  422

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  423  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEATPVA  477



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQ LSVGSSLVEEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+
Sbjct  305  YKAQXLSVGSSLVEEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASS  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFNDAL+TTKT+IWNGPMGVFEFDKFA GTESVAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+ V
Sbjct  425  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAILV  478



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL+KAK+KGVSL+LP DVVIADKFA DANSKVVP++A
Sbjct  313  YKAQGLSVGSSLVEEDKLELATSLLKKAKSKGVSLMLPADVVIADKFAADANSKVVPSTA  372

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  373  IPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  432

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAVPVA
Sbjct  433  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAVPVA  487



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  303  YKAQGLSVGSSLVEEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  362

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K FN+ALETTKTVIWNGPMGVFEFDKFA GT +VAKKLAELSGK 
Sbjct  363  IPDGWMGLDIGPDSIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAVAKKLAELSGKD  422

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PV
Sbjct  423  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEATPV  476



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVVIADKFAPDANS+VVPASA
Sbjct  313  YKAQGLSVGSSLVEEDKLDLATLLLAKAKAKGVSLLLPTDVVIADKFAPDANSQVVPASA  372

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFA GTE++AKKLA+LSGKG
Sbjct  373  IPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFATGTEAIAKKLADLSGKG  432

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA PV
Sbjct  433  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVVALDEATPV  486



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANS++VPASA
Sbjct  304  YKAQGLAVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSQIVPASA  363

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLA+LSGKG
Sbjct  364  IPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLADLSGKG  423

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  424  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEATPVA  478



>gb|ACJ85441.1| unknown [Medicago truncatula]
Length=260

 Score =   310 bits (793),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VGSSLVEEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANS++VPASA
Sbjct  85   YKAQGLAVGSSLVEEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSQIVPASA  144

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TT+T+IWNGPMGVFEFDKFAVGTE +AKKLA+LSGKG
Sbjct  145  IPDGWMGLDIGPDSIKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEFIAKKLADLSGKG  204

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGD VAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA PVA
Sbjct  205  VTTIIGGGDFVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEATPVA  259



>gb|EMT12348.1| Phosphoglycerate kinase, chloroplastic [Aegilops tauschii]
Length=376

 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  198  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  257

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  258  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  317

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE V
Sbjct  318  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV  369



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   316 bits (810),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIA+KFAPDA SK+VPA+ 
Sbjct  309  YKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVIANKFAPDAESKIVPATE  368

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN AL+TTKTVIWNGPMGVFEF+KFA GTE++A KLAELSGKG
Sbjct  369  IPDGWMGLDIGPDSIKTFNAALDTTKTVIWNGPMGVFEFEKFAAGTEAIANKLAELSGKG  428

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALDEA+PVA
Sbjct  429  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALDEAIPVA  483



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPA+A
Sbjct  305  YKAQGLSVGSSLVEEDKLDLATTLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPAAA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+ALETTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV ALDEAV
Sbjct  425  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKVLPGVDALDEAV  476



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLL KA +KGVSL+LP+DVV+ADKFAPDANSKVVP++A
Sbjct  317  YKAQGCSVGSSLVEEDKLELATSLLAKAVSKGVSLMLPSDVVVADKFAPDANSKVVPSTA  376

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+F+DALETTKTVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  377  IPDGWMGLDIGPDSVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  436

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE+VPVA
Sbjct  437  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDESVPVA  491



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  302  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  361

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  362  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  421

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE V
Sbjct  422  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV  473



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DV+IADKFAPDANSK+VPASA
Sbjct  306  YKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSKIVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  366  IPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE   VA
Sbjct  426  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEVERVA  480



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   311 bits (798),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DV+IADKFAPDANS+VVPASA
Sbjct  230  YKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSQVVPASA  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++ LET KTVIWNGPMGVFEFDKFAVGTE+ AKKLA+LS KG
Sbjct  290  IPDGWMGLDIGPDSIKTFSEVLETAKTVIWNGPMGVFEFDKFAVGTEATAKKLADLSRKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGVIALDEA PV
Sbjct  350  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLPGVIALDEATPV  403



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   314 bits (804),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG  VGSSLVE+DKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDA SKVVPAS 
Sbjct  304  YKAQGFPVGSSLVEDDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAQSKVVPASE  363

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDSVKTFNDAL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  364  IPDGWMGLDVGPDSVKTFNDALDTTKTIIWNGPMGVFEFDKFATGTEAIAKKLAELSGKG  423

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV VA
Sbjct  424  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAVVVA  478



>gb|AAA79705.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=231

 Score =   305 bits (781),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  56   YKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASA  115

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+V  KLAELS KG
Sbjct  116  IPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVRNKLAELSKKG  175

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA PV
Sbjct  176  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPV  229



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   313 bits (803),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASA
Sbjct  302  YKAQGLSVGSSLVEEDKLDLATTLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASA  361

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK+FN+AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKKLA+LS KG
Sbjct  362  IPDGWMGLDIGPDSVKSFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSEKG  421

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEA PV
Sbjct  422  VTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVVALDEATPV  475



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGV+LLLP+DVVIADKFAPDANSKVVPASA
Sbjct  230  YKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVALLLPSDVVIADKFAPDANSKVVPASA  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +F+  LETTKTVIWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  290  IPDGWMGLDIGPDSVASFSSTLETTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV VA
Sbjct  350  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAVTVA  404



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  230  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  290  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE V
Sbjct  350  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV  401



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVG+SLVEEDKL LATSLL KAK KGVSLLLPTDVVIADKFAPDANS++VPASA
Sbjct  308  YKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAPDANSQIVPASA  367

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD+V +FN AL+T +TVIWNGPMGVFEFDKFAVGTE+VAKKLAELS KG
Sbjct  368  IPDGWMGLDIGPDAVTSFNAALDTCQTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSAKG  427

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEA+PVA
Sbjct  428  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAIPVA  482



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  306  YKAQGLSVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +FN AL+TT+TVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  366  IPDGWMGLDIGPDSVASFNAALDTTQTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALDEAV
Sbjct  426  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV  477



>dbj|BAH57185.1| AT1G79550 [Arabidopsis thaliana]
Length=226

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  56   YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  115

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  116  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  175

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  176  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  226



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVE+DKL LA+SLL KAKAKGVSLLLPTDV+IADKFA DA SKVVPAS 
Sbjct  305  YKAQGFSVGSSLVEDDKLELASSLLAKAKAKGVSLLLPTDVIIADKFAADAESKVVPASE  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTF+DAL+TTKT+IWNGPMGVFEFDKFAVGTES+AKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSVKTFSDALDTTKTIIWNGPMGVFEFDKFAVGTESIAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDEAV VA
Sbjct  425  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEAVAVA  479



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   311 bits (797),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVE DKL LATSLLEKAKAKGV LLLPTDVVIADKFAPDA SK+VPASA
Sbjct  312  YKAQGLSVGSSLVEADKLDLATSLLEKAKAKGVELLLPTDVVIADKFAPDATSKIVPASA  371

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN AL+ TKTVIWNGPMGVFEFDKFA+GTE+VAKKLAELSGKG
Sbjct  372  IPDGWMGLDIGPDSIKTFNAALDKTKTVIWNGPMGVFEFDKFALGTEAVAKKLAELSGKG  431

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LPGV+ALDEA  VA
Sbjct  432  VTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKDLPGVLALDEATLVA  486



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  230  YKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASA  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+VA KLAELS KG
Sbjct  290  IPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSKKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA PV
Sbjct  350  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPV  403



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK VPASA
Sbjct  306  YKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFA+GTE++AKKLAELSGKG
Sbjct  366  IPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAIGTEAIAKKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDE   VA
Sbjct  426  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKALPGVLALDEVERVA  480



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  303  YKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASA  362

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+VA KLAELS KG
Sbjct  363  IPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSKKG  422

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA PV
Sbjct  423  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPV  476



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  303  YKAQGLSVGSSLVEEDKLELATSLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASA  362

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TT+TVIWNGPMGVFEF+KFA GTE+VA KLAELS KG
Sbjct  363  IPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAQGTEAVANKLAELSKKG  422

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ LDEA PV
Sbjct  423  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVVLDEATPV  476



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  233  YKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  292

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  293  IPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  352

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA  V
Sbjct  353  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAATV  406



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  305  YKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA  V
Sbjct  425  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAATV  478



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  305  YKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA  V
Sbjct  425  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAATV  478



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  231  YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  231  YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_006858226.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVE+DK+ LATSLLEKAKAKGVSLLLPTDVVIADKFAPDA SK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEDDKIDLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAESKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPD WMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEFDKFAVGTE++AKKLA+LS KG
Sbjct  366  IPDRWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSAKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVAA  204
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALDE VPVAA
Sbjct  426  VTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKALPGVLALDEVVPVAA  481



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  305  YKAQGLPVGASLVEEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV +FN AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  365  IPDGWMGLDIGPDSVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+EA  V
Sbjct  425  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALNEAATV  478



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANS+ V ASA
Sbjct  304  YKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSQTVAASA  363

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV TFN ALETT+T+IWNGPMGVFEFDKFAVGTE+VAKKLAELS KG
Sbjct  364  IPDGWMGLDIGPDSVATFNAALETTQTIIWNGPMGVFEFDKFAVGTEAVAKKLAELSKKG  423

