BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051N15

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778974.1|  PREDICTED: katanin p80 WD40 repeat-containin...    160   7e-41   Nicotiana sylvestris
ref|XP_009778973.1|  PREDICTED: katanin p80 WD40 repeat-containin...    160   8e-41   Nicotiana sylvestris
ref|XP_006347178.1|  PREDICTED: katanin p80 WD40 repeat-containin...    160   1e-40   
ref|XP_009593363.1|  PREDICTED: katanin p80 WD40 repeat-containin...    158   6e-40   Nicotiana tomentosiformis
ref|XP_009593301.1|  PREDICTED: katanin p80 WD40 repeat-containin...    158   6e-40   Nicotiana tomentosiformis
ref|XP_010316710.1|  PREDICTED: katanin p80 WD40 repeat-containin...    156   3e-39   Solanum lycopersicum
ref|XP_004232826.1|  PREDICTED: katanin p80 WD40 repeat-containin...    156   3e-39   Solanum lycopersicum
ref|XP_002521412.1|  katanin P80 subunit, putative                      154   1e-38   
emb|CDO99605.1|  unnamed protein product                                153   1e-38   Coffea canephora [robusta coffee]
emb|CBI35743.3|  unnamed protein product                                147   2e-38   Vitis vinifera
ref|XP_007025733.1|  Katanin P80 subunit, putative isoform 1            153   3e-38   
gb|KDP20912.1|  hypothetical protein JCGZ_21383                         152   8e-38   Jatropha curcas
gb|KJB68607.1|  hypothetical protein B456_010G254700                    150   1e-37   Gossypium raimondii
ref|XP_010647331.1|  PREDICTED: katanin p80 WD40 repeat-containin...    150   1e-37   
gb|KJB68606.1|  hypothetical protein B456_010G254700                    150   2e-37   Gossypium raimondii
ref|XP_011096279.1|  PREDICTED: katanin p80 WD40 repeat-containin...    150   2e-37   Sesamum indicum [beniseed]
ref|XP_011043252.1|  PREDICTED: katanin p80 WD40 repeat-containin...    150   2e-37   Populus euphratica
gb|KJB68608.1|  hypothetical protein B456_010G254700                    150   2e-37   Gossypium raimondii
gb|KJB68609.1|  hypothetical protein B456_010G254700                    150   2e-37   Gossypium raimondii
ref|XP_006377307.1|  hypothetical protein POPTR_0011s04530g             150   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011043253.1|  PREDICTED: katanin p80 WD40 repeat-containin...    150   3e-37   Populus euphratica
ref|XP_010647505.1|  PREDICTED: katanin p80 WD40 repeat-containin...    146   7e-37   
ref|XP_010057472.1|  PREDICTED: katanin p80 WD40 repeat-containin...    148   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006594334.1|  PREDICTED: katanin p80 WD40 repeat-containin...    147   2e-36   Glycine max [soybeans]
ref|XP_010057471.1|  PREDICTED: katanin p80 WD40 repeat-containin...    148   2e-36   Eucalyptus grandis [rose gum]
ref|XP_003541552.1|  PREDICTED: katanin p80 WD40 repeat-containin...    147   2e-36   
gb|EYU27954.1|  hypothetical protein MIMGU_mgv1a001351mg                147   3e-36   Erythranthe guttata [common monkey flower]
ref|XP_003543076.1|  PREDICTED: katanin p80 WD40 repeat-containin...    146   6e-36   Glycine max [soybeans]
gb|KHN46320.1|  Katanin p80 WD40 repeat-containing subunit B1 like 1    145   8e-36   Glycine soja [wild soybean]
ref|XP_008442151.1|  PREDICTED: katanin p80 WD40 repeat-containin...    146   9e-36   Cucumis melo [Oriental melon]
ref|XP_008442143.1|  PREDICTED: katanin p80 WD40 repeat-containin...    146   9e-36   Cucumis melo [Oriental melon]
gb|KGN64638.1|  hypothetical protein Csa_1G072490                       145   2e-35   Cucumis sativus [cucumbers]
ref|XP_003545861.1|  PREDICTED: katanin p80 WD40 repeat-containin...    144   2e-35   Glycine max [soybeans]
ref|XP_004158060.1|  PREDICTED: katanin p80 WD40 repeat-containin...    145   2e-35   
ref|XP_004146637.1|  PREDICTED: katanin p80 WD40 repeat-containin...    145   2e-35   
ref|XP_006467862.1|  PREDICTED: katanin p80 WD40 repeat-containin...    144   3e-35   Citrus sinensis [apfelsine]
ref|XP_006467863.1|  PREDICTED: katanin p80 WD40 repeat-containin...    144   3e-35   Citrus sinensis [apfelsine]
ref|XP_006467861.1|  PREDICTED: katanin p80 WD40 repeat-containin...    144   4e-35   Citrus sinensis [apfelsine]
ref|XP_004293499.1|  PREDICTED: katanin p80 WD40 repeat-containin...    143   5e-35   Fragaria vesca subsp. vesca
gb|KDO75818.1|  hypothetical protein CISIN_1g001462mg                   144   7e-35   Citrus sinensis [apfelsine]
ref|XP_007148216.1|  hypothetical protein PHAVU_006G189900g             142   1e-34   Phaseolus vulgaris [French bean]
ref|XP_006597408.1|  PREDICTED: katanin p80 WD40 repeat-containin...    141   1e-34   Glycine max [soybeans]
ref|XP_010278330.1|  PREDICTED: katanin p80 WD40 repeat-containin...    142   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009378641.1|  PREDICTED: katanin p80 WD40 repeat-containin...    142   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_007213652.1|  hypothetical protein PRUPE_ppa001393mg             141   2e-34   Prunus persica
ref|XP_006583803.1|  PREDICTED: katanin p80 WD40 repeat-containin...    141   2e-34   
gb|KJB69456.1|  hypothetical protein B456_011G024400                    142   2e-34   Gossypium raimondii
ref|XP_008224984.1|  PREDICTED: katanin p80 WD40 repeat-containin...    141   2e-34   Prunus mume [ume]
ref|XP_008224985.1|  PREDICTED: katanin p80 WD40 repeat-containin...    141   3e-34   Prunus mume [ume]
ref|XP_008224983.1|  PREDICTED: katanin p80 WD40 repeat-containin...    141   3e-34   Prunus mume [ume]
ref|XP_009378573.1|  PREDICTED: katanin p80 WD40 repeat-containin...    141   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_011460265.1|  PREDICTED: katanin p80 WD40 repeat-containin...    140   3e-34   Fragaria vesca subsp. vesca
ref|XP_006449267.1|  hypothetical protein CICLE_v10014112mg             141   6e-34   Citrus clementina [clementine]
ref|XP_009378713.1|  PREDICTED: katanin p80 WD40 repeat-containin...    139   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_008371311.1|  PREDICTED: katanin p80 WD40 repeat-containin...    139   1e-33   
ref|XP_008371310.1|  PREDICTED: katanin p80 WD40 repeat-containin...    139   2e-33   
ref|XP_007159273.1|  hypothetical protein PHAVU_002G224100g             135   9e-33   Phaseolus vulgaris [French bean]
ref|XP_007159274.1|  hypothetical protein PHAVU_002G224100g             135   2e-32   Phaseolus vulgaris [French bean]
ref|XP_011087019.1|  PREDICTED: katanin p80 WD40 repeat-containin...    136   2e-32   Sesamum indicum [beniseed]
ref|XP_010696580.1|  PREDICTED: katanin p80 WD40 repeat-containin...    135   3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696579.1|  PREDICTED: katanin p80 WD40 repeat-containin...    135   3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696578.1|  PREDICTED: katanin p80 WD40 repeat-containin...    135   4e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO75817.1|  hypothetical protein CISIN_1g001462mg                   135   7e-32   Citrus sinensis [apfelsine]
gb|KJB34818.1|  hypothetical protein B456_006G086000                    134   1e-31   Gossypium raimondii
dbj|BAC43272.1|  unknown protein                                        125   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KJB34817.1|  hypothetical protein B456_006G086000                    133   2e-31   Gossypium raimondii
ref|XP_003593480.1|  Katanin p80 WD40-containing subunit B1             134   2e-31   
gb|AES63731.2|  katanin p80 WD40 repeat subunit B1-like protein         134   2e-31   Medicago truncatula
ref|XP_010547296.1|  PREDICTED: katanin p80 WD40 repeat-containin...    130   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010547289.1|  PREDICTED: katanin p80 WD40 repeat-containin...    130   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010547320.1|  PREDICTED: katanin p80 WD40 repeat-containin...    130   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010547314.1|  PREDICTED: katanin p80 WD40 repeat-containin...    130   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010547304.1|  PREDICTED: katanin p80 WD40 repeat-containin...    130   2e-30   Tarenaya hassleriana [spider flower]
emb|CDY52222.1|  BnaA01g35940D                                          128   2e-29   Brassica napus [oilseed rape]
ref|XP_009104461.1|  PREDICTED: katanin p80 WD40 repeat-containin...    128   2e-29   Brassica rapa
ref|XP_009104469.1|  PREDICTED: katanin p80 WD40 repeat-containin...    127   2e-29   Brassica rapa
ref|XP_008776508.1|  PREDICTED: katanin p80 WD40 repeat-containin...    125   8e-29   Phoenix dactylifera
ref|NP_176316.4|  protein DWD hypersensitive to ABA 3                   126   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185277.1|  protein DWD hypersensitive to ABA 3                126   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430118.1|  PREDICTED: katanin p80 WD40 repeat-containin...    125   2e-28   
ref|XP_010473325.1|  PREDICTED: katanin p80 WD40 repeat-containin...    125   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010473326.1|  PREDICTED: katanin p80 WD40 repeat-containin...    125   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010933308.1|  PREDICTED: katanin p80 WD40 repeat-containin...    124   2e-28   Elaeis guineensis
ref|XP_010933310.1|  PREDICTED: katanin p80 WD40 repeat-containin...    124   2e-28   Elaeis guineensis
ref|XP_010933307.1|  PREDICTED: katanin p80 WD40 repeat-containin...    124   2e-28   Elaeis guineensis
ref|XP_010933311.1|  PREDICTED: katanin p80 WD40 repeat-containin...    123   2e-28   Elaeis guineensis
gb|EPS68225.1|  hypothetical protein M569_06544                         124   3e-28   Genlisea aurea
ref|XP_006300659.1|  hypothetical protein CARUB_v10019681mg             124   3e-28   Capsella rubella
ref|XP_007025735.1|  Katanin P80 subunit, putative isoform 3            124   4e-28   
ref|XP_006392030.1|  hypothetical protein EUTSA_v10023227mg             124   4e-28   
emb|CDY03812.1|  BnaC01g29290D                                          124   6e-28   
gb|KFK40724.1|  hypothetical protein AALP_AA2G032800                    123   7e-28   Arabis alpina [alpine rockcress]
gb|KFK40725.1|  hypothetical protein AALP_AA2G032800                    123   7e-28   Arabis alpina [alpine rockcress]
ref|XP_008800146.1|  PREDICTED: katanin p80 WD40 repeat-containin...    122   8e-28   Phoenix dactylifera
ref|XP_010533875.1|  PREDICTED: katanin p80 WD40 repeat-containin...    122   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010533874.1|  PREDICTED: katanin p80 WD40 repeat-containin...    122   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010533879.1|  PREDICTED: katanin p80 WD40 repeat-containin...    122   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010533878.1|  PREDICTED: katanin p80 WD40 repeat-containin...    122   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010533877.1|  PREDICTED: katanin p80 WD40 repeat-containin...    122   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010905608.1|  PREDICTED: katanin p80 WD40 repeat-containin...    120   6e-27   Elaeis guineensis
gb|ABK26032.1|  unknown                                                 113   6e-27   Picea sitchensis
ref|XP_010905607.1|  PREDICTED: katanin p80 WD40 repeat-containin...    120   7e-27   Elaeis guineensis
ref|XP_010905604.1|  PREDICTED: katanin p80 WD40 repeat-containin...    120   9e-27   Elaeis guineensis
ref|XP_009418645.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007025736.1|  Transducin/WD40 repeat-like superfamily prot...    119   2e-26   
ref|XP_010492426.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   2e-26   
ref|XP_006848621.1|  hypothetical protein AMTR_s00171p00033150          118   2e-26   
gb|KHG05933.1|  hypothetical protein F383_10434                         119   2e-26   Gossypium arboreum [tree cotton]