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGV+ALDEAV V
Sbjct  424  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKQLPGVVALDEAVTV  477



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  231  YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLEL+EGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELIEGKPLPGVLALDEA  401



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK VPASA
Sbjct  306  YKAQGLAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  366  IPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE   VA
Sbjct  426  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEVERVA  480



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  302  YKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  361

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+  FN ALETT+TVIWNGPMGVFE+DKFA+GTE+VAKKLAELS KG
Sbjct  362  IPDGWMGLDIGPDSIAAFNAALETTQTVIWNGPMGVFEYDKFAIGTEAVAKKLAELSRKG  421

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV ALDEA  V
Sbjct  422  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVTALDEAATV  475



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LLEKAKAKGVSLLLP DVVIADKFA DANSK+VPAS 
Sbjct  307  YKAQGLSVGSSLVEEDKLDLATTLLEKAKAKGVSLLLPPDVVIADKFAADANSKIVPASE  366

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F+DAL+TT+TVIWNGPMGVFEFDKFAVGTE++AKKL E+S KG
Sbjct  367  IPDGWMGLDIGPDSIKMFSDALDTTQTVIWNGPMGVFEFDKFAVGTEAIAKKLEEISKKG  426

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPGV+ALDEAVPV
Sbjct  427  VTTIIGGGDSVAAVEKVGVAESMSHISTGGGASLELLEGKELPGVLALDEAVPV  480



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKF PDANSK+VPASA
Sbjct  231  YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFCPDANSKIVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 2/176 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPA--  558
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSKV+ A  
Sbjct  303  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKVLNAVN  362

Query  557  SAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSG  378
              +PDGWMGLDIGPDSVKTFNDAL++T+T+IWNGPMGVFEFDKFAVGTE+VAKKLAELS 
Sbjct  363  CRLPDGWMGLDIGPDSVKTFNDALDSTQTIIWNGPMGVFEFDKFAVGTEAVAKKLAELSE  422

Query  377  KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGVIALDEA PV
Sbjct  423  KGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLPGVIALDEAAPV  478



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELSGKG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+PV
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPV  479



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VGSSLVEEDKL LAT+LLEKAKAKGVSLLLP+DVVIADKFAPDANSK VPASA
Sbjct  306  YKAQGLAVGSSLVEEDKLDLATTLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  366  IPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAIAKKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALDE   VA
Sbjct  426  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALDEVERVA  480



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELSGKG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA+PV
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAIPV  479



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIADKFA DANS+VVPAS+
Sbjct  231  YKAQGYSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIADKFAADANSQVVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN++L+TTKT+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNESLDTTKTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALNDA  401



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  231  YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASA
Sbjct  231  YKAQGYSVGSSLLEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELSGKG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA+PV
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAIPV  479



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL +AKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATELLAEAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELSGKG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALDEA+PV
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEAIPV  479



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVG+SLVEEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASA
Sbjct  452  YKAQGLSVGASLVEEDKLDLATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASA  511

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+  FN ALETT+TVIWNGPMGVFE+DKFA+GTE+VAKKLAELS KG
Sbjct  512  IPDGWMGLDIGPDSIAAFNAALETTQTVIWNGPMGVFEYDKFAIGTEAVAKKLAELSRKG  571

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV ALDEA  V
Sbjct  572  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVTALDEAATV  625



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LAT+LLEKAKAKGVSLLLPTDVVIADKFA DANSK VPAS+
Sbjct  231  YKAQGYSVGSSLVEEDKLSLATTLLEKAKAKGVSLLLPTDVVIADKFAADANSKTVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF +AL+TT+T+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFGEALDTTQTIIWNGPMGVFEFDKFATGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  224  YKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  283

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  284  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  343

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+PV
Sbjct  344  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPV  397



>emb|CDX67989.1| BnaA07g20290D [Brassica napus]
Length=348

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  178  YKAQGHSVGSSLLEEDKLDLARSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  237

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  238  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  297

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  298  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  348



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELSGKG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSGKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV ALDEA+PV
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVTALDEAIPV  479



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+DAL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSDALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LA SL+EKAKAKGVS+LLPTDVVIADKFA DANSKVVPASA
Sbjct  231  YKAQGLSVGSSLVEEDKLDLAKSLMEKAKAKGVSILLPTDVVIADKFAADANSKVVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  401



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+PV
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPV  479



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDK+ LA SL+  AK KGVSLLLPTDVV+ADKFA DANSK+VP++A
Sbjct  236  YKAQGLSVGSSLVEEDKIDLAKSLMRTAKDKGVSLLLPTDVVVADKFAADANSKIVPSTA  295

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  296  IPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  355

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEAV
Sbjct  356  VTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVAALDEAV  407



>gb|KEH15368.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=226

 Score =   293 bits (750),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG S+GSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DAN K+VPAS+
Sbjct  56   YKAQGYSIGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANDKIVPASS  115

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKKLAE+SGKG
Sbjct  116  IPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKKLAEVSGKG  175

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  176  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  226



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELS KG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSEKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAITV  479



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS 
Sbjct  309  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASG  368

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELS KG
Sbjct  369  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSEKG  428

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  429  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAITV  482



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKLGLATSL+EKAK KGVSLLLP+DVVIADKFA DANSKVVPAS 
Sbjct  231  YKAQGHAVGSSLVEEDKLGLATSLMEKAKTKGVSLLLPSDVVIADKFAADANSKVVPASQ  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F +ALETTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VGSSLVEEDKL LAT+LLEKAK+KGVSLLLP+DVVIADKFA DANSK+VPAS+
Sbjct  231  YKAQGLAVGSSLVEEDKLDLATTLLEKAKSKGVSLLLPSDVVIADKFAADANSKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F++AL+TTKTVIWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFSEALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVPALDEA  401



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LAT+LLEKAKAKGVSLLLPTDVVIADKFA DANSK VPAS+
Sbjct  231  YKAQGYSVGSSLVEEDKLSLATTLLEKAKAKGVSLLLPTDVVIADKFAADANSKTVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF +AL+ T+TVIWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFGEALDKTQTVIWNGPMGVFEFDKFATGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>emb|CDY49746.1| BnaA02g19260D [Brassica napus]
Length=388

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  218  YKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  277

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  278  IPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  337

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  338  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  388



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS 
Sbjct  307  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASG  366

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELS KG
Sbjct  367  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSEKG  426

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  427  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAITV  480



>emb|CDX88547.1| BnaC06g39910D [Brassica napus]
Length=352

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+A
Sbjct  182  YKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATA  241

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  242  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  301

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  302  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  352



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   301 bits (770),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVE DKL LATSLL KAK KGVSL+LPTDVV+ADKFAPDA S+VVPASA
Sbjct  315  YKAQGFSVGSSLVEADKLELATSLLSKAKEKGVSLMLPTDVVVADKFAPDARSQVVPASA  374

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEF KFAVGTE++AKKLAELSGKG
Sbjct  375  IPDGWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFKKFAVGTEAIAKKLAELSGKG  434

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALDEA
Sbjct  435  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELPGVVALDEA  485



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVE DKL LATSLL KAK KGVSL+LPTDVV+ADKFAPDA S+VVPASA
Sbjct  314  YKAQGFSVGSSLVEADKLELATSLLSKAKEKGVSLMLPTDVVVADKFAPDARSQVVPASA  373

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEF KFAVGTE++AKKLAELSGKG
Sbjct  374  IPDGWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFKKFAVGTEAIAKKLAELSGKG  433

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALDEA
Sbjct  434  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELPGVVALDEA  484



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEFDKFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010669985.1| PREDICTED: phosphoglycerate kinase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG+SVGSSLVEEDKL LATSL+EKAKAKGVSL+LPTDVVIADKFA DA SK VPASA
Sbjct  231  YKAQGISVGSSLVEEDKLELATSLIEKAKAKGVSLMLPTDVVIADKFAADAESKTVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ T+T+IWNGPMGVFEFDKFA GTE+VA+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDKTQTIIWNGPMGVFEFDKFAAGTEAVARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDK  LAT+LLEKAKAKGVS+LLPTDVVIADKFAPDANSK+VPAS+
Sbjct  231  YKAQGYSVGSSLVEEDKYDLATTLLEKAKAKGVSILLPTDVVIADKFAPDANSKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++ L+TT+T+IWNGPMGVFEF+KFA GTE++AKKLAE+SGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSETLDTTQTIIWNGPMGVFEFEKFAAGTEAIAKKLAEISGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVV AS 
Sbjct  231  YKAQGYSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVSASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+ TF++AL+TTKT+IWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSINTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|KCW71393.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=345

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+SK+VPASA
Sbjct  175  YKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADADSKIVPASA  234

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GTE+VAKKLAELSGKG
Sbjct  235  IPDGWMGLDIGPDSIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAVAKKLAELSGKG  294

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  295  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  345