ref|XP_010492410.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   2e-26   
emb|CDY34658.1|  BnaC08g42170D                                          118   2e-26   Brassica napus [oilseed rape]
ref|XP_010492441.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010492450.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010492433.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010492418.1|  PREDICTED: katanin p80 WD40 repeat-containin...    119   3e-26   
emb|CDY15006.1|  BnaCnng04090D                                          118   3e-26   Brassica napus [oilseed rape]
ref|NP_172582.2|  WD40 domain-containing protein                        118   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417385.1|  hypothetical protein EUTSA_v10006699mg             118   4e-26   
ref|XP_002889852.1|  hypothetical protein ARALYDRAFT_471250             118   4e-26   
ref|XP_006468674.1|  PREDICTED: katanin p80 WD40 repeat-containin...    117   5e-26   Citrus sinensis [apfelsine]
ref|XP_006468672.1|  PREDICTED: katanin p80 WD40 repeat-containin...    117   5e-26   Citrus sinensis [apfelsine]
gb|KDO77056.1|  hypothetical protein CISIN_1g003448mg                   117   5e-26   Citrus sinensis [apfelsine]
ref|XP_006306661.1|  hypothetical protein CARUB_v10008176mg             117   5e-26   
gb|KDO77058.1|  hypothetical protein CISIN_1g003448mg                   117   5e-26   Citrus sinensis [apfelsine]
gb|KFK43409.1|  hypothetical protein AALP_AA1G122100                    116   1e-25   Arabis alpina [alpine rockcress]
gb|KDO77060.1|  hypothetical protein CISIN_1g003448mg                   115   2e-25   Citrus sinensis [apfelsine]
ref|XP_009118200.1|  PREDICTED: katanin p80 WD40 repeat-containin...    116   2e-25   Brassica rapa
ref|XP_009118199.1|  PREDICTED: katanin p80 WD40 repeat-containin...    116   2e-25   Brassica rapa
emb|CDY34846.1|  BnaA09g47720D                                          116   2e-25   Brassica napus [oilseed rape]
gb|KFK43408.1|  hypothetical protein AALP_AA1G122100                    116   2e-25   Arabis alpina [alpine rockcress]
ref|XP_010274906.1|  PREDICTED: katanin p80 WD40 repeat-containin...    115   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010458498.1|  PREDICTED: katanin p80 WD40 repeat-containin...    116   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010458499.1|  PREDICTED: katanin p80 WD40 repeat-containin...    116   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006448506.1|  hypothetical protein CICLE_v10014294mg             115   3e-25   Citrus clementina [clementine]
ref|XP_009392834.1|  PREDICTED: katanin p80 WD40 repeat-containin...    114   6e-25   
ref|XP_009392835.1|  PREDICTED: katanin p80 WD40 repeat-containin...    114   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918467.1|  PREDICTED: katanin p80 WD40 repeat-containin...    114   6e-25   
ref|XP_009392832.1|  PREDICTED: katanin p80 WD40 repeat-containin...    114   6e-25   
ref|XP_009392833.1|  PREDICTED: katanin p80 WD40 repeat-containin...    114   7e-25   
emb|CBI35338.3|  unnamed protein product                                114   1e-24   Vitis vinifera
gb|KHN07303.1|  Katanin p80 WD40 repeat-containing subunit B1 like 1    113   1e-24   Glycine soja [wild soybean]
ref|XP_008778233.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    114   1e-24   Phoenix dactylifera
ref|XP_010655954.1|  PREDICTED: katanin p80 WD40 repeat-containin...    113   1e-24   Vitis vinifera
ref|XP_010940397.1|  PREDICTED: katanin p80 WD40 repeat-containin...    113   1e-24   Elaeis guineensis
ref|XP_011463422.1|  PREDICTED: katanin p80 WD40 repeat-containin...    113   2e-24   Fragaria vesca subsp. vesca
ref|XP_011463420.1|  PREDICTED: katanin p80 WD40 repeat-containin...    113   2e-24   Fragaria vesca subsp. vesca
ref|XP_011463419.1|  PREDICTED: katanin p80 WD40 repeat-containin...    113   2e-24   Fragaria vesca subsp. vesca
ref|XP_010940396.1|  PREDICTED: katanin p80 WD40 repeat-containin...    112   2e-24   Elaeis guineensis
ref|XP_006468673.1|  PREDICTED: katanin p80 WD40 repeat-containin...    112   3e-24   Citrus sinensis [apfelsine]
gb|KDO77057.1|  hypothetical protein CISIN_1g003448mg                   112   3e-24   Citrus sinensis [apfelsine]
ref|XP_010476017.1|  PREDICTED: katanin p80 WD40 repeat-containin...    112   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010476018.1|  PREDICTED: katanin p80 WD40 repeat-containin...    112   4e-24   Camelina sativa [gold-of-pleasure]
emb|CDP16884.1|  unnamed protein product                                111   6e-24   Coffea canephora [robusta coffee]
ref|XP_007221941.1|  hypothetical protein PRUPE_ppa001553mg             111   6e-24   Prunus persica
gb|KHN27492.1|  Katanin p80 WD40 repeat-containing subunit B1 like 1    105   1e-23   Glycine soja [wild soybean]
ref|XP_010935617.1|  PREDICTED: katanin p80 WD40 repeat-containin...    110   2e-23   Elaeis guineensis
gb|KJB47123.1|  hypothetical protein B456_008G011900                    110   2e-23   Gossypium raimondii
gb|KJB47121.1|  hypothetical protein B456_008G011900                    110   2e-23   Gossypium raimondii
gb|KJB47120.1|  hypothetical protein B456_008G011900                    109   2e-23   Gossypium raimondii
ref|XP_008221114.1|  PREDICTED: katanin p80 WD40 repeat-containin...    109   4e-23   Prunus mume [ume]
ref|NP_001170410.1|  uncharacterized protein LOC100384397               105   4e-23   
gb|AFW59900.1|  hypothetical protein ZEAMMB73_759012                    103   5e-23   
ref|XP_010655958.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   6e-23   Vitis vinifera
ref|XP_007043149.1|  Transducin/WD40 repeat-like superfamily protein    109   6e-23   
ref|XP_004970183.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   7e-23   Setaria italica
ref|XP_011070501.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   8e-23   Sesamum indicum [beniseed]
ref|XP_010688600.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   8e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011463423.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   8e-23   Fragaria vesca subsp. vesca
ref|XP_006646391.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   8e-23   Oryza brachyantha
ref|XP_011463421.1|  PREDICTED: katanin p80 WD40 repeat-containin...    108   9e-23   Fragaria vesca subsp. vesca
ref|XP_010521766.1|  PREDICTED: katanin p80 WD40 repeat-containin...    107   1e-22   
gb|EYU24724.1|  hypothetical protein MIMGU_mgv1a015220mg                101   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_008802561.1|  PREDICTED: LOW QUALITY PROTEIN: katanin p80 ...    107   1e-22   Phoenix dactylifera
ref|XP_010476019.1|  PREDICTED: katanin p80 WD40 repeat-containin...    107   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_004489185.1|  PREDICTED: katanin p80 WD40 repeat-containin...    107   2e-22   Cicer arietinum [garbanzo]
ref|NP_001044436.1|  Os01g0780400                                       107   2e-22   
gb|KJB12376.1|  hypothetical protein B456_002G014900                    107   2e-22   Gossypium raimondii
ref|XP_008655324.1|  PREDICTED: uncharacterized protein LOC100384...    107   2e-22   
gb|KJB12374.1|  hypothetical protein B456_002G014900                    107   2e-22   Gossypium raimondii
ref|XP_002513719.1|  katanin P80 subunit, putative                      107   2e-22   
gb|KJB12373.1|  hypothetical protein B456_002G014900                    107   2e-22   Gossypium raimondii
ref|XP_009793706.1|  PREDICTED: katanin p80 WD40 repeat-containin...    106   3e-22   Nicotiana sylvestris
ref|XP_008655322.1|  PREDICTED: uncharacterized protein LOC100384...    106   3e-22   Zea mays [maize]
ref|XP_009793704.1|  PREDICTED: katanin p80 WD40 repeat-containin...    106   3e-22   Nicotiana sylvestris
ref|XP_008655323.1|  PREDICTED: uncharacterized protein LOC100384...    106   3e-22   Zea mays [maize]
gb|KHG00735.1|  hypothetical protein F383_07474                         106   3e-22   Gossypium arboreum [tree cotton]
gb|KHG19796.1|  hypothetical protein F383_00950                         106   3e-22   Gossypium arboreum [tree cotton]
gb|KJB47119.1|  hypothetical protein B456_008G011900                    105   6e-22   Gossypium raimondii
gb|KJB47118.1|  hypothetical protein B456_008G011900                    105   6e-22   Gossypium raimondii
gb|KJB47122.1|  hypothetical protein B456_008G011900                    105   7e-22   Gossypium raimondii
ref|XP_008663730.1|  PREDICTED: katanin p80 WD40 repeat-containin...    105   7e-22   Zea mays [maize]
gb|KJB31921.1|  hypothetical protein B456_005G214400                    105   7e-22   Gossypium raimondii
gb|KEH24722.1|  katanin p80 WD40 repeat subunit B1-like protein         105   7e-22   Medicago truncatula
ref|XP_004147132.1|  PREDICTED: katanin p80 WD40 repeat-containin...    105   8e-22   
ref|XP_008445915.1|  PREDICTED: katanin p80 WD40 repeat-containin...    105   9e-22   Cucumis melo [Oriental melon]
ref|XP_008445914.1|  PREDICTED: katanin p80 WD40 repeat-containin...    105   1e-21   Cucumis melo [Oriental melon]
gb|KGN51580.1|  hypothetical protein Csa_5G580650                       105   1e-21   Cucumis sativus [cucumbers]
ref|XP_008655321.1|  PREDICTED: uncharacterized protein LOC100384...    104   1e-21   Zea mays [maize]
gb|KJB12372.1|  hypothetical protein B456_002G014900                    104   1e-21   Gossypium raimondii
ref|XP_009395414.1|  PREDICTED: katanin p80 WD40 repeat-containin...    104   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008221115.1|  PREDICTED: katanin p80 WD40 repeat-containin...    104   2e-21   Prunus mume [ume]
ref|XP_006653028.1|  PREDICTED: katanin p80 WD40 repeat-containin...    104   2e-21   Oryza brachyantha
ref|XP_003525689.2|  PREDICTED: katanin p80 WD40 repeat-containin...    103   2e-21   Glycine max [soybeans]
gb|KDP33053.1|  hypothetical protein JCGZ_13639                         103   2e-21   Jatropha curcas
ref|XP_010688601.1|  PREDICTED: katanin p80 WD40 repeat-containin...    103   4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011033108.1|  PREDICTED: katanin p80 WD40 repeat-containin...    103   4e-21   Populus euphratica
ref|XP_008668688.1|  PREDICTED: katanin p80 WD40 repeat-containin...    103   4e-21   Zea mays [maize]
ref|XP_004960069.1|  PREDICTED: katanin p80 WD40 repeat-containin...    103   5e-21   
ref|XP_006603797.1|  PREDICTED: katanin p80 WD40 repeat-containin...    102   5e-21   Glycine max [soybeans]
gb|KHN19710.1|  Katanin p80 WD40 repeat-containing subunit B1 like 1    102   6e-21   Glycine soja [wild soybean]
ref|XP_002311885.1|  hypothetical protein POPTR_0008s00290g             102   6e-21   
ref|XP_004489186.1|  PREDICTED: katanin p80 WD40 repeat-containin...    102   7e-21   Cicer arietinum [garbanzo]
ref|XP_009793705.1|  PREDICTED: katanin p80 WD40 repeat-containin...    102   7e-21   Nicotiana sylvestris
gb|EEC78255.1|  hypothetical protein OsI_17928                          102   8e-21   Oryza sativa Indica Group [Indian rice]
gb|EEE61907.1|  hypothetical protein OsJ_16629                          102   8e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05767.2|  OSJNBa0064G10.18                                       102   9e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KJB12377.1|  hypothetical protein B456_002G014900                    102   9e-21   Gossypium raimondii
ref|XP_007150863.1|  hypothetical protein PHAVU_004G000600g             102   9e-21   Phaseolus vulgaris [French bean]
ref|XP_010232433.1|  PREDICTED: katanin p80 WD40 repeat-containin...    102   1e-20   Brachypodium distachyon [annual false brome]
ref|XP_003564353.1|  PREDICTED: katanin p80 WD40 repeat-containin...    102   1e-20   
emb|CAJ86235.1|  H0402C08.11                                            102   1e-20   Oryza sativa [red rice]
gb|KJB12375.1|  hypothetical protein B456_002G014900                    102   1e-20   Gossypium raimondii
ref|XP_002316424.2|  hypothetical protein POPTR_0010s26190g             101   1e-20   
emb|CDX80363.1|  BnaC07g30810D                                          101   1e-20   
ref|XP_009622381.1|  PREDICTED: katanin p80 WD40 repeat-containin...    101   2e-20   Nicotiana tomentosiformis
ref|XP_008355994.1|  PREDICTED: katanin p80 WD40 repeat-containin...  94.0    2e-20   
ref|XP_009622378.1|  PREDICTED: katanin p80 WD40 repeat-containin...    101   2e-20   
ref|XP_009597532.1|  PREDICTED: katanin p80 WD40 repeat-containin...    101   2e-20   Nicotiana tomentosiformis
ref|XP_010234861.1|  PREDICTED: katanin p80 WD40 repeat-containin...    101   2e-20   
emb|CDM83145.1|  unnamed protein product                                100   2e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001753544.1|  predicted protein                                95.1    3e-20   
gb|KHG01969.1|  hypothetical protein F383_21214                         100   4e-20   Gossypium arboreum [tree cotton]
ref|XP_008340406.1|  PREDICTED: katanin p80 WD40 repeat-containin...    100   4e-20   Malus domestica [apple tree]
emb|CDX88026.1|  BnaA06g26170D                                          100   4e-20   
tpg|DAA35346.1|  TPA: hypothetical protein ZEAMMB73_159052              100   4e-20   
ref|XP_011013730.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    7e-20   Populus euphratica
ref|XP_011046586.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    7e-20   Populus euphratica
ref|XP_011013727.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    8e-20   Populus euphratica
ref|XP_009790404.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    8e-20   Nicotiana sylvestris
ref|XP_011013729.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    8e-20   Populus euphratica
ref|XP_011046583.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    8e-20   Populus euphratica
ref|XP_011046585.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.4    8e-20   Populus euphratica
ref|XP_009351770.1|  PREDICTED: katanin p80 WD40 repeat-containin...  99.0    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_009150876.1|  PREDICTED: katanin p80 WD40 repeat-containin...  98.2    2e-19   Brassica rapa
ref|XP_004231535.1|  PREDICTED: katanin p80 WD40 repeat-containin...  97.8    2e-19   Solanum lycopersicum
ref|XP_010067049.1|  PREDICTED: katanin p80 WD40 repeat-containin...  97.8    2e-19   Eucalyptus grandis [rose gum]
ref|XP_009622380.1|  PREDICTED: katanin p80 WD40 repeat-containin...  97.1    4e-19   Nicotiana tomentosiformis
ref|XP_006361541.1|  PREDICTED: katanin p80 WD40 repeat-containin...  97.1    5e-19   Solanum tuberosum [potatoes]
ref|XP_006394609.1|  hypothetical protein EUTSA_v10005394mg           96.7    6e-19   
ref|XP_009131065.1|  PREDICTED: katanin p80 WD40 repeat-containin...  96.7    6e-19   Brassica rapa
ref|XP_010905606.1|  PREDICTED: katanin p80 WD40 repeat-containin...  95.5    1e-18   
ref|XP_008389947.1|  PREDICTED: katanin p80 WD40 repeat-containin...  95.1    1e-18   
ref|XP_008340409.1|  PREDICTED: katanin p80 WD40 repeat-containin...  95.5    2e-18   Malus domestica [apple tree]
ref|XP_006360856.1|  PREDICTED: katanin p80 WD40 repeat-containin...  94.7    3e-18   Solanum tuberosum [potatoes]
gb|KCW65114.1|  hypothetical protein EUGRSUZ_G02621                   94.7    3e-18   Eucalyptus grandis [rose gum]
ref|XP_004236878.1|  PREDICTED: katanin p80 WD40 repeat-containin...  94.7    3e-18   Solanum lycopersicum
emb|CAJ86243.1|  H0801D08.1                                           94.4    4e-18   Oryza sativa [red rice]
ref|XP_009351774.1|  PREDICTED: katanin p80 WD40 repeat-containin...  94.0    5e-18   Pyrus x bretschneideri [bai li]
gb|EEE54730.1|  hypothetical protein OsJ_02077                        90.5    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010546257.1|  PREDICTED: katanin p80 WD40 repeat-containin...  93.6    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_010240609.1|  PREDICTED: katanin p80 WD40 repeat-containin...  93.2    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_010240610.1|  PREDICTED: katanin p80 WD40 repeat-containin...  93.2    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_010067050.1|  PREDICTED: katanin p80 WD40 repeat-containin...  92.8    1e-17   Eucalyptus grandis [rose gum]
emb|CDY60225.1|  BnaA03g55700D                                        92.4    1e-17   Brassica napus [oilseed rape]
ref|NP_001054267.2|  Os04g0677700                                     87.4    2e-17   
ref|NP_001043242.2|  Os01g0531300                                     90.5    2e-17   
gb|AFN42837.1|  katanin-like protein                                  92.0    2e-17   Marsilea vestita
gb|EEC70811.1|  hypothetical protein OsI_02272                        89.7    3e-17   Oryza sativa Indica Group [Indian rice]
gb|EEC71594.1|  hypothetical protein OsI_03978                        91.7    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010319353.1|  PREDICTED: katanin p80 WD40 repeat-containin...  90.9    6e-17   Solanum lycopersicum
ref|XP_010423097.1|  PREDICTED: katanin p80 WD40 repeat-containin...  90.5    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010423095.1|  PREDICTED: katanin p80 WD40 repeat-containin...  90.5    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010491476.1|  PREDICTED: katanin p80 WD40 repeat-containin...  90.5    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010491474.1|  PREDICTED: katanin p80 WD40 repeat-containin...  90.5    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010452825.1|  PREDICTED: katanin p80 WD40 repeat-containin...  90.1    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002871324.1|  hypothetical protein ARALYDRAFT_487674           89.7    1e-16   Arabidopsis lyrata subsp. lyrata
gb|KHG08287.1|  hypothetical protein F383_16149                       89.4    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010418089.1|  PREDICTED: katanin p80 WD40 repeat-containin...  87.8    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010418088.1|  PREDICTED: katanin p80 WD40 repeat-containin...  87.8    7e-16   Camelina sativa [gold-of-pleasure]
gb|EEC67235.1|  hypothetical protein OsI_34162                        87.0    9e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001064946.1|  Os10g0494800                                     87.0    1e-15   
gb|EEE51202.1|  hypothetical protein OsJ_32015                        86.7    1e-15   
ref|XP_004982744.1|  PREDICTED: katanin p80 WD40 repeat-containin...  85.5    3e-15   
ref|NP_568194.2|  transducin/WD40 repeat-like superfamily protein     85.5    3e-15   
dbj|BAE98997.1|  katanin p80 subunit - like protein                   85.5    3e-15   
ref|XP_004982743.1|  PREDICTED: katanin p80 WD40 repeat-containin...  85.5    3e-15   
ref|XP_009392416.1|  PREDICTED: katanin p80 WD40 repeat-containin...  85.5    3e-15   
ref|XP_004982742.1|  PREDICTED: katanin p80 WD40 repeat-containin...  85.5    3e-15   
ref|XP_009392408.1|  PREDICTED: katanin p80 WD40 repeat-containin...  85.5    3e-15   
gb|EEE55490.1|  hypothetical protein OsJ_03675                        84.7    5e-15   
ref|XP_002456444.1|  hypothetical protein SORBIDRAFT_03g036400        84.7    5e-15   
gb|EMS68408.1|  Katanin p80 WD40 repeat-containing subunit B1-lik...  84.7    6e-15   
gb|EMT11460.1|  hypothetical protein F775_05157                       84.3    7e-15   
ref|XP_008664808.1|  PREDICTED: katanin p80 WD40 repeat-containin...  84.3    7e-15   
ref|XP_006661901.1|  PREDICTED: katanin p80 WD40 repeat-containin...  84.3    8e-15   
ref|XP_008664807.1|  PREDICTED: katanin p80 WD40 repeat-containin...  84.0    9e-15   
ref|XP_008664806.1|  PREDICTED: katanin p80 WD40 repeat-containin...  84.0    9e-15   
ref|XP_008664810.1|  PREDICTED: katanin p80 WD40 repeat-containin...  84.0    1e-14   
ref|XP_010493465.1|  PREDICTED: katanin p80 WD40 repeat-containin...  82.8    2e-14   
ref|XP_002975481.1|  hypothetical protein SELMODRAFT_442850           82.4    3e-14   
ref|XP_002874130.1|  transducin family protein                        82.4    3e-14   
ref|NP_851064.1|  Katanin p80 WD40 repeat-containing subunit B1-1     81.6    5e-14   
ref|XP_010421144.1|  PREDICTED: katanin p80 WD40 repeat-containin...  81.3    7e-14   
ref|XP_010421146.1|  PREDICTED: katanin p80 WD40 repeat-containin...  81.3    7e-14   
ref|XP_010421148.1|  PREDICTED: katanin p80 WD40 repeat-containin...  81.3    7e-14   
gb|EMT21321.1|  hypothetical protein F775_02319                       81.3    8e-14   
ref|XP_010454622.1|  PREDICTED: katanin p80 WD40 repeat-containin...  81.3    8e-14   
ref|XP_010454626.1|  PREDICTED: katanin p80 WD40 repeat-containin...  80.9    9e-14   
ref|XP_002978720.1|  hypothetical protein SELMODRAFT_443995           80.9    9e-14   
ref|XP_010421149.1|  PREDICTED: katanin p80 WD40 repeat-containin...  80.9    9e-14   
gb|KHG16229.1|  hypothetical protein F383_04189                       80.9    1e-13   
ref|XP_006399331.1|  hypothetical protein EUTSA_v10012683mg           80.9    1e-13   
emb|CDX81101.1|  BnaC03g03550D                                        80.5    1e-13   
gb|EPS62586.1|  hypothetical protein M569_12203                       80.9    1e-13   
ref|XP_009141539.1|  PREDICTED: katanin p80 WD40 repeat-containin...  73.2    7e-13   
dbj|BAK00426.1|  predicted protein                                    77.0    2e-12   
ref|NP_197734.2|  Katanin p80 WD40 repeat-containing subunit B1-1     77.0    2e-12   
ref|XP_006287083.1|  hypothetical protein CARUB_v10000243mg           75.9    4e-12   
ref|XP_001768340.1|  predicted protein                                70.9    4e-12   
gb|AAD49999.1|AC007259_12  Hypothetical protein                       75.1    7e-12   
ref|XP_006287049.1|  hypothetical protein CARUB_v10000197mg           74.7    9e-12   
emb|CAC08339.1|  katanin p80 subunit-like protein                     74.3    1e-11   
gb|AAM92815.1|  putative microtubule-severing protein subunit         72.4    5e-11   
ref|XP_002993384.1|  hypothetical protein SELMODRAFT_431447           69.7    3e-10   
ref|XP_002464436.1|  hypothetical protein SORBIDRAFT_01g018340        64.7    6e-10   
gb|EMS67191.1|  Katanin p80 WD40 repeat-containing subunit B1-lik...  68.2    1e-09   
dbj|BAB09559.1|  unnamed protein product                              67.0    3e-09   
tpg|DAA49487.1|  TPA: hypothetical protein ZEAMMB73_490443            61.6    9e-09   
gb|AHY23247.1|  hypothetical protein                                  59.7    2e-08   
ref|XP_009150875.1|  PREDICTED: katanin p80 WD40 repeat-containin...  59.7    2e-08   
ref|XP_007025740.1|  Transducin/WD40 repeat-like superfamily prot...  60.8    3e-07   
gb|KHG01968.1|  hypothetical protein F383_21214                       59.3    3e-07   
ref|XP_007025734.1|  Transducin/WD40 repeat-like superfamily prot...  45.8    4e-07   
gb|KEH36528.1|  katanin p80 WD40 repeat subunit B1-like protein       55.5    2e-05   
emb|CDY40962.1|  BnaCnng10050D                                        53.5    4e-05   
tpg|DAA49488.1|  TPA: hypothetical protein ZEAMMB73_490443            48.1    4e-04   
ref|XP_011418638.1|  PREDICTED: katanin p80 WD40 repeat-containin...  50.8    6e-04   
ref|XP_011418637.1|  PREDICTED: katanin p80 WD40 repeat-containin...  50.8    7e-04   
gb|EKC42151.1|  Katanin p80 WD40-containing subunit B1                50.8    7e-04   
ref|XP_011418636.1|  PREDICTED: katanin p80 WD40 repeat-containin...  50.4    8e-04   