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+SK+VPASA
Sbjct  231  YKAQGLSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADADSKIVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GTE+VAKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAVAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK+KGVSLLLPTDVVIADKFA DANSKVVPA+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPD++K+F++AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            +KAQGLSVGSSLVEEDK+ LA SL++ AK KGVSLLLPTDVV+ADKFA DANSK+VP++A
Sbjct  296  FKAQGLSVGSSLVEEDKIDLAKSLMKTAKDKGVSLLLPTDVVVADKFAADANSKIVPSTA  355

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFN+AL+TTKTVIWNGPMGVFEFDKFAVGTE+VAKKLAELSGKG
Sbjct  356  IPDGWMGLDIGPDSVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAVAKKLAELSGKG  415

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAV  216
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEAV
Sbjct  416  VTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVAALDEAV  467



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKLGLATSLLEKAK+KGVSLLLPTDVVIADKFA DA+SK+VPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLGLATSLLEKAKSKGVSLLLPTDVVIADKFAADADSKIVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+ ALE+TKT+IWNGPMGVFEF+KFAVGTE++AKKLA+LSG G
Sbjct  291  IPDGWMGLDIGPDSIKTFSGALESTKTIIWNGPMGVFEFEKFAVGTEAIAKKLADLSGTG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DANSKVVPAS 
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKTVIWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DANSKVVPAS 
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKTVIWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|KJB14020.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=349

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVV+ADKFA DANSKVVPAS 
Sbjct  179  YKAQGYAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVVADKFAADANSKVVPASG  238

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA GTE+VAKKLAELSGKG
Sbjct  239  IPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKKLAELSGKG  298

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+AL++A
Sbjct  299  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALNDA  349



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKV+PAS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVLPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFAVGTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAVGTEAIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS 
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASG  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  365  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  425  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIAV  478



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   295 bits (756),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LAT+LLEKAK+KGVSLLLPTD+V+ADKFA DANSKVVPASA
Sbjct  231  YKAQGHSVGSSLVEEDKLSLATALLEKAKSKGVSLLLPTDIVVADKFAADANSKVVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF ++L+TTKTVIWNGPMGVFEFDKFA GTE++AKKLAEL+GKG
Sbjct  291  IPDGWMGLDIGPDSIKTFGESLDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLAELTGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALNDA  401



>emb|CDX79326.1| BnaC06g19770D [Brassica napus]
Length=353

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSL+EEDKL LA SL+EKA+ KGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  183  YKAQGHAVGSSLLEEDKLDLARSLMEKAQDKGVSLLLPTDVVIADKFAPDANSKIVPATA  242

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  243  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  302

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  303  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  353



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL L TSL+EKAK+KGVSLLLPTDVVIADKFA DANSKVVPA+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLGTSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPD++K+F++AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKA+AKGVSLLLPTDVVIADKFAPDANSK+VPA+A
Sbjct  231  YKAQGHSVGSSLVEEDKLDLAKSLMEKAEAKGVSLLLPTDVVIADKFAPDANSKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE+VAK+LAELSGKG
Sbjct  291  IPDGWMGLDVGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAVAKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVA+VEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVASVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVG+SLVEEDKLGLATSL+EKAKAKGVSLLLPTDVVIADKF+ DAN K+VPAS+
Sbjct  231  YKAQGYSVGTSLVEEDKLGLATSLIEKAKAKGVSLLLPTDVVIADKFSADANDKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ ++TVIWNGPMGVFEFDKFA GTE++AKKLAE+SGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDKSQTVIWNGPMGVFEFDKFAAGTEAIAKKLAEISGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS 
Sbjct  309  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASG  368

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE+VA KLAELS KG
Sbjct  369  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAVANKLAELSEKG  428

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  429  VTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAITV  482



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SLLEKAK+KGVS+LLPTDVVIADKFA DANSKVVPASA
Sbjct  231  YKAQGHSVGSSLVEEDKLDLAKSLLEKAKSKGVSILLPTDVVIADKFAADANSKVVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TT+T+IWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVV+ADKFA DANSKVVPAS 
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVVADKFAADANSKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA GTE+VAKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALNDA  401



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS 
Sbjct  306  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASG  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  366  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  426  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIAV  479



>gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA +L+EKAKAKGV LLLPTDVVIADKFA DANSKVVPAS+
Sbjct  231  YKAQGHSVGSSLVEEDKLDLANTLMEKAKAKGVFLLLPTDVVIADKFAADANSKVVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGW+GLD+GPDS++TF +AL+TTKTVIWNGPMGVFEF+KFAVGTE++AKKLAELSGKG
Sbjct  291  IPDGWLGLDVGPDSIQTFCEALDTTKTVIWNGPMGVFEFEKFAVGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66344.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG S+GSSLVEEDKL LATSL+EKAKAKGVSLLLPTDVVIADKF+ DAN K+VPAS+
Sbjct  231  YKAQGYSIGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFSADANDKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKKLAE+SGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKKLAEVSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|AAX57302.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57303.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57304.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57305.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57306.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57307.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57308.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57309.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57310.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57311.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57312.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57313.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57314.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57315.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57316.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57317.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57318.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57319.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57320.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57321.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57322.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57324.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57325.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57326.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57327.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57328.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57329.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85283.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85284.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85285.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85286.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85287.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85288.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85289.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85290.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85291.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85292.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|ABS19549.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19552.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19557.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19535.1| CT114 [Solanum chilense]
Length=224

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VGSSLVE+DK+ LA +L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS 
Sbjct  332  YKAQGLKVGSSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADANSKVVPASD  391

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKFA GTES+AKKLAELSGKG
Sbjct  392  IPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESIAKKLAELSGKG  451

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            V TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALDEAVPV
Sbjct  452  VITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLALDEAVPV  505



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VGSSLVE+DK+ LA +L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS 
Sbjct  332  YKAQGLKVGSSLVEDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADANSKVVPASD  391

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKFA GTES+AKKLAELSGKG
Sbjct  392  IPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESIAKKLAELSGKG  451

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            V TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALDEAVPV
Sbjct  452  VITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLALDEAVPV  505



>gb|ABS19537.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++A+KLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIARKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|AAX57323.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85276.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85278.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85282.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|ABS19539.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19540.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19541.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19542.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19543.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19545.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19546.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19548.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19550.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19551.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19553.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19554.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19555.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19558.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19559.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19544.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   287 bits (735),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSG+G
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGRG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LAT+L+EKAKAKGVSLLLPTDVVIADKFA DAN K+VPAS+
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATTLIEKAKAKGVSLLLPTDVVIADKFAADANDKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKKLAE+SGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKKLAEVSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKVVPAS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   293 bits (750),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++ LE+TKT+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSETLESTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|AAZ85273.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85274.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85275.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85277.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85279.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85280.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85281.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
Length=224

 Score =   286 bits (733),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPT+VVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTNVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   294 bits (752),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVVIADKF+PDANSK+VPAS 
Sbjct  259  YKAQGLAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFSPDANSKIVPASE  318

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++AKKLAEL  KG
Sbjct  319  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAKKLAELGDKG  378

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  379  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALNDA  429



>gb|ABS19556.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   286 bits (733),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATS +EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSFMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   293 bits (749),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVE DKL LATSL+EKAKAKGVSLLLP+DVVIADKFA DANSKVVPAS 
Sbjct  231  YKAQGHAVGSSLVEADKLDLATSLIEKAKAKGVSLLLPSDVVIADKFAADANSKVVPASQ  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F +ALETTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALNDA  401



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS 
Sbjct  239  YKAQGYSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASG  298

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++ LE+TKT+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  299  IPDGWMGLDIGPDSIKTFSETLESTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  358

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  359  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  409



>emb|CBI24183.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG  VGSSLVEEDKL LATSLLEKAK+KGVSLLLP DVVIADKFA DANSKVVPAS 
Sbjct  179  YKAQGYGVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASC  238

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF ++L+TTKT+IWNGPMGVFEFDKFA+GTE++AKKLA+LS KG
Sbjct  239  IPDGWMGLDIGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAIAKKLADLSEKG  298

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  299  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLALDDA  349



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKVV AS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVAASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+TTKT+IWNGPMGVFEF+KFA GTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|ABS19536.1| CT114 [Solanum chilense]
Length=224

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YK QG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKVQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVE DKL LA+SL+EKAKAKGV LLLPTDVVIADKFA DANSKVVPAS+
Sbjct  231  YKAQGHSVGSSLVEGDKLDLASSLIEKAKAKGVDLLLPTDVVIADKFAADANSKVVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPD++KTF +AL+TT+T+IWNGPMGVFEFDKFAVGTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDVGPDAIKTFCEALDTTQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SLLEKAKAKGVS+LLPTDVVIADKFA DANSKVVPASA
Sbjct  231  YKAQGYSVGSSLVEEDKLDLAKSLLEKAKAKGVSILLPTDVVIADKFAADANSKVVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL TT+T+IWNGPMGVFEF+KFA GTE++AKKLAELS KG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALVTTQTIIWNGPMGVFEFEKFAAGTEAIAKKLAELSDKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DV++ADKFAPDANSKVVPAS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|ABS19538.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGWMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGG DSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGSDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSLLEKAKAKGVSLLLP+DVV+ADKFA DANSKVVPAS 
Sbjct  231  YKAQGHAVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPSDVVVADKFAADANSKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+++L+TT+T+IWNGPMGVFEF+KFA GTE+VAKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAVAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVLALNDA  401