>ref|XP_009778974.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 isoform 
X2 [Nicotiana sylvestris]
Length=945

 Score =   160 bits (406),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+GAINA +KLPDHSVQADVVSVL+++ME+ITL+LFS LLPVLL LLDSK+ERHANVS
Sbjct  810  NDIRGAINALRKLPDHSVQADVVSVLVDKMEIITLDLFSCLLPVLLTLLDSKVERHANVS  869

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LLKLVA+FGPVVRSA +A PSVGVDLHAE+RI+CC+QC A+LQ IQ+++P L +R G
Sbjct  870  LELLLKLVAVFGPVVRSAVAAPPSVGVDLHAEERIQCCKQCFAYLQDIQKVLPALTRRSG  929

Query  407  LVAKSA  390
            L+AK A
Sbjct  930  LLAKGA  935



>ref|XP_009778973.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 isoform 
X1 [Nicotiana sylvestris]
Length=1027

 Score =   160 bits (406),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDI+GAINA +KLPDHSVQADVVSVL+++ME+ITL+LFS LLPVLL LLDSK+ERHANVS
Sbjct  892   NDIRGAINALRKLPDHSVQADVVSVLVDKMEIITLDLFSCLLPVLLTLLDSKVERHANVS  951

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LE+LLKLVA+FGPVVRSA +A PSVGVDLHAE+RI+CC+QC A+LQ IQ+++P L +R G
Sbjct  952   LELLLKLVAVFGPVVRSAVAAPPSVGVDLHAEERIQCCKQCFAYLQDIQKVLPALTRRSG  1011

Query  407   LVAKSA  390
             L+AK A
Sbjct  1012  LLAKGA  1017



>ref|XP_006347178.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum tuberosum]
Length=1113

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDI+GA    +KL DHSVQADVVSVL+++ME+ITL+LFS LLPVLLALLD+KIERHANVS
Sbjct  978   NDIRGAFEGLRKLSDHSVQADVVSVLVDKMEIITLDLFSFLLPVLLALLDTKIERHANVS  1037

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LE+LLKLVA+FGPVVRSA SARPSVGVDLHAE RI+CCRQC A+LQ IQ+ +P LI+RGG
Sbjct  1038  LELLLKLVAVFGPVVRSAVSARPSVGVDLHAEARIKCCRQCFAYLQDIQKTLPALIRRGG  1097

Query  407   LVAKSA  390
             L AK A
Sbjct  1098  LPAKGA  1103



>ref|XP_009593363.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022} isoform X2 [Nicotiana 
tomentosiformis]
Length=945

 Score =   158 bits (399),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+GAINA +KLPDHSVQADVVSVL+++ME+ITL+LFS LLPVLL LLDSK+ERHANVS
Sbjct  810  NDIRGAINALRKLPDHSVQADVVSVLVDKMEIITLDLFSCLLPVLLTLLDSKVERHANVS  869

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LLKLVA+FGPVVRSA  A PSVGVDLHAE+RI+CC+QC  +LQ IQ+++P LI+R G
Sbjct  870  LELLLKLVAVFGPVVRSAILAPPSVGVDLHAEERIQCCKQCFVYLQDIQKVLPALIRRSG  929

Query  407  LVAKSA  390
            L+AK A
Sbjct  930  LLAKGA  935



>ref|XP_009593301.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022} isoform X1 [Nicotiana 
tomentosiformis]
Length=1027

 Score =   158 bits (400),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDI+GAINA +KLPDHSVQADVVSVL+++ME+ITL+LFS LLPVLL LLDSK+ERHANVS
Sbjct  892   NDIRGAINALRKLPDHSVQADVVSVLVDKMEIITLDLFSCLLPVLLTLLDSKVERHANVS  951

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LE+LLKLVA+FGPVVRSA  A PSVGVDLHAE+RI+CC+QC  +LQ IQ+++P LI+R G
Sbjct  952   LELLLKLVAVFGPVVRSAILAPPSVGVDLHAEERIQCCKQCFVYLQDIQKVLPALIRRSG  1011

Query  407   LVAKSA  390
             L+AK A
Sbjct  1012  LLAKGA  1017



>ref|XP_010316710.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Solanum lycopersicum]
Length=947

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+GA  A +KL D+SVQADVVSVL+++ME+ITL+LFS LLPVLLALL++KIERHANVS
Sbjct  812  NDIRGAFEALRKLSDYSVQADVVSVLVDKMEIITLDLFSFLLPVLLALLETKIERHANVS  871

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LLKLVA+FGPVVRSAASARPSVGVDLHAE RI+CCRQC A+LQ IQ+ +P LI+ GG
Sbjct  872  LELLLKLVAVFGPVVRSAASARPSVGVDLHAEARIKCCRQCFAYLQDIQKTLPELIRGGG  931

Query  407  LVAKSA  390
              AK A
Sbjct  932  QPAKGA  937



>ref|XP_004232826.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Solanum lycopersicum]
Length=1029

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDI+GA  A +KL D+SVQADVVSVL+++ME+ITL+LFS LLPVLLALL++KIERHANVS
Sbjct  894   NDIRGAFEALRKLSDYSVQADVVSVLVDKMEIITLDLFSFLLPVLLALLETKIERHANVS  953

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LE+LLKLVA+FGPVVRSAASARPSVGVDLHAE RI+CCRQC A+LQ IQ+ +P LI+ GG
Sbjct  954   LELLLKLVAVFGPVVRSAASARPSVGVDLHAEARIKCCRQCFAYLQDIQKTLPELIRGGG  1013

Query  407   LVAKSA  390
               AK A
Sbjct  1014  QPAKGA  1019



>ref|XP_002521412.1| katanin P80 subunit, putative [Ricinus communis]
 gb|EEF40902.1| katanin P80 subunit, putative [Ricinus communis]
Length=936

 Score =   154 bits (389),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAINA +KLPDHSVQAD++SVL+E+ME++TL+LFS LLPVL+ LLDSK+ERH  VS
Sbjct  801  NDIKGAINALRKLPDHSVQADIISVLMEKMEILTLDLFSCLLPVLVGLLDSKMERHTGVS  860

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+RS  S  P VGV+LHAEQR+ECC+QC   LQ IQQI+P LI++GG
Sbjct  861  LEMLLKLVAVFGPVIRSTISGPPLVGVNLHAEQRLECCKQCFVQLQKIQQILPALIRKGG  920

Query  407  LVAKSA  390
            ++AKSA
Sbjct  921  VLAKSA  926



>emb|CDO99605.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   153 bits (387),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 94/126 (75%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA  KLPDHSVQADVVSVL E+ME+ITLELFS LLPVLL+LLDSKI+RHA+VS
Sbjct  672  NDVKGAINAMMKLPDHSVQADVVSVLKEKMEIITLELFSCLLPVLLSLLDSKIDRHASVS  731

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+A+FGP+VRS  SA  +VGVDLHAE+R E C+QC  HLQ +Q+I+P+LIQRGG
Sbjct  732  LEMLLKLIAVFGPLVRSTVSAPRAVGVDLHAEERRESCKQCFVHLQNVQKILPSLIQRGG  791

Query  407  LVAKSA  390
            +VA+ A
Sbjct  792  VVARCA  797



>emb|CBI35743.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA +KLPDHSVQADVVSVL+E+ME++TL+LFS LLPVL++LLDS +ERHAN+S
Sbjct  179  NDVKGAINALRKLPDHSVQADVVSVLMEKMEILTLDLFSCLLPVLMSLLDSNLERHANLS  238

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV++FGPV+ SA SA P++GV+L AE R ECC QC   LQ IQ+ +P +I+RGG
Sbjct  239  LDMLLKLVSVFGPVIHSAISAPPAIGVNLQAEHRRECCNQCFIQLQKIQKNLPVIIRRGG  298

Query  407  LVAKSA  390
            L+AKSA
Sbjct  299  LLAKSA  304



>ref|XP_007025733.1| Katanin P80 subunit, putative isoform 1 [Theobroma cacao]
 gb|EOY28355.1| Katanin P80 subunit, putative isoform 1 [Theobroma cacao]
Length=966

 Score =   153 bits (386),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 88/126 (70%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADV+SVL+E+ME++TL+LFS L+PVL+ LLDSK+ERH NVS
Sbjct  832  NDIKGAIGALRKLPDHSVQADVISVLMEKMEILTLDLFSGLIPVLMGLLDSKMERHVNVS  891

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGP++RS  SAR  VGVDLHAEQR ECC QC   LQ IQ+++P L++RGG
Sbjct  892  LEMLLKLVAVFGPMIRSTVSARRGVGVDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGG  951

Query  407  LVAKSA  390
             +A+ A
Sbjct  952  AIARCA  957



>gb|KDP20912.1| hypothetical protein JCGZ_21383 [Jatropha curcas]
Length=941

 Score =   152 bits (383),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KLPDHSVQ DV+S L+E+ME++TL+LFS LLPVL+ LLDSK+ERH +VS
Sbjct  806  NDIKGAISALRKLPDHSVQTDVISCLMEKMEILTLDLFSCLLPVLVGLLDSKMERHTSVS  865

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FG V+RS  SA P+VGVDLH EQR+ECC+QC   LQ IQQI+P LI++GG
Sbjct  866  LEMLLKLVAVFGQVIRSTISAPPAVGVDLHQEQRLECCKQCFVQLQKIQQILPALIRKGG  925

Query  407  LVAKSA  390
            LVAKSA
Sbjct  926  LVAKSA  931



>gb|KJB68607.1| hypothetical protein B456_010G254700 [Gossypium raimondii]
Length=821

 Score =   150 bits (380),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG+I A +KLPDHSVQADV+ VL+E+ME++ L+LFS LLPVL+ LLDSK+ERH N+S
Sbjct  687  NDIKGSIGALRKLPDHSVQADVIGVLMEKMEILNLDLFSGLLPVLMGLLDSKMERHTNIS  746

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGP++RS  SAR SVGVDLHAEQR ECC QC   LQ IQ+++P L++RGG
Sbjct  747  LEMLLKLVAVFGPMIRSTVSARRSVGVDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGG  806

Query  407  LVAKSA  390
             +A+ A
Sbjct  807  TIARGA  812



>ref|XP_010647331.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Vitis vinifera]
Length=806

 Score =   150 bits (380),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 88/126 (70%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA +KLPDHSVQADVVSVL+E+ME++TL+LFS LLPVL++LLDS +ERHAN+S
Sbjct  671  NDVKGAINALRKLPDHSVQADVVSVLMEKMEILTLDLFSCLLPVLMSLLDSNLERHANLS  730

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGPV+ SA SA P++GV+L AE R ECC QC   LQ IQ+ +P +I+RGG
Sbjct  731  LDMLLKLVAVFGPVIHSAISAPPAIGVNLQAEHRRECCNQCFIQLQKIQKNLPVIIRRGG  790

Query  407  LVAKSA  390
            L+AKSA
Sbjct  791  LLAKSA  796



>gb|KJB68606.1| hypothetical protein B456_010G254700 [Gossypium raimondii]
Length=835

 Score =   150 bits (380),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG+I A +KLPDHSVQADV+ VL+E+ME++ L+LFS LLPVL+ LLDSK+ERH N+S
Sbjct  701  NDIKGSIGALRKLPDHSVQADVIGVLMEKMEILNLDLFSGLLPVLMGLLDSKMERHTNIS  760

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGP++RS  SAR SVGVDLHAEQR ECC QC   LQ IQ+++P L++RGG
Sbjct  761  LEMLLKLVAVFGPMIRSTVSARRSVGVDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGG  820

Query  407  LVAKSA  390
             +A+ A
Sbjct  821  TIARGA  826



>ref|XP_011096279.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Sesamum indicum]
Length=860

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA +KLPDHSVQADVV VLIERMEVITL+LFS LLPVLL LLDSK+ERHA++S
Sbjct  725  NDVKGAINAVRKLPDHSVQADVVGVLIERMEVITLDLFSCLLPVLLGLLDSKVERHASIS  784

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA FG VVRS  SA  +VGVDLHAE+R+E C+QC AHLQ +Q+++P L++RGG
Sbjct  785  LEMLLKLVAGFGTVVRSTVSAPRAVGVDLHAEERLESCKQCFAHLQNVQKMLPELVKRGG  844

Query  407  LVAK  396
            +VA+
Sbjct  845  VVAR  848



>ref|XP_011043252.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=959

 Score =   150 bits (380),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGAINA +KLPD+SVQADV+SVL+++ME++ L+LFS LLPVL+ LLDSK+ERHAN+S
Sbjct  824  SDIKGAINALRKLPDYSVQADVISVLMDKMEILNLDLFSCLLPVLVGLLDSKMERHANIS  883

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV++SA SA P VGVDLHAEQR ECC +C A LQ IQQI+P L +RGG
Sbjct  884  LEMLLKLVAVFGPVIQSAVSAPPVVGVDLHAEQRRECCNKCFAQLQKIQQILPALARRGG  943

Query  407  LVAKSA  390
            L+ KSA
Sbjct  944  LLTKSA  949



>gb|KJB68608.1| hypothetical protein B456_010G254700 [Gossypium raimondii]
Length=926

 Score =   150 bits (380),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG+I A +KLPDHSVQADV+ VL+E+ME++ L+LFS LLPVL+ LLDSK+ERH N+S
Sbjct  792  NDIKGSIGALRKLPDHSVQADVIGVLMEKMEILNLDLFSGLLPVLMGLLDSKMERHTNIS  851

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGP++RS  SAR SVGVDLHAEQR ECC QC   LQ IQ+++P L++RGG
Sbjct  852  LEMLLKLVAVFGPMIRSTVSARRSVGVDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGG  911

Query  407  LVAKSA  390
             +A+ A
Sbjct  912  TIARGA  917



>gb|KJB68609.1| hypothetical protein B456_010G254700 [Gossypium raimondii]
Length=927

 Score =   150 bits (380),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG+I A +KLPDHSVQADV+ VL+E+ME++ L+LFS LLPVL+ LLDSK+ERH N+S
Sbjct  793  NDIKGSIGALRKLPDHSVQADVIGVLMEKMEILNLDLFSGLLPVLMGLLDSKMERHTNIS  852

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGP++RS  SAR SVGVDLHAEQR ECC QC   LQ IQ+++P L++RGG
Sbjct  853  LEMLLKLVAVFGPMIRSTVSARRSVGVDLHAEQRRECCNQCFMQLQKIQKLLPPLVRRGG  912

Query  407  LVAKSA  390
             +A+ A
Sbjct  913  TIARGA  918



>ref|XP_006377307.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa]
 gb|ERP55104.1| hypothetical protein POPTR_0011s04530g [Populus trichocarpa]
Length=990

 Score =   150 bits (380),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGAINA +KLPD+SVQADV+SVL+++ME++ L+LFS LLPVL+ LLDSK+ERHAN+S
Sbjct  855  SDIKGAINALRKLPDYSVQADVISVLMDKMEILNLDLFSCLLPVLVGLLDSKMERHANIS  914

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV++SA SA P VGVDLHAEQR ECC +C A LQ IQQI+P L +RGG
Sbjct  915  LEMLLKLVAVFGPVIQSAVSAPPVVGVDLHAEQRRECCNKCFAQLQKIQQILPALARRGG  974

Query  407  LVAKSA  390
            L+ KSA
Sbjct  975  LLTKSA  980



>ref|XP_011043253.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Populus euphratica]
Length=838

 Score =   150 bits (378),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGAINA +KLPD+SVQADV+SVL+++ME++ L+LFS LLPVL+ LLDSK+ERHAN+S
Sbjct  703  SDIKGAINALRKLPDYSVQADVISVLMDKMEILNLDLFSCLLPVLVGLLDSKMERHANIS  762

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV++SA SA P VGVDLHAEQR ECC +C A LQ IQQI+P L +RGG
Sbjct  763  LEMLLKLVAVFGPVIQSAVSAPPVVGVDLHAEQRRECCNKCFAQLQKIQQILPALARRGG  822

Query  407  LVAKSA  390
            L+ KSA
Sbjct  823  LLTKSA  828



>ref|XP_010647505.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Vitis vinifera]
Length=542

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA +KLPDHSVQADVVSVL+E+ME++TL+LFS LLPVL++LLDS +ERHAN+S
Sbjct  407  NDVKGAINALRKLPDHSVQADVVSVLMEKMEILTLDLFSCLLPVLMSLLDSNLERHANLS  466

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV++FGPV+ SA SA P++GV+L AE R ECC QC   LQ IQ+ +P +I+RGG
Sbjct  467  LDMLLKLVSVFGPVIHSAISAPPAIGVNLQAEHRRECCNQCFIQLQKIQKNLPVIIRRGG  526

Query  407  LVAKSA  390
            L+AKSA
Sbjct  527  LLAKSA  532



>ref|XP_010057472.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Eucalyptus grandis]
Length=912

 Score =   148 bits (373),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            D+KGAINA ++LPDHSVQADV+S+L E+ME++ L+LFS LLPVL+ LLDSK+ERH+ VSL
Sbjct  778  DMKGAINALRRLPDHSVQADVISILTEKMEMLNLDLFSCLLPVLVGLLDSKVERHSCVSL  837

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLVA+FG VVRS  SA P+VGVDLHAEQR+ECC QC   LQ IQ+IIP L++RGG+
Sbjct  838  EMLLKLVAVFGSVVRSTVSAPPTVGVDLHAEQRLECCNQCFTELQKIQKIIPMLVRRGGV  897