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F  AL+TTK +IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDAIKSFGSALDTTKNIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS 
Sbjct  305  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASG  364

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  365  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  424

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALDEA+ V
Sbjct  425  VTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIAV  478



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SLLEKAKAKGVS+LLPTDVVIADKFA DANSKVVPASA
Sbjct  279  YKAQGYSVGSSLVEEDKLDLAKSLLEKAKAKGVSILLPTDVVIADKFAADANSKVVPASA  338

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL TT+T+IWNGPMGVFEF+KFA GTE++AKKLAELS KG
Sbjct  339  IPDGWMGLDIGPDSIKTFSEALVTTQTIIWNGPMGVFEFEKFAAGTEAIAKKLAELSDKG  398

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  399  VTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLPGVLALDDA  449



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF + LE+TK +IWNGPMGVFEF+KFAVGTE++AKKLA+LSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFCETLESTKAIIWNGPMGVFEFEKFAVGTEAIAKKLADLSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAKAKGVSLLLP DVVIADKF+ DANSK+VPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLDLATSLIEKAKAKGVSLLLPADVVIADKFSADANSKIVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F +AL+TTKT+IWNGPMGVFEF+ FA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDAIKSFGEALDTTKTIIWNGPMGVFEFENFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG  VGSSLVEEDKL LATSLLEKAK+KGVSLLLP DVVIADKFA DANSKVVPAS 
Sbjct  231  YKAQGYGVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASC  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF ++L+TTKT+IWNGPMGVFEFDKFA+GTE++AKKLA+LS KG
Sbjct  291  IPDGWMGLDIGPDSIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAIAKKLADLSEKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG+SVGSSLVEEDKL LATSLL KAK KGVSLLLPTDVVIADKFA DA+SK+VPAS 
Sbjct  258  YKAQGMSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAADADSKIVPASG  317

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+TT+TVIWNGPMGVFEF+KFA GTE++AKKL E+S KG
Sbjct  318  IPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKKLEEISKKG  377

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
             TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK+LPGV+AL+EA PV
Sbjct  378  ATTIIGGGDSVAAVEKVGVAEAMSHISTGGGASLELLEGKQLPGVLALNEADPV  431



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LAT+L+EKAKAKGVSLLLPTDVVIADKFA DAN K+VPAS+
Sbjct  231  YKAQGYAVGSSLVEEDKLDLATTLIEKAKAKGVSLLLPTDVVIADKFAADANDKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKKLAE+SGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDRSQTIIWNGPMGVFEFDKFAAGTEAIAKKLAEVSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+   MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLEDKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|NP_001167912.1| phosphoglycerate kinase [Zea mays]
 gb|ACN26497.1| unknown [Zea mays]
 tpg|DAA57247.1| TPA: phosphoglycerate kinase [Zea mays]
Length=371

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG S+GSSLVE+DKL LATSLL KAK KGVSL+LP D+V+ADKFAPDA+S+VVPASA
Sbjct  201  YKAQGHSIGSSLVEDDKLELATSLLRKAKEKGVSLMLPFDLVVADKFAPDASSQVVPASA  260

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPD WMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEFDKFAVGT+++AKKLAELSGKG
Sbjct  261  IPDAWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFDKFAVGTKAIAKKLAELSGKG  320

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTI+GGGDS+AAVEKVGVA  +SHISTGGGASLELLEGKELPGV ALDEA
Sbjct  321  VTTIVGGGDSIAAVEKVGVADSLSHISTGGGASLELLEGKELPGVAALDEA  371



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFA DANSK V AS+
Sbjct  231  YKAQGLSVGSSLVEEDKLDLATSLLEKAKAKGVSLLLPTDVVIADKFAADANSKTVSASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+ T+TVIWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDATQTVIWNGPMGVFEFEKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALNDA  401



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLPTDVV+ADKFAPDANSKVVPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPTDVVVADKFAPDANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A KLAELSGKG
Sbjct  291  IADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score =   291 bits (744),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLP+DVVIA+KFA DA+SKVV AS 
Sbjct  231  YKAQGHSVGSSLVEEDKLELAKSLMEKAKAKGVSLLLPSDVVIANKFAADADSKVVSASD  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF +AL+TT+T+IWNGPMGVFEFDKFAVGTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFGEALDTTQTIIWNGPMGVFEFDKFAVGTETIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   290 bits (743),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDV+IADKFA DANS VVPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLDLATSLLEKAKSKGVSLLLPTDVLIADKFAADANSMVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+++L+TTKT+IWNGPMGVFEF+KFA+GTE++AKKLAELS  G
Sbjct  291  IPDGWMGLDIGPDSIKTFSESLDTTKTIIWNGPMGVFEFEKFALGTEAIAKKLAELSASG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKAK KGV LLLP DV++ADKFAPDANSKVVPAS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+ TF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSITTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|ABS19547.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS 
Sbjct  58   YKAQGYAVGSSLVEEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASE  117

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDG MGLDIGPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  118  IPDGRMGLDIGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  177

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  231
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  178  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+LL KAK KGV  LLP+DVVIADKFAPDANSKVVPA A
Sbjct  302  YKAQGLSVGSSLVEEDKLDLATTLLAKAKEKGVFFLLPSDVVIADKFAPDANSKVVPAFA  361

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD VK+FN+AL+TTKT+IWNGPMGVFEFDKFAVGTE++AKKLA+ S KG
Sbjct  362  IPDGWMGLDIGPDFVKSFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADFSEKG  421

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            V  IIGGGD VAAVEKVGVA+VMSHI TGGGASLELLEGKELPGV+A DEA PV
Sbjct  422  VPPIIGGGDFVAAVEKVGVANVMSHIFTGGGASLELLEGKELPGVVAFDEAPPV  475



>ref|XP_006858233.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            Y+AQG SVGSSLVEEDKL LATSLLEKAKAKGV+LLLPTDVV+ADKFAPDA SKVVPAS 
Sbjct  231  YEAQGFSVGSSLVEEDKLDLATSLLEKAKAKGVALLLPTDVVVADKFAPDAESKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IP+GWMGLDIGPDS+KTFNDALE  KT+IWNGPMGVFEF+KFA GT+++AKKLAELS KG
Sbjct  291  IPEGWMGLDIGPDSIKTFNDALEPAKTIIWNGPMGVFEFEKFAAGTKAIAKKLAELSEKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVE+ G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEQAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA SK+VPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAESKIVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F+  LE+TKT+IWNGPMGVFE++KFAVGTE++AKKLA+LSG G
Sbjct  291  IPDGWMGLDIGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAIAKKLADLSGSG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEED+L LA SL+EKAKAKGV LLLPTDVV ADKFAPDANSKVVPAS 
Sbjct  231  YKAQGHSVGSSLVEEDRLDLALSLIEKAKAKGVPLLLPTDVVAADKFAPDANSKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F++AL+ TKT+IWNGPMGVFE+DKFA GTE++AKKLAELSG G
Sbjct  291  IPDGWMGLDIGPDAIKSFSEALDATKTIIWNGPMGVFEYDKFATGTEAIAKKLAELSGNG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS 
Sbjct  307  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASG  366

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  367  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  426

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALDEA
Sbjct  427  VTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEA  477



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG  VG+SLVE+DKL LATSLL KAK KGVSL+LPTDV++ADKFAP+AN +VV A A
Sbjct  279  YKAQGFPVGASLVEDDKLELATSLLAKAKEKGVSLMLPTDVIVADKFAPEANCQVVSAYA  338

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSV  F+ ALETT+TVIWNGPMGVFEF+KFAVGTE++AKKLAELSGKG
Sbjct  339  IPDGWMGLDIGPDSVAAFSSALETTQTVIWNGPMGVFEFEKFAVGTEAIAKKLAELSGKG  398

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGG DSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALDEA
Sbjct  399  VTTIIGGKDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVVALDEA  449



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VGSSLVE+DK+ LA++L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS 
Sbjct  332  YKAQGLKVGSSLVEDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADANSKVVPASD  391

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKF++GT S+AKKLAELSGKG
Sbjct  392  IPDGWMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSIAKKLAELSGKG  451

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+AVPV
Sbjct  452  VTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLALDDAVPV  505



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLV+EDKL LATSL+EKAK KGVSLLLPTDVVIADKFA +ANSK+VPAS 
Sbjct  232  YKAQGYAVGSSLVKEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAANANSKIVPASE  291

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD GPD++K+F  AL+TTKT+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  292  IPDGWMGLDFGPDAIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  351

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  352  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA  402



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LAT+L+EKAK+KGVSLLLPTDVV+A+KFA DA++KVVPAS 
Sbjct  231  YKAQGLSVGSSLVEEDKLDLATALIEKAKSKGVSLLLPTDVVVANKFAADADTKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F++ L++TKT+IWNGPMGVFEFDKFAVGTE++AKKLA+LSGKG
Sbjct  291  IPDGWMGLDIGPDSIKIFSETLDSTKTIIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  ATTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVE DKL LATSL++KAKAKGVSLLLP+DVVIADKFA DA+SKVVPAS 
Sbjct  231  YKAQGQSVGSSLVEADKLDLATSLIDKAKAKGVSLLLPSDVVIADKFAADASSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEFDKFA GTE++A+KLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFGEALDSTETIIWNGPMGVFEFDKFAAGTEAIARKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  401