Query  404  VAKSA  390
            +A+SA
Sbjct  898  IARSA  902



>ref|XP_006594334.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Glycine max]
Length=778

 Score =   147 bits (371),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND KGAI+A +KLPD SVQADV+SVL+++ME+ITL+LFS LLPVL  LLDS IERH  VS
Sbjct  643  NDTKGAISALRKLPDQSVQADVISVLVDKMEIITLDLFSCLLPVLTGLLDSNIERHVKVS  702

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP +RS  SA PSVG+DLHAEQR EC  QC   LQ I+ I+P LI+RGG
Sbjct  703  LDMLLKLVAVFGPTIRSTISAPPSVGIDLHAEQRRECSNQCFMQLQKIRMILPILIRRGG  762

Query  407  LVAKSA  390
            ++AKSA
Sbjct  763  ILAKSA  768



>ref|XP_010057471.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Eucalyptus grandis]
 gb|KCW74643.1| hypothetical protein EUGRSUZ_E03367 [Eucalyptus grandis]
Length=1017

 Score =   148 bits (373),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 88/125 (70%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  764   DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
             D+KGAINA ++LPDHSVQADV+S+L E+ME++ L+LFS LLPVL+ LLDSK+ERH+ VSL
Sbjct  883   DMKGAINALRRLPDHSVQADVISILTEKMEMLNLDLFSCLLPVLVGLLDSKVERHSCVSL  942

Query  584   EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
             EMLLKLVA+FG VVRS  SA P+VGVDLHAEQR+ECC QC   LQ IQ+IIP L++RGG+
Sbjct  943   EMLLKLVAVFGSVVRSTVSAPPTVGVDLHAEQRLECCNQCFTELQKIQKIIPMLVRRGGV  1002

Query  404   VAKSA  390
             +A+SA
Sbjct  1003  IARSA  1007



>ref|XP_003541552.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Glycine max]
Length=814

 Score =   147 bits (371),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND KGAI+A +KLPD SVQADV+SVL+++ME+ITL+LFS LLPVL  LLDS IERH  VS
Sbjct  679  NDTKGAISALRKLPDQSVQADVISVLVDKMEIITLDLFSCLLPVLTGLLDSNIERHVKVS  738

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP +RS  SA PSVG+DLHAEQR EC  QC   LQ I+ I+P LI+RGG
Sbjct  739  LDMLLKLVAVFGPTIRSTISAPPSVGIDLHAEQRRECSNQCFMQLQKIRMILPILIRRGG  798

Query  407  LVAKSA  390
            ++AKSA
Sbjct  799  ILAKSA  804



>gb|EYU27954.1| hypothetical protein MIMGU_mgv1a001351mg [Erythranthe guttata]
Length=835

 Score =   147 bits (370),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 88/126 (70%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KLPDHSVQADV+ VL+ER+E+ITLELFS LLPVLL LL+SK ERH +VS
Sbjct  700  NDVKGAIIAVRKLPDHSVQADVIGVLVERLEIITLELFSCLLPVLLGLLESKAERHVSVS  759

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FG +VRS  SA  SVGVDLHAE+R ECC+QC  HLQ +Q+ +P L++RGG
Sbjct  760  LEMLLKLVAVFGTLVRSTVSAPQSVGVDLHAEERRECCKQCFVHLQGVQKSLPELMKRGG  819

Query  407  LVAKSA  390
            +VA+ A
Sbjct  820  VVARYA  825



>ref|XP_003543076.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
 gb|KHN08569.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=824

 Score =   146 bits (368),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGA NA +KLPDHSVQADV+SVL+ERME+ TL+LFS LLPVL  LLDSKIERH  VS
Sbjct  689  NDIKGATNALRKLPDHSVQADVISVLVERMEIFTLDLFSCLLPVLTGLLDSKIERHVKVS  748

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLK+VA+FGP V +  SA PSVGVDLH E+R ECC +C   LQ IQ  +P LI++GG
Sbjct  749  LDMLLKVVAVFGPTVLATVSAPPSVGVDLHQEERRECCNKCFMELQKIQMTLPILIRKGG  808

Query  407  LVAKSA  390
            ++A+SA
Sbjct  809  ILARSA  814



>gb|KHN46320.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=834

 Score =   145 bits (367),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND KGAI+A +KLPD SVQADV+SVL+++ME++TL+LFS LLPVL  LLDS IERH  VS
Sbjct  699  NDAKGAISALRKLPDQSVQADVISVLVDKMEILTLDLFSCLLPVLTGLLDSNIERHVKVS  758

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP +RS  SA PSVG+DLHAEQR EC  QC   LQ I+ I+P LI+RGG
Sbjct  759  LDMLLKLVAVFGPTIRSTISAPPSVGIDLHAEQRRECSNQCFMQLQKIRMILPILIRRGG  818

Query  407  LVAKSA  390
            ++AKSA
Sbjct  819  ILAKSA  824



>ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Cucumis melo]
Length=920

 Score =   146 bits (368),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA  KLPDHSVQADV+SVLI++M+V+TL+LFS LLPVL+ LLDSKIERHA++S
Sbjct  785  NDMKGAINAMTKLPDHSVQADVISVLIDKMDVLTLDLFSCLLPVLVGLLDSKIERHASLS  844

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +E+L+KLVA+FG V+ SA SA P VGVDLHAEQR++CC+QC   LQ IQ++IP+ ++RGG
Sbjct  845  MEILVKLVAVFGHVISSAVSAPPVVGVDLHAEQRVQCCKQCFTQLQKIQKVIPSFVRRGG  904

Query  407  LVAKSA  390
             +A+SA
Sbjct  905  SLARSA  910



>ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Cucumis melo]
Length=922

 Score =   146 bits (368),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA  KLPDHSVQADV+SVLI++M+V+TL+LFS LLPVL+ LLDSKIERHA++S
Sbjct  787  NDMKGAINAMTKLPDHSVQADVISVLIDKMDVLTLDLFSCLLPVLVGLLDSKIERHASLS  846

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +E+L+KLVA+FG V+ SA SA P VGVDLHAEQR++CC+QC   LQ IQ++IP+ ++RGG
Sbjct  847  MEILVKLVAVFGHVISSAVSAPPVVGVDLHAEQRVQCCKQCFTQLQKIQKVIPSFVRRGG  906

Query  407  LVAKSA  390
             +A+SA
Sbjct  907  SLARSA  912



>gb|KGN64638.1| hypothetical protein Csa_1G072490 [Cucumis sativus]
Length=978

 Score =   145 bits (366),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA  KLPDHSVQADV+SVL+++M+V+TL+LFS LLPVL+ LLDSKIERHA++S
Sbjct  843  NDMKGAINAMTKLPDHSVQADVISVLVDKMDVLTLDLFSCLLPVLVGLLDSKIERHASLS  902

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +E+L+KLVA+FG V+ SA SA P VGVDLHAEQR++CC+QC   LQ +Q+IIP+ ++RGG
Sbjct  903  MEILVKLVAVFGHVISSAVSAPPVVGVDLHAEQRVQCCKQCFTQLQKVQKIIPSFVRRGG  962

Query  407  LVAKSA  390
             +A+SA
Sbjct  963  SLARSA  968



>ref|XP_003545861.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Glycine max]
Length=825

 Score =   144 bits (364),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGA NA +KLPD SVQADV+SVL+E+ME+ TL+LFS LLPVL  LLDSKIERH  +S
Sbjct  690  NDIKGATNALRKLPDQSVQADVISVLVEKMEIFTLDLFSCLLPVLTGLLDSKIERHVKLS  749

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP +R+  SA PSVGVDLH E+R ECC +C   LQ IQ  +P LI++GG
Sbjct  750  LDMLLKLVAVFGPTIRATVSAPPSVGVDLHQEERRECCNKCFMELQKIQMTLPILIRKGG  809

Query  407  LVAKSA  390
            ++A+SA
Sbjct  810  ILARSA  815



>ref|XP_004158060.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
Length=906

 Score =   145 bits (365),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA  KLPDHSVQADV+SVL+++M+V+TL+LFS LLPVL+ LLDSKIERHA++S
Sbjct  771  NDMKGAINAMTKLPDHSVQADVISVLVDKMDVLTLDLFSCLLPVLVGLLDSKIERHASLS  830

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +E+L+KLVA+FG V+ SA SA P VGVDLHAEQR++CC+QC   LQ +Q+IIP+ ++RGG
Sbjct  831  MEILVKLVAVFGHVISSAVSAPPVVGVDLHAEQRVQCCKQCFTQLQKVQKIIPSFVRRGG  890

Query  407  LVAKSA  390
             +A+SA
Sbjct  891  SLARSA  896



>ref|XP_004146637.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
Length=922

 Score =   145 bits (365),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA  KLPDHSVQADV+SVL+++M+V+TL+LFS LLPVL+ LLDSKIERHA++S
Sbjct  787  NDMKGAINAMTKLPDHSVQADVISVLVDKMDVLTLDLFSCLLPVLVGLLDSKIERHASLS  846

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +E+L+KLVA+FG V+ SA SA P VGVDLHAEQR++CC+QC   LQ +Q+IIP+ ++RGG
Sbjct  847  MEILVKLVAVFGHVISSAVSAPPVVGVDLHAEQRVQCCKQCFTQLQKVQKIIPSFVRRGG  906

Query  407  LVAKSA  390
             +A+SA
Sbjct  907  SLARSA  912



>ref|XP_006467862.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Citrus sinensis]
Length=983

 Score =   144 bits (364),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG INA +KLPDHSVQADV+SVL+E+ME++ L+LFS LLP+L+ LLDSK+ERHA++S
Sbjct  848  NDIKGGINALRKLPDHSVQADVMSVLMEKMEILNLDLFSCLLPMLMGLLDSKMERHASIS  907

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FGP++ S  SA P+VGVDLHAEQR ECC +C   LQ IQ+I+P L +RGG
Sbjct  908  LEMLLKLVVVFGPMIHSTLSAPPAVGVDLHAEQRQECCNRCFMQLQKIQKILPILERRGG  967

Query  407  LVAKSA  390
            L+AK A
Sbjct  968  LLAKCA  973



>ref|XP_006467863.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Citrus sinensis]
Length=955

 Score =   144 bits (364),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG INA +KLPDHSVQADV+SVL+E+ME++ L+LFS LLP+L+ LLDSK+ERHA++S
Sbjct  820  NDIKGGINALRKLPDHSVQADVMSVLMEKMEILNLDLFSCLLPMLMGLLDSKMERHASIS  879

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FGP++ S  SA P+VGVDLHAEQR ECC +C   LQ IQ+I+P L +RGG
Sbjct  880  LEMLLKLVVVFGPMIHSTLSAPPAVGVDLHAEQRQECCNRCFMQLQKIQKILPILERRGG  939

Query  407  LVAKSA  390
            L+AK A
Sbjct  940  LLAKCA  945



>ref|XP_006467861.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Citrus sinensis]
Length=1074