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA+SKVV AS+
Sbjct  231  YKAQGLAVGKSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVVADKFAADADSKVVAASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFGEALDSTQTIIWNGPMGVFEFEKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA G SVGSSLVE+DKL LATSL+EKAKAKGVSLLLP DVVIADKFA DANSKVVPA+ 
Sbjct  231  YKALGYSVGSSLVEDDKLDLATSLIEKAKAKGVSLLLPADVVIADKFAVDANSKVVPATE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++K+F +AL+TTKT+IWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDAIKSFGEALDTTKTIIWNGPMGVFEFEKFASGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALDDA  401



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA+SKVV AS+
Sbjct  231  YKAQGLAVGKSLVEEDKLDLATSLIEKAKAKGVSLLLPTDVVVADKFAADADSKVVAASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F +AL++T+T+IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFGEALDSTQTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVSALDDA  401



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   288 bits (736),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA SK+VPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAESKIVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F+  LE+TKT+IWNGPMGVFE++KFAVGTE++AKKLA+LSG G
Sbjct  291  IPDGWMGLDIGPDSIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAIAKKLADLSGSG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVLALEDA  401



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL VGSSLVEEDKLGLATSLLEKAKAKGVSLLLP+DV+IADKFAPDANSK VPASA
Sbjct  306  YKAQGLPVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSKTVPASA  365

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVKTF++AL TT+TVIWNGPMGVFEFDKFAVGTE++AKKLAELS KG
Sbjct  366  IPDGWMGLDIGPESVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAIAKKLAELSSKG  425

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPVA  207
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALDE   VA
Sbjct  426  VTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGEELPGVLALDEVERVA  480



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG S+GSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKVVPAS 
Sbjct  231  YKAQGYSIGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A KLAELSGKG
Sbjct  291  IADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSL+EKA+ KGV LLLPTDVV+ADKFA DANSKVVPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLDLATSLIEKARVKGVKLLLPTDVVVADKFASDANSKVVPASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTF++AL+TTKT+IWNGPMGVFEF+KFA GTE++A KLAELSGKG
Sbjct  291  IADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAIAWKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG S+GSSLVE+DKL LA SLL+KAK KGVSL+LP DVVIADKFAPDA+S+VVPASA
Sbjct  319  YKAQGHSIGSSLVEDDKLELAISLLKKAKEKGVSLMLPIDVVIADKFAPDASSQVVPASA  378

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPD WMGLDIGPDS+  F+ ALETT+TVIWNGPMGVFEFDKF+VGT+++AKKLAELSGKG
Sbjct  379  IPDAWMGLDIGPDSISAFSSALETTQTVIWNGPMGVFEFDKFSVGTKAIAKKLAELSGKG  438

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEGKELPGV ALDEA
Sbjct  439  VTTIIGGGDSVAAVEKAGVADSMSHISTGGGASLELLEGKELPGVAALDEA  489



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA +L+EKAKAKGVSLLLPTDVVIADKFA DAN K+V AS+
Sbjct  231  YKAQGYSVGSSLVEEDKLELANTLIEKAKAKGVSLLLPTDVVIADKFAADANDKIVSASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTFN+AL+ ++T+IWNGPMGVFEFDKFA GTE++AKKLAE+S KG
Sbjct  291  IPDGWMGLDIGPDSIKTFNEALDKSQTIIWNGPMGVFEFDKFAAGTEAIAKKLAEVSDKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVE DKL LA+SL+EKAKAKGVSLLLPTDVV+ADKFA DANSKVV AS 
Sbjct  231  YKAQGLSVGSSLVEGDKLELASSLMEKAKAKGVSLLLPTDVVVADKFAADANSKVVSASE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IP+GWMGLDIGPDSV TFN+AL+ T+T+IWNGPMGVFEFDKFAVGTE++AKKLAEL  KG
Sbjct  291  IPEGWMGLDIGPDSVTTFNEALDKTQTIIWNGPMGVFEFDKFAVGTEAMAKKLAELGEKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD A
Sbjct  351  VTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDHA  401



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVV ADKFA DANSKVVPAS 
Sbjct  231  YKAQGHSVGSSLVEEDKLDLALSLIEKAKAKGVSLLLPTDVVAADKFAADANSKVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP S+K+F++AL+TTKT+IWNGPMGVFEFDKFA GT+++AKKLAELSG G
Sbjct  291  IPDGWMGLDIGPVSIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTDTIAKKLAELSGNG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDNA  401



>dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA SK+VPA+A
Sbjct  212  YKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATA  271

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GT+++AK+LAEL+GKG
Sbjct  272  IPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTGKG  331

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  332  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  382



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LATSLLEKAK+KGVSLLLPTDVV ADKFA DAN  VVPAS 
Sbjct  231  YKAQGYSVGSSLVEEDKLNLATSLLEKAKSKGVSLLLPTDVVAADKFAADANCMVVPASG  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F+++L+TTKT+IWNGPMGVFEF+KFAVGTE++AKKLA+LS  G
Sbjct  291  IPDGWMGLDIGPDSIKAFSESLDTTKTIIWNGPMGVFEFEKFAVGTEAIAKKLADLSAAG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  401



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG  VGSSLVEEDKL LATSL+EKAKAKGVSLLLP+DVVIADKFA DANSKVVPA  
Sbjct  231  YKAQGYKVGSSLVEEDKLDLATSLIEKAKAKGVSLLLPSDVVIADKFAADANSKVVPAKE  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K+F++ L+TTKTVIWNGPMGVFEF+KFA GTE++AKKLAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKSFSETLDTTKTVIWNGPMGVFEFEKFAAGTEAIAKKLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTII GGDSVAAVEKVG+A  MSHISTGGGASL+LLEGK LPGV+AL+EA
Sbjct  351  VTTII-GGDSVAAVEKVGLADKMSHISTGGGASLQLLEGKTLPGVLALNEA  400



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA SK+VPA+A
Sbjct  231  YKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GT+++AK+LAEL+GKG
Sbjct  291  IPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSL+EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+A
Sbjct  231  YKAQGHAVGSSLLEEDKLDLARSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVLATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++AL+T KT+IWNGPMGVFEF+KFA GTE+V K+LAELSGKG
Sbjct  291  IPDGWMGLDIGPDSIKTFSEALDTAKTIIWNGPMGVFEFEKFAAGTEAVVKQLAELSGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VT IIGGGDSVAAVEKVG+A  MSHISTGGGA LELLEGK  PGV+ALD+A
Sbjct  351  VTKIIGGGDSVAAVEKVGLADKMSHISTGGGARLELLEGKPRPGVLALDDA  401



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVV+ADKFA DANSK V AS 
Sbjct  262  YKAQGHAVGSSLVEEDKLSLANSLMEKAKAKGVSLLLPTDVVVADKFAADANSKTVSASE  321

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IP+GWMGLDIGPDS++TF++AL+ T+T+IWNGPMGVFEFDKFAVGTE++AKKLAELS KG
Sbjct  322  IPEGWMGLDIGPDSIETFSEALDETQTIIWNGPMGVFEFDKFAVGTEAIAKKLAELSDKG  381

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  382  VTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  432



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS 
Sbjct  627  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASG  686

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            I DGWMGLDIGPDS+KTFN+AL+TT+TVIWNGPMGVFE +KFA GTE++A KLAELS KG
Sbjct  687  IEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKG  746

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALDEA
Sbjct  747  VTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEA  797



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFAPDA SK+VPA+A
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAPDAESKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPD WMGLD+GPD+ KTFNDAL+ T+T+IWNGPMGVFEF+KFA GTE++AKKLAEL + K
Sbjct  291  IPDDWMGLDVGPDATKTFNDALDKTQTIIWNGPMGVFEFEKFAAGTEAIAKKLAELTTTK  350

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  GVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG  VGSSLVE D+L LAT+LLEKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS 
Sbjct  231  YKAQGHPVGSSLVE-DQLDLATALLEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASG  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+++L++TKT+IWNGPMGVFEF+KFAVGTE++AKKLA+LSGKG
Sbjct  290  IPDGWMGLDIGPDSIKTFSESLDSTKTIIWNGPMGVFEFEKFAVGTEAIAKKLADLSGKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK+G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  350  VTTIIGGGDSVAAVEKMGLADKMSHISTGGGASLELLEGKSLPGVLALDDA  400



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VG SLVEEDKL LATSL+E AKAKGV LLLP DVV+ADKFA DA SKVVPASA
Sbjct  231  YKAQGLAVGKSLVEEDKLELATSLIETAKAKGVKLLLPIDVVVADKFAADAESKVVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPD++KTF++AL+T KT+IWNGPMGVFEF+KFA GT+++AK+LAEL+ KG
Sbjct  291  IPDGWMGLDVGPDAIKTFSEALDTCKTIIWNGPMGVFEFEKFAAGTDAIAKQLAELTAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA  401