 Score =   144 bits (364),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKG INA +KLPDHSVQADV+SVL+E+ME++ L+LFS LLP+L+ LLDSK+ERHA++S
Sbjct  939   NDIKGGINALRKLPDHSVQADVMSVLMEKMEILNLDLFSCLLPMLMGLLDSKMERHASIS  998

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLV +FGP++ S  SA P+VGVDLHAEQR ECC +C   LQ IQ+I+P L +RGG
Sbjct  999   LEMLLKLVVVFGPMIHSTLSAPPAVGVDLHAEQRQECCNRCFMQLQKIQKILPILERRGG  1058

Query  407   LVAKSA  390
             L+AK A
Sbjct  1059  LLAKCA  1064



>ref|XP_004293499.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Fragaria vesca subsp. vesca]
Length=803

 Score =   143 bits (361),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 84/126 (67%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGA+ A +KLPDH+VQADV+SVL+++++++TL+LFS LLPVLL LLDSKIERHANVS
Sbjct  668  NDIKGAVTAIRKLPDHAVQADVISVLLDKLDILTLDLFSCLLPVLLGLLDSKIERHANVS  727

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV++S  SA P+VGV+L AEQR+ECC QC  +LQ IQ+I+P  +++GG
Sbjct  728  LEMLLKLVAVFGPVIQSTISAPPAVGVNLQAEQRLECCNQCSIYLQKIQKILPVFVRKGG  787

Query  407  LVAKSA  390
            ++A+ A
Sbjct  788  VLARCA  793



>gb|KDO75818.1| hypothetical protein CISIN_1g001462mg [Citrus sinensis]
Length=1074

 Score =   144 bits (362),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKG INA +KLPDHSVQADV+SVL+E+ME++ L+LF  LLP+L+ LLDSK+ERHA++S
Sbjct  939   NDIKGGINALRKLPDHSVQADVMSVLMEKMEILNLDLFLCLLPMLMGLLDSKMERHASIS  998

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLV +FGP++ S  SA P+VGVDLHAEQR ECC +C   LQ IQ+I+P L +RGG
Sbjct  999   LEMLLKLVVVFGPMIHSTLSAPPAVGVDLHAEQRRECCNRCFMQLQKIQKILPILERRGG  1058

Query  407   LVAKSA  390
             L+AK A
Sbjct  1059  LLAKCA  1064



>ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris]
 gb|ESW20210.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris]
Length=828

 Score =   142 bits (359),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGA  A +KLPD SVQADV+SVL+E+ME+ T++LFS LLPVL  LLDSK+ERHA VS
Sbjct  693  NDIKGATTALRKLPDQSVQADVISVLVEKMEIFTMDLFSCLLPVLTGLLDSKMERHAKVS  752

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG  +R+  SA PSVGVDLH E+R ECC QC   LQ IQ I+P LI+RGG
Sbjct  753  LDMLLKLVAVFGSTIRATVSAPPSVGVDLHQEERRECCNQCFMELQKIQMILPILIRRGG  812

Query  407  LVAKSA  390
            ++A+SA
Sbjct  813  ILARSA  818



>ref|XP_006597408.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Glycine max]
Length=706

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGA NA +KLPD SVQADV+SVL+E+ME+ TL+LFS LLPVL  LLDSKIERH  +S
Sbjct  571  NDIKGATNALRKLPDQSVQADVISVLVEKMEIFTLDLFSCLLPVLTGLLDSKIERHVKLS  630

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP +R+  SA PSVGVDLH E+R ECC +C   LQ IQ  +P LI++GG
Sbjct  631  LDMLLKLVAVFGPTIRATVSAPPSVGVDLHQEERRECCNKCFMELQKIQMTLPILIRKGG  690

Query  407  LVAKSA  390
            ++A+SA
Sbjct  691  ILARSA  696



>ref|XP_010278330.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Nelumbo nucifera]
Length=786

 Score =   142 bits (357),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAINA +KLPDHSVQADV S L+E+ME +TL+LFS LLPVL +LLDS  +RH +VSL
Sbjct  652  DIKGAINAMRKLPDHSVQADVTSALMEKMESVTLDLFSCLLPVLTSLLDSMTDRHTSVSL  711

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLV +FGPV+RS  SA PSVGVD+ AE R ECC+QC   LQ I+Q++PT+ +RGGL
Sbjct  712  EMLLKLVTVFGPVIRSTLSASPSVGVDIQAEHRRECCKQCFLQLQKIKQVLPTVTRRGGL  771

Query  404  VAKSA  390
            +AK A
Sbjct  772  IAKCA  776



>ref|XP_009378641.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Pyrus x bretschneideri]
Length=859

 Score =   142 bits (357),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KLPDHSVQADVV+VL+E+M+ +TL+LFS LLPVLL LLDSK ERHAN+S
Sbjct  724  NDIKGAISAIRKLPDHSVQADVVTVLLEKMDCLTLDLFSCLLPVLLGLLDSKTERHANIS  783

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  S    VGV+L AEQR+ECC+QC  HLQ IQ+I+P  ++RGG
Sbjct  784  LEMLLKLVAVFGPVIHSTVSGPRPVGVNLQAEQRLECCKQCSIHLQKIQKILPVFVRRGG  843

Query  407  LVAKSA  390
            ++A+ A
Sbjct  844  VLARCA  849



>ref|XP_007213652.1| hypothetical protein PRUPE_ppa001393mg [Prunus persica]
 gb|EMJ14851.1| hypothetical protein PRUPE_ppa001393mg [Prunus persica]
Length=839

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADV+SVL+E+M+++TL+LFS LLPVLL LLDSKIERHA VS
Sbjct  704  NDIKGAIGAIRKLPDHSVQADVISVLLEKMDILTLDLFSRLLPVLLGLLDSKIERHAIVS  763

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  SA P+VGV+L AEQR++CC QC   LQ IQ+I+P  ++RGG
Sbjct  764  LEMLLKLVAVFGPVIHSTISAPPAVGVNLQAEQRLQCCNQCFIQLQKIQKILPVFVRRGG  823

Query  407  LVAKSA  390
            ++A+ A
Sbjct  824  VLARCA  829



>ref|XP_006583803.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
Length=726

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND K AI+A +KLPD SVQADV+SVL+E+ME++TL+LFS LLPVL  LLDS IERH  VS
Sbjct  591  NDTKSAISALRKLPDLSVQADVISVLVEKMEILTLDLFSCLLPVLTGLLDSNIERHVKVS  650

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP VRS  SA PSVGVDLHAEQR EC  QC   LQ I+ I+P LI+RGG
Sbjct  651  LDMLLKLVAVFGPTVRSTISAPPSVGVDLHAEQRRECSNQCFMQLQKIRLILPILIRRGG  710

Query  407  LVAKSA  390
            L+AKSA
Sbjct  711  LLAKSA  716



>gb|KJB69456.1| hypothetical protein B456_011G024400 [Gossypium raimondii]
Length=987

 Score =   142 bits (358),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N+IKGAI A +KLPDHSVQ DV+SV++E+ME++TL+LFS LLPVL  LLDSK ERH N+S
Sbjct  853  NNIKGAIGALQKLPDHSVQVDVISVIMEKMEILTLDLFSGLLPVLKGLLDSKTERHVNIS  912

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGP++RS  SA   +GVDLHAEQR ECC QC   LQ I +++P L +RGG
Sbjct  913  LEMLLKLVAVFGPMIRSTVSAPRGIGVDLHAEQRRECCNQCFTQLQKILKLLPPLERRGG  972

Query  407  LVAKSA  390
            ++A+ A
Sbjct  973  VIARCA  978



>ref|XP_008224984.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Prunus mume]
Length=851

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADV+SVL+E+M+++TL+LFS LLPVLL LLDSKIERHA VS
Sbjct  716  NDIKGAIGAIRKLPDHSVQADVISVLLEKMDILTLDLFSRLLPVLLGLLDSKIERHAIVS  775

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  SA P+VGV+L AEQR++CC QC   LQ IQ+I+P  ++RGG
Sbjct  776  LEMLLKLVAVFGPVIHSTISAPPAVGVNLQAEQRLQCCNQCFIQLQKIQKILPVFVRRGG  835

Query  407  LVAKSA  390
            ++A+ A
Sbjct  836  VLARCA  841



>ref|XP_008224985.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Prunus mume]
Length=850

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADV+SVL+E+M+++TL+LFS LLPVLL LLDSKIERHA VS
Sbjct  715  NDIKGAIGAIRKLPDHSVQADVISVLLEKMDILTLDLFSRLLPVLLGLLDSKIERHAIVS  774

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  SA P+VGV+L AEQR++CC QC   LQ IQ+I+P  ++RGG
Sbjct  775  LEMLLKLVAVFGPVIHSTISAPPAVGVNLQAEQRLQCCNQCFIQLQKIQKILPVFVRRGG  834

Query  407  LVAKSA  390
            ++A+ A
Sbjct  835  VLARCA  840



>ref|XP_008224983.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Prunus mume]
Length=852

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADV+SVL+E+M+++TL+LFS LLPVLL LLDSKIERHA VS
Sbjct  717  NDIKGAIGAIRKLPDHSVQADVISVLLEKMDILTLDLFSRLLPVLLGLLDSKIERHAIVS  776

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  SA P+VGV+L AEQR++CC QC   LQ IQ+I+P  ++RGG
Sbjct  777  LEMLLKLVAVFGPVIHSTISAPPAVGVNLQAEQRLQCCNQCFIQLQKIQKILPVFVRRGG  836

Query  407  LVAKSA  390
            ++A+ A
Sbjct  837  VLARCA  842



>ref|XP_009378573.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
Length=864

 Score =   141 bits (356),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KLPDHSVQADVV+VL+E+M+ +TL+LFS LLPVLL LLDSK ERHAN+S
Sbjct  729  NDIKGAISAIRKLPDHSVQADVVTVLLEKMDCLTLDLFSCLLPVLLGLLDSKTERHANIS  788

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  S    VGV+L AEQR+ECC+QC  HLQ IQ+I+P  ++RGG
Sbjct  789  LEMLLKLVAVFGPVIHSTVSGPRPVGVNLQAEQRLECCKQCSIHLQKIQKILPVFVRRGG  848

Query  407  LVAKSA  390
            ++A+ A
Sbjct  849  VLARCA  854



>ref|XP_011460265.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Fragaria vesca subsp. vesca]
Length=721

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGA+ A +KLPDH+VQADV+SVL+++++++TL+LFS LLPVLL LLDSKIERHANVS
Sbjct  586  NDIKGAVTAIRKLPDHAVQADVISVLLDKLDILTLDLFSCLLPVLLGLLDSKIERHANVS  645

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV++S  SA P+VGV+L AEQR+ECC QC  +LQ IQ+I+P  +++GG
Sbjct  646  LEMLLKLVAVFGPVIQSTISAPPAVGVNLQAEQRLECCNQCSIYLQKIQKILPVFVRKGG  705

Query  407  LVAKSA  390
            ++A+ A
Sbjct  706  VLARCA  711



>ref|XP_006449267.1| hypothetical protein CICLE_v10014112mg [Citrus clementina]
 gb|ESR62507.1| hypothetical protein CICLE_v10014112mg [Citrus clementina]
Length=1058