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   280 bits (717),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAK+KGVSLLLPTD+V+ADKFA DA SK VPASA
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKKLA+++ KG
Sbjct  291  IPDGWMGLDIGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL++A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALNDA  401



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFA DA SK+VPA+A
Sbjct  231  YKAQGYSVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAESKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPD WMGLD+GPD+ KTF++AL+TTKTVIWNGPMGVFEF KFA GTE++AKKLAEL + K
Sbjct  291  IPDDWMGLDVGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAIAKKLAELTTTK  350

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  GVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  402



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            +KAQGLSVGSSLVEEDKL LAT L+EKAK KGV+LLLPTDVV+ADKFAPDA+SK+V ASA
Sbjct  232  FKAQGLSVGSSLVEEDKLILATKLMEKAKLKGVTLLLPTDVVVADKFAPDASSKIVSASA  291

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F++AL++T T+IWNGPMGVFEF  FAVGTE++A KLAELS KG
Sbjct  292  IPDGWMGLDIGPDSIKAFSEALDSTNTIIWNGPMGVFEFKNFAVGTEAIAAKLAELSDKG  351

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LPGV ALD+A
Sbjct  352  VTTIIGGGDSVAAVEKAGVADQMSHISTGGGASLELLEGRILPGVAALDDA  402



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAK+KGVSLLLPTDVV+ADKF  +A SK+VPAS+
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKSKGVSLLLPTDVVVADKFDANAESKIVPASS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF+  L+TTKTVIWNGPMGVFEF+KFA GT+++A KLAEL+ KG
Sbjct  291  IPDGWMGLDIGPDSIKTFSQTLDTTKTVIWNGPMGVFEFEKFAAGTDAIAMKLAELTAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLANKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            +KAQGLSVGSSLVEEDKL LAT L+EKAK KGV+LLLPTDVV+ADKFAPDA+SK+V ASA
Sbjct  232  FKAQGLSVGSSLVEEDKLILATKLMEKAKLKGVTLLLPTDVVVADKFAPDASSKIVSASA  291

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F+ AL +T T+IWNGPMGVFEF  FAVGTE++A KLAELS KG
Sbjct  292  IPDGWMGLDIGPDSIKAFSQALNSTNTIIWNGPMGVFEFKNFAVGTEAIAAKLAELSDKG  351

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LPGV ALD+A
Sbjct  352  VTTIIGGGDSVAAVEKAGVADRMSHISTGGGASLELLEGRILPGVAALDDA  402



>gb|ABR25550.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=176

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASA
Sbjct  5    YKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASA  64

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEFDKFA GT+++AKKLA+L + K
Sbjct  65   IPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFDKFAAGTDAIAKKLADLTTTK  124

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            G TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  125  GATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  176



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVG SLVEEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFA DA SK+VPA+A
Sbjct  401  YKAQGYSVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAESKIVPATA  460

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPD WMGLD+GPD+ KTF++AL+TTKTVIWNGPMGVFEF KFA GTE++AKKLAEL + K
Sbjct  461  IPDDWMGLDVGPDATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAIAKKLAELTTTK  520

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  521  GVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  572



>gb|EMT08517.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=401

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LA SL+EKAK+KGVSLLLPTD+V+AD FA DA SK+VPASA
Sbjct  231  YKAQGHAVGKSLVEEDKLELANSLIEKAKSKGVSLLLPTDIVVADNFAADAESKIVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKKLA+++ KG
Sbjct  291  IPDGWMGLDIGPDSIKKFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LPGV++LD A
Sbjct  351  VTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLPGVLSLDNA  401



>gb|ABR16231.1| unknown [Picea sitchensis]
Length=472

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  719  GLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDG  540
            G  V SSLVE+DK+ LA++L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDG
Sbjct  301  GSKVSSSLVEDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDG  360

Query  539  WMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKGVTTI  360
            WMGLDIG DS+KTF++AL+TTKTVIWNGPMGVFEFDKF++GT S+AKKLAELSGKGVTTI
Sbjct  361  WMGLDIGADSIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSIAKKLAELSGKGVTTI  420

Query  359  IGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEAVPV  210
            IGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+AVPV
Sbjct  421  IGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLALDDAVPV  470



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKA +KGVSLLLPTDVV+ADKF  DA SK V ASA
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKANSKGVSLLLPTDVVVADKFTADAESKTVLASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKKLA+++ KG
Sbjct  291  IPDGWMGLDIGPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVE+DKL LA SL+EKAK+KGVSLLLPTD+V+A+ FA DA SK VPASA
Sbjct  231  YKAQGHAVGKSLVEDDKLELANSLIEKAKSKGVSLLLPTDIVVANNFAADAESKTVPASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS++ F++ L+TTKTVIWNGPMGVFEF+KFA GT+++AKKLA+++ +G
Sbjct  291  IPDGWMGLDIGPDSIRKFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAQG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 158/199 (79%), Gaps = 28/199 (14%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV-----  567
            YKAQG S+GSSLVEEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKV     
Sbjct  231  YKAQGYSIGSSLVEEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVCIIVR  290

Query  566  -----------------------VPASAIPDGWMGLDIGPDSVKTFNDALETTKTVIWNG  456
                                   VPAS I DGWMGLDIGPDS+KTF++AL+TTKT+IWNG
Sbjct  291  LNYVHSLEYVHVNLLFSAIFLQVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNG  350

Query  455  PMGVFEFDKFAVGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGA  276
            PMGVFEF+KFA GTE++A KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGA
Sbjct  351  PMGVFEFEKFAAGTEAIAWKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGA  410

Query  275  SLELLEGKELPGVIALDEA  219
            SLELLEGK LPGV+ALD+A
Sbjct  411  SLELLEGKPLPGVLALDDA  429



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASA
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IP+GWMGLD+GPD++KTF+ AL+T  T+IWNGPMGVFEF+KFA GT+++AKKLAEL + K
Sbjct  291  IPEGWMGLDVGPDAIKTFSGALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLAELTTTK  350

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  GVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|WP_015184203.1| phosphoglycerate kinase [Microcoleus sp. PCC 7113]
 gb|AFZ20067.1| 3-phosphoglycerate kinase [Microcoleus sp. PCC 7113]
Length=401

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA SL  KAK +GV+LLLPTDVV+AD FAPDANS+ V   +
Sbjct  231  YKARGLSVGKSLVEEDKLELAKSLEAKAKERGVALLLPTDVVVADNFAPDANSQTVSIDS  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F DAL   KTVIWNGPMGVFEFDKFAVGTE++A  +A+L+ +G
Sbjct  291  IPDGWMGLDIGPDSVKVFQDALSDCKTVIWNGPMGVFEFDKFAVGTEAIAHTMADLTKQG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  351  ATTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKELPGITALDDA  401



>ref|WP_035992253.1| phosphoglycerate kinase [Leptolyngbya sp. KIOST-1]
Length=401

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GL+VG SLVEEDKL LA +L  KAK KGV LLLPTDVV+AD FA DANS+ V   A
Sbjct  231  YKARGLAVGKSLVEEDKLELAKALEAKAKEKGVDLLLPTDVVLADNFAADANSQTVSVDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F DAL+  K+VIWNGPMGVFEFDKFAVGTE++A  LAEL+G G
Sbjct  291  IPDGWMGLDIGPDSVKVFQDALKQCKSVIWNGPMGVFEFDKFAVGTEAIAHTLAELTGTG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKELPGIAALDDA  401



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGL+VG SLVEEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA SK+VPA+A
Sbjct  231  YKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLD+GPDS+KTF +AL+TTKTVIWNGPMGVFEF+KFA GT+++AK+LAEL+GKG
Sbjct  291  IPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  243
            VTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  351  VTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393



>ref|WP_017300589.1| phosphoglycerate kinase [Nodosilinea nodulosa]
Length=401

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GL+VG SLVEEDKL LA SL  KAK KGV LLLPTDVV+AD FAPDAN++ V   A
Sbjct  231  YKARGLNVGKSLVEEDKLELAKSLEAKAKEKGVDLLLPTDVVLADNFAPDANAQTVSVEA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F DAL+  K+VIWNGPMGVFEFDKFA GTE++A  LAEL+  G
Sbjct  291  IPDGWMGLDIGPDSIKVFQDALKQCKSVIWNGPMGVFEFDKFAAGTEAIAHTLAELTDTG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  351  VTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKELPGIAALDDA  401



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASA
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEF+KFA GT+++AKKLA+L + K
Sbjct  291  IPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTK  350

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            G TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  GATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|WP_011377868.1| MULTISPECIES: phosphoglycerate kinase [Synechococcus]
 sp|Q31P73.1|PGK_SYNE7 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 7942]
 gb|ABB57146.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
 gb|AJD58338.1| phosphoglycerate kinase [Synechococcus sp. UTEX 2973]
Length=402

 Score =   267 bits (683),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVG SLVEEDKL LA SL+ KA+ KGV LLLP DVV+ADKFAPDAN+K V   A
Sbjct  231  YKAQGLSVGGSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVK F +AL   ++VIWNGPMGVFEFD+FAVGTE++A+ LA L+ KG
Sbjct  291  IPDGWMGLDIGPESVKQFEEALADCRSVIWNGPMGVFEFDQFAVGTEAIARSLAGLTRKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  351  ATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAALDDA  401



>gb|AAC32142.1| phosphoglycerate kinase [Picea mariana]
Length=151

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -1

Query  656  EKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTFNDALETT  477
            +KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIG DS+KTF++AL+TT
Sbjct  1    KKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGADSIKTFSEALDTT  60

Query  476  KTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSH  297
            KTVIWNGPMGVFEFDKF++GT S+AKKLAELSGKGVTTIIGGGDSVAAVEKVGVA  MSH
Sbjct  61   KTVIWNGPMGVFEFDKFSLGTTSIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVAEKMSH  120

Query  296  ISTGGGASLELLEGKELPGVIALDEAVPV  210
            ISTGGGASLELLEGK LPGV+ALDEAVPV
Sbjct  121  ISTGGGASLELLEGKTLPGVLALDEAVPV  149



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA S+ V ASA
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESRTVAASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEF+KFA GT+++AKKLA+L + K
Sbjct  291  IPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTK  350

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            G TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  GATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>dbj|BAA21478.1| phosphoglycerate kinase [Robinia pseudoacacia]
Length=229

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG SVGSSLVEEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFA DANSKVVPAS+
Sbjct  79   YKAQGHSVGSSLVEEDKLDLANSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASS  138

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD++KTF++ L+ T+++IWNGPMGVFEFDKFA GTE++AKKLAELSGKG
Sbjct  139  IPDGWMGLDIGPDAIKTFSETLDKTQSIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKG  198

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGG  279
            VTTIIGGGDSVAAVEKVG+A  MSHISTGGG
Sbjct  199  VTTIIGGGDSVAAVEKVGLADKMSHISTGGG  229



>ref|WP_011242745.1| phosphoglycerate kinase [Synechococcus elongatus]
 sp|Q5N4Z6.1|PGK_SYNP6 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 6301]
 dbj|BAD78623.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
Length=402

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVG SLVEEDKL LA SL+ KA+ KGV LLLP DVV+ADKFAPDAN+K V   A
Sbjct  231  YKAQGLSVGGSLVEEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVK F  AL   ++VIWNGPMGVFEFD+FAVGTE++A+ LA L+ KG
Sbjct  291  IPDGWMGLDIGPESVKQFEGALADCRSVIWNGPMGVFEFDQFAVGTEAIARSLAGLTRKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  351  ATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAALDDA  401



>ref|WP_016865730.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+AD FA DANS+ V    
Sbjct  230  YKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAADANSQTVSIEN  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F DAL   KTV+WNGPMGVFEFDKFAVGTE++A+ LA+LS KG
Sbjct  290  IPDGWMGLDIGPDSVKLFQDALADCKTVVWNGPMGVFEFDKFAVGTEAIARTLADLSKKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  350  ATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>ref|WP_041032823.1| phosphoglycerate kinase [Tolypothrix campylonemoides]
 gb|KIJ78650.1| phosphoglycerate kinase [Tolypothrix campylonemoides VB511288]
Length=400

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            +KA+GL+VG SLVEEDKL LA SL  KAK +GV LLLPTDVV+AD FAPDANS+ V    
Sbjct  230  FKARGLNVGKSLVEEDKLELAKSLEAKAKERGVDLLLPTDVVVADNFAPDANSQTVSVEN  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGP+SVK F  AL  TKTVIWNGPMGVFEFDKFAVGTE++A+ LA++S  G
Sbjct  290  IPDGWMGLDIGPESVKFFQQALADTKTVIWNGPMGVFEFDKFAVGTEAIARTLADISKTG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALDEA
Sbjct  350  ATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALDEA  400



>ref|WP_039728851.1| MULTISPECIES: phosphoglycerate kinase [Oscillatoriophycideae]
 gb|KIF16377.1| phosphoglycerate kinase [Aphanocapsa montana BDHKU210001]
 gb|KIF41302.1| phosphoglycerate kinase [Lyngbya confervoides BDU141951]
Length=401

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA +L  KAK KGV LLLPTDVV+AD FAPDAN++ V   A
Sbjct  231  YKARGLSVGKSLVEEDKLELAKALEAKAKEKGVELLLPTDVVVADNFAPDANAQTVSIEA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPD+VK F +AL+  K+VIWNGPMGVFEFDKFA GTE++A  LAEL+  G
Sbjct  291  IPDGWMGLDIGPDAVKVFQEALKQCKSVIWNGPMGVFEFDKFAAGTEAIAHTLAELTPSG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  351  VTTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKTLPGIAALDEA  401



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQG +VG SLVEEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASA
Sbjct  231  YKAQGYAVGKSLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAEL-SGK  375
            IPDGWMGLD+GPD++KT ++AL+T  T+IWNGPMGVFEF+K A GT+++AKKLA+L + K
Sbjct  291  IPDGWMGLDVGPDAIKTSSEALDTCNTIIWNGPMGVFEFEKLAAGTDAIAKKLADLTTTK  350

Query  374  GVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            G TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALDEA
Sbjct  351  GATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA  402



>ref|WP_029637902.1| phosphoglycerate kinase [[Scytonema hofmanni] UTEX B 1581]
Length=400

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GL+VG SLVEEDK+ LA SL  KAK +GV LLLPTDVV+ADKFAPDANS+ V    
Sbjct  230  YKARGLNVGKSLVEEDKIELAKSLEAKAKERGVDLLLPTDVVVADKFAPDANSQTVSIEN  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F +AL   KTVIWNGPMGVFEFDKFA GTE++A  LA++S KG
Sbjct  290  IPDGWMGLDIGPDSIKVFQEALADCKTVIWNGPMGVFEFDKFAAGTEAIAHTLADISKKG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
              TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALD+A
Sbjct  350  AITIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALDDA  400



>ref|WP_015166011.1| phosphoglycerate kinase [Pseudanabaena sp. PCC 7367]
 gb|AFY71055.1| phosphoglycerate kinase [Pseudanabaena sp. PCC 7367]
Length=401

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GL+VG SLVEEDKL LA SL  KAK +GV LLLPTDVV+AD F+PDANS+ V   +
Sbjct  231  YKARGLAVGKSLVEEDKLDLAKSLEAKAKERGVDLLLPTDVVVADNFSPDANSQTVSIES  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTF  AL    TVIWNGPMGVFEFDKFAVGTE++A  LAEL+GKG
Sbjct  291  IPDGWMGLDIGPDSVKTFQAALADCMTVIWNGPMGVFEFDKFAVGTEAIAHSLAELTGKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
              TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  351  AITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGIAALDDA  401



>ref|WP_011936642.1| phosphoglycerate kinase [Synechococcus sp. RCC307]
 sp|A5GW73.1|PGK_SYNR3 RecName: Full=Phosphoglycerate kinase [Synechococcus sp. RCC307]
 emb|CAK29132.1| Phosphoglycerate kinase [Synechococcus sp. RCC307]
Length=402

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA  L  KAKAKGV LLLPTDVV+AD FAPDANS+V    A
Sbjct  231  YKARGLSVGKSLVEEDKLELAKELEAKAKAKGVQLLLPTDVVLADNFAPDANSQVASIDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IP+GWMGLDIGPDS+K F DAL   KTVIWNGPMGVFEFDKFA GT ++A  LAELS KG
Sbjct  291  IPEGWMGLDIGPDSIKVFQDALGDCKTVIWNGPMGVFEFDKFAAGTNAIATTLAELSAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
              TIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  351  CCTIIGGGDSVAAVEKAGLAAQMSHISTGGGASLELLEGKVLPGVAALDEA  401



>ref|WP_026734580.1| phosphoglycerate kinase [Fischerella sp. PCC 9605]
Length=400

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GL+VG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+ADKFA DANS+ V    
Sbjct  230  YKARGLNVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAADANSQTVSVEN  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F +AL   KT+IWNGPMGVFEFDKFAVGTE++A+ LA+LS  G
Sbjct  290  IPDGWMGLDIGPDSVKLFQEALSDCKTIIWNGPMGVFEFDKFAVGTEAIARTLADLSKNG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  350  ATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>ref|WP_016924803.1| phosphoglycerate kinase [Prochlorothrix hollandica]
Length=401

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GL+VGSSLVEEDKL LA +L  KAK KGV LLLPTDVV+ADKFA DAN+K V   A
Sbjct  231  YKARGLAVGSSLVEEDKLELAQALEAKAKEKGVELLLPTDVVVADKFAADANAKTVAVDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+KTF +AL+T K+VIWNGPMGVFEF +FA GTE VAK LA L+ +G
Sbjct  291  IPDGWMGLDIGPDSLKTFQEALKTCKSVIWNGPMGVFEFPQFAAGTEGVAKTLASLTPQG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
            VTTIIGGGDSVAAVE+VG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  351  VTTIIGGGDSVAAVEQVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  401



>ref|WP_026097925.1| phosphoglycerate kinase [Geitlerinema sp. PCC 7105]
Length=401

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            +KA+GLSVG SLVEEDKL LA +L  KAK +GV LLLPTDV++AD FAPDAN + V   A
Sbjct  231  FKARGLSVGKSLVEEDKLELAKALEAKAKERGVELLLPTDVIVADNFAPDANDRTVAVDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTF DAL   K+VIWNGPMGVFEF+KFA GTE++A+ LA+L+G+G
Sbjct  291  IPDGWMGLDIGPDSVKTFQDALADCKSVIWNGPMGVFEFEKFAKGTEAIARTLADLTGQG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  351  TTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGIAALDDA  401



>gb|KIZ02489.1| phosphoglycerate kinase [Monoraphidium neglectum]
Length=176

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+G SVGSSLVEE++L LAT L   AK KGV LLLPTDVVIADKFAPDAN+++V A A
Sbjct  6    YKARGYSVGSSLVEEEQLDLATKLEALAKEKGVELLLPTDVVIADKFAPDANTQIVAADA  65

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDS+K F DAL  TKTV+WNGPMGVFEFD FA GT ++A  LAE++ KG
Sbjct  66   IPDGWMGLDIGPDSIKLFQDALADTKTVVWNGPMGVFEFDAFAKGTIAIADTLAEITPKG  125

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDE  222
              TIIGGGDSVAAVEK GVAS MSHISTGGGASLELLEG+ LPGV ALDE
Sbjct  126  AITIIGGGDSVAAVEKAGVASKMSHISTGGGASLELLEGRVLPGVAALDE  175



>ref|WP_035831895.1| phosphoglycerate kinase [Cyanobium sp. CACIAM 14]
 gb|KEF41737.1| phosphoglycerate kinase [Cyanobium sp. CACIAM 14]
Length=401

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            +KA+GL+VG SLVEEDKL LA  L  KA AKGV LLLPTDVV+AD FAPDANS   P  A
Sbjct  231  FKARGLAVGKSLVEEDKLELARELEAKAAAKGVQLLLPTDVVLADNFAPDANSMTTPIDA  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IP+GWMGLDIGPDSVKTF DAL   +TVIWNGPMGVFEFD+FA GT ++A  LA+LS KG
Sbjct  291  IPEGWMGLDIGPDSVKTFQDALADCQTVIWNGPMGVFEFDRFAAGTNAIAHTLADLSAKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
              TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  351  CCTIIGGGDSVAAVEKVGVADRMSHISTGGGASLELLEGKVLPGVAALDEA  401



>ref|WP_017309094.1| MULTISPECIES: phosphoglycerate kinase [Stigonematales]
 gb|KIY12309.1| phosphoglycerate kinase [Mastigocladus laminosus UU774]
Length=400

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+ADKFAPDANS+ V    
Sbjct  230  YKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAPDANSQTVSIEN  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F DAL   K+V+WNGPMGVFEFDKFAVGTE++A  LA++   G
Sbjct  290  IPDGWMGLDIGPDSVKLFQDALADCKSVVWNGPMGVFEFDKFAVGTEAIAHTLADIGKNG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  350  ATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>ref|WP_006105635.1| phosphoglycerate kinase [Coleofasciculus chthonoplastes]
 gb|EDX71471.1| phosphoglycerate kinase [Coleofasciculus chthonoplastes PCC 7420]
Length=401

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA SL  KAK KGV LLLPTDVV+AD FA DANS+ V   +
Sbjct  231  YKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVDLLLPTDVVVADNFAADANSQTVSVES  290

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F DAL   K+VIWNGPMGVFEFDKFA GTE++A+ LA+L+ KG
Sbjct  291  IPDGWMGLDIGPDSVKFFQDALGDCKSVIWNGPMGVFEFDKFAAGTEAIARTLADLTKKG  350

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  351  TTTIIGGGDSVAAVEKVGVADQMSHISTGGGASLELLEGKVLPGIAALDDA  401



>gb|AFH41108.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41121.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>ref|WP_016861411.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKA+GLSVG SLVEEDKL LA SL  KAK KGV+ LLPTDVV+AD FAPDANS+ V    
Sbjct  230  YKARGLSVGKSLVEEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAPDANSQTVSIEN  289

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVK F DAL   K+V+WNGPMGVFEFDKFAVGTE++A+ LA++   G
Sbjct  290  IPDGWMGLDIGPDSVKLFQDALADCKSVVWNGPMGVFEFDKFAVGTEAIARTLADIGKNG  349

Query  371  VTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  219
             TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  350  ATTIIGGGDSVAAVEKVGLAEQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>gb|AFH41102.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41131.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AAM51702.1|AF343476_1 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AAM51706.1|AF343480_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51716.1|AF343490_1 3-phosphoglycerate kinase, partial [Aegilops speltoides var. 
ligustica]
 gb|AFH41077.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41080.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41082.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii x Triticum turgidum subsp. polonicum]
 gb|AFH41085.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41090.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41093.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41096.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
 gb|AFH41098.1| plastid 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AFH41100.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41105.1| plastid 3-phosphoglycerate kinase, partial [Triticum macha]
 gb|AFH41111.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41113.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41116.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41119.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41126.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41129.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41132.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41134.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41136.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41138.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41143.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41146.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41151.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41154.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AID16251.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
 gb|AID16258.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16264.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16267.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16269.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AAM51700.1|AF343474_1 3-phosphoglycerate kinase, partial [Triticum urartu]
 gb|AAM51701.1|AF343475_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51703.1|AF343477_1 3-phosphoglycerate kinase, partial [Triticum timopheevii subsp. 
armeniacum]
 gb|AAM51704.1|AF343478_1 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AAM51705.1|AF343479_1 3-phosphoglycerate kinase, partial [Aegilops tauschii subsp. 
tauschii]
 gb|AAM51707.1|AF343481_1 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AAM51711.1|AF343485_1 3-phosphoglycerate kinase, partial [Aegilops bicornis]
 gb|AAM51712.1|AF343486_1 3-phosphoglycerate kinase, partial [Aegilops sharonensis]
 gb|AAM51713.1|AF343487_1 3-phosphoglycerate kinase, partial [Aegilops longissima]
 gb|AAM51714.1|AF343488_1 3-phosphoglycerate kinase, partial [Triticum timopheevii subsp. 
armeniacum]
 gb|AAM51715.1|AF343489_1 3-phosphoglycerate kinase, partial [Aegilops searsii]
 gb|AAM51718.1|AF343492_1 3-phosphoglycerate kinase, partial [Aegilops speltoides subsp. 
speltoides]
 gb|ACO40252.1| 3-phosphoglycerate kinase, partial [Taeniatherum caput-medusae]
 gb|ACO40253.1| 3-phosphoglycerate kinase, partial [Triticum monococcum]
 gb|AFH41072.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii]
 gb|AFH41075.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41076.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41078.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41079.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. durum]
 gb|AFH41083.1| plastid 3-phosphoglycerate kinase, partial [Aegilops tauschii 
subsp. tauschii x Triticum turgidum subsp. polonicum]
 gb|AFH41086.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41087.1| plastid 3-phosphoglycerate kinase, partial [Triticum carthlicum]
 gb|AFH41089.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41094.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41097.1| plastid 3-phosphoglycerate kinase, partial [Triticum dicoccoides]
 gb|AFH41103.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AFH41107.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41109.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41110.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41112.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41114.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41115.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41117.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41118.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41120.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41122.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41123.1| plastid 3-phosphoglycerate kinase, partial [Triticum polonicum]
 gb|AFH41125.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41127.1| plastid 3-phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AFH41133.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum 
subsp. turanicum]
 gb|AFH41135.1| plastid 3-phosphoglycerate kinase, partial [Triticum turgidum]
 gb|AFH41141.1| plastid 3-phosphoglycerate kinase, partial [Triticum sphaerococcum]
 gb|AFH41142.1| plastid 3-phosphoglycerate kinase, partial [Triticum spelta]
 gb|AFH41145.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41147.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. tibeticum]
 gb|AFH41148.1| plastid 3-phosphoglycerate kinase, partial [Triticum timopheevii]
 gb|AFH41150.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41152.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AFH41153.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum 
subsp. yunnanense]
 gb|AID16245.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16247.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16250.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16254.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16256.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16257.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16259.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16260.1| phosphoglycerate kinase, partial [Triticum petropavlovskyi]
 gb|AID16263.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16265.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16266.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16268.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
 gb|AID16270.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
 gb|AID16271.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41091.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
 gb|AFH41092.1| plastid 3-phosphoglycerate kinase, partial [Triticum compactum]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AID16252.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. yunnanense]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



>gb|AFH41101.1| plastid 3-phosphoglycerate kinase, partial [Triticum aestivum]
 gb|AID16248.1| phosphoglycerate kinase, partial [Triticum aestivum subsp. tibeticum]
Length=298

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  731  YKAQGLSVGSSLVEEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASA  552
            YKAQGLSVGSSLVEEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASA
Sbjct  157  YKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASA  216

Query  551  IPDGWMGLDIGPDSVKTFNDALETTKTVIWNGPMGVFEFDKFAVGTESVAKKLAELSGKG  372
            IPDGWMGLDIGPDSVKTFNDAL+TT+T+IWNGPMGVFEFDKFAVGTES+AKKLAELS KG
Sbjct  217  IPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKG  276

Query  371  VTTIIGGGDSVAAVEKVGVASV  306
            VTTIIGGGDSVAAVEKVGVA V
Sbjct  277  VTTIIGGGDSVAAVEKVGVADV  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470