 Score =   141 bits (355),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKG INA +KLPDHSVQADV+SVL+E+ME++ L+LF  LLP+L+ LLDSK+ERHA++S
Sbjct  923   NDIKGGINALRKLPDHSVQADVMSVLMEKMEILNLDLFLCLLPMLMGLLDSKMERHASIS  982

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLV +FGP++ S  SA P+VGVDLHAEQR ECC +C   LQ IQ+I+P L + GG
Sbjct  983   LEMLLKLVVVFGPMIHSTLSAPPAVGVDLHAEQRRECCNRCFMQLQKIQKILPILERSGG  1042

Query  407   LVAKSA  390
             L+AK A
Sbjct  1043  LLAKCA  1048



>ref|XP_009378713.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Pyrus x bretschneideri]
Length=745

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KLPDHSVQADVV+VL+E+M+ +TL+LFS LLPVLL LLDSK ERHAN+S
Sbjct  610  NDIKGAISAIRKLPDHSVQADVVTVLLEKMDCLTLDLFSCLLPVLLGLLDSKTERHANIS  669

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  S    VGV+L AEQR+ECC+QC  HLQ IQ+I+P  ++RGG
Sbjct  670  LEMLLKLVAVFGPVIHSTVSGPRPVGVNLQAEQRLECCKQCSIHLQKIQKILPVFVRRGG  729

Query  407  LVAKSA  390
            ++A+ A
Sbjct  730  VLARCA  735



>ref|XP_008371311.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Malus domestica]
Length=694

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADVV+VL+E+M+ +TL+LFS LLPVLL LLDSK ERHAN+S
Sbjct  559  NDIKGAIGAIRKLPDHSVQADVVTVLLEKMDCLTLDLFSCLLPVLLGLLDSKTERHANIS  618

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  S    VGV+L AEQR+ECC+QC  HLQ IQ+I+P  ++RGG
Sbjct  619  LEMLLKLVAVFGPVIHSTVSGPRPVGVNLQAEQRLECCKQCSIHLQKIQKILPVFVRRGG  678

Query  407  LVAKSA  390
            ++A+ A
Sbjct  679  VLARCA  684



>ref|XP_008371310.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
Length=813

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADVV+VL+E+M+ +TL+LFS LLPVLL LLDSK ERHAN+S
Sbjct  678  NDIKGAIGAIRKLPDHSVQADVVTVLLEKMDCLTLDLFSCLLPVLLGLLDSKTERHANIS  737

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+ S  S    VGV+L AEQR+ECC+QC  HLQ IQ+I+P  ++RGG
Sbjct  738  LEMLLKLVAVFGPVIHSTVSGPRPVGVNLQAEQRLECCKQCSIHLQKIQKILPVFVRRGG  797

Query  407  LVAKSA  390
            ++A+ A
Sbjct  798  VLARCA  803



>ref|XP_007159273.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
 gb|ESW31267.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
Length=651

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KL D SVQADV+SVL+E+ME+ TL+LFS LLPVL  L+DSKIERH  VS
Sbjct  514  NDIKGAISALRKLADQSVQADVISVLVEKMEIFTLDLFSCLLPVLTGLVDSKIERHVKVS  573

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP +RS  SA PSVGVDLH EQR EC  QC   LQ I+ I+P LI+ GG
Sbjct  574  LDMLLKLVVVFGPTIRSTISAPPSVGVDLHGEQRRECSNQCFMQLQKIRMILPILIRSGG  633

Query  407  LVAKSA  390
            ++AK A
Sbjct  634  VLAKYA  639



>ref|XP_007159274.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
 gb|ESW31268.1| hypothetical protein PHAVU_002G224100g [Phaseolus vulgaris]
Length=714

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KL D SVQADV+SVL+E+ME+ TL+LFS LLPVL  L+DSKIERH  VS
Sbjct  577  NDIKGAISALRKLADQSVQADVISVLVEKMEIFTLDLFSCLLPVLTGLVDSKIERHVKVS  636

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP +RS  SA PSVGVDLH EQR EC  QC   LQ I+ I+P LI+ GG
Sbjct  637  LDMLLKLVVVFGPTIRSTISAPPSVGVDLHGEQRRECSNQCFMQLQKIRMILPILIRSGG  696

Query  407  LVAKSA  390
            ++AK A
Sbjct  697  VLAKYA  702



>ref|XP_011087019.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Sesamum indicum]
Length=938

 Score =   136 bits (342),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA ++LPDHSV ADVV VLIERM+V TL+LFS LLPVLL L +SK ERHA++S
Sbjct  803  NDVKGAINALRRLPDHSVHADVVDVLIERMDVFTLDLFSCLLPVLLELSESKAERHASIS  862

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL + +G V+RS  SA P+VG+DLHA++R+EC + C +HLQ IQ+ +P L++RGG
Sbjct  863  LEMLLKLTSAYGAVIRSTVSAPPTVGIDLHAQERLECSKLCASHLQNIQKNLPDLVKRGG  922

Query  407  LVAKSA  390
             V + A
Sbjct  923  AVGRWA  928



>ref|XP_010696580.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=820

 Score =   135 bits (340),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K AI A +KLPDHSVQADVVSV +E+ME+I ++LFS +LPVL+ LLDSK+ERHA ++
Sbjct  683  NDVKDAIIALRKLPDHSVQADVVSVFMEKMEIINMDLFSCMLPVLVGLLDSKMERHAKMA  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA FGP +RS  SA P+VGVDLH E+RI CC+QC   LQ IQ ++  L +RGG
Sbjct  743  LDMLLKLVAAFGPTIRSTISAPPAVGVDLHQEERIACCKQCFVQLQQIQGLLSALARRGG  802

Query  407  LVAKSA  390
             +A+SA
Sbjct  803  SLARSA  808



>ref|XP_010696579.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=820

 Score =   135 bits (340),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K AI A +KLPDHSVQADVVSV +E+ME+I ++LFS +LPVL+ LLDSK+ERHA ++
Sbjct  683  NDVKDAIIALRKLPDHSVQADVVSVFMEKMEIINMDLFSCMLPVLVGLLDSKMERHAKMA  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA FGP +RS  SA P+VGVDLH E+RI CC+QC   LQ IQ ++  L +RGG
Sbjct  743  LDMLLKLVAAFGPTIRSTISAPPAVGVDLHQEERIACCKQCFVQLQQIQGLLSALARRGG  802

Query  407  LVAKSA  390
             +A+SA
Sbjct  803  SLARSA  808



>ref|XP_010696578.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=821

 Score =   135 bits (340),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K AI A +KLPDHSVQADVVSV +E+ME+I ++LFS +LPVL+ LLDSK+ERHA ++
Sbjct  684  NDVKDAIIALRKLPDHSVQADVVSVFMEKMEIINMDLFSCMLPVLVGLLDSKMERHAKMA  743

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA FGP +RS  SA P+VGVDLH E+RI CC+QC   LQ IQ ++  L +RGG
Sbjct  744  LDMLLKLVAAFGPTIRSTISAPPAVGVDLHQEERIACCKQCFVQLQQIQGLLSALARRGG  803

Query  407  LVAKSA  390
             +A+SA
Sbjct  804  SLARSA  809



>gb|KDO75817.1| hypothetical protein CISIN_1g001462mg [Citrus sinensis]
Length=1072

 Score =   135 bits (340),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 83/126 (66%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKG INA +KLPDHS  ADV+SVL+E+ME++ L+LF  LLP+L+ LLDSK+ERHA++S
Sbjct  939   NDIKGGINALRKLPDHS--ADVMSVLMEKMEILNLDLFLCLLPMLMGLLDSKMERHASIS  996

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLV +FGP++ S  SA P+VGVDLHAEQR ECC +C   LQ IQ+I+P L +RGG
Sbjct  997   LEMLLKLVVVFGPMIHSTLSAPPAVGVDLHAEQRRECCNRCFMQLQKIQKILPILERRGG  1056

Query  407   LVAKSA  390
             L+AK A
Sbjct  1057  LLAKCA  1062



>gb|KJB34818.1| hypothetical protein B456_006G086000 [Gossypium raimondii]
 gb|KJB34819.1| hypothetical protein B456_006G086000 [Gossypium raimondii]
Length=781

 Score =   134 bits (336),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KLPDHSVQ D +SV +++ME++TL+LFS LLPVL  LLDSKIERH  VS
Sbjct  647  NDIKGAIDALRKLPDHSVQVDSISVFMQKMEILTLDLFSGLLPVLTGLLDSKIERHVIVS  706

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+R  A A  SV VDLH EQR ECC QC   L+ I +++P L +RGG
Sbjct  707  LEMLLKLVAVFGPVIRLTALAPRSVSVDLHGEQRRECCNQCSMQLEKIHKLLPLLQRRGG  766

Query  407  LVAKSA  390
             +A+ A
Sbjct  767  TIARCA  772



>dbj|BAC43272.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39920.1| At1g61220 [Arabidopsis thaliana]
Length=163

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGAI A +KL DHSVQADV+++L ++ E++TL+LFS L PVL  LL SK ER  NVS
Sbjct  28   SDIKGAIAALRKLSDHSVQADVINILTDKTEILTLDLFSQLAPVLTGLLGSKTERPVNVS  87

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FG V++S  SAR  VGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  88   LEMLLKLVAVFGTVIQSTVSARRVVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  147

Query  407  LVAKSA  390
            L+A+ A
Sbjct  148  LIARKA  153



>gb|KJB34817.1| hypothetical protein B456_006G086000 [Gossypium raimondii]
Length=780

 Score =   133 bits (334),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +KLPDHSVQ D +SV +++ME++TL+LFS LLPVL  LLDSKIERH  VS
Sbjct  647  NDIKGAIDALRKLPDHSVQVDSISVFMQKMEILTLDLFSGLLPVLTGLLDSKIERHVIVS  706

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+R  A A  SV VDLH EQR ECC QC   L+ I +++P L+QRGG
Sbjct  707  LEMLLKLVAVFGPVIRLTALAPRSVSVDLHGEQRRECCNQCSMQLEKIHKLLP-LLQRGG  765

Query  407  LVAKSA  390
             +A+ A
Sbjct  766  TIARCA  771



>ref|XP_003593480.1| Katanin p80 WD40-containing subunit B1 [Medicago truncatula]
Length=1131

 Score =   134 bits (336),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKGAI+A +KLPD SVQADV+SVL+E+ME++TL+L +SLLPVL  LLDSK ERH  VS
Sbjct  996   NDIKGAISALRKLPDQSVQADVISVLMEKMEILTLDLLASLLPVLTGLLDSKTERHVKVS  1055

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLK  A+FG  + +  SA PSVGVDLH EQR ECC +C   LQ +Q I+P LI+RGG
Sbjct  1056  LDMLLKFAAVFGSTITATISAPPSVGVDLHREQRRECCNECFMELQKVQTILPMLIRRGG  1115

Query  407   LVAKSA  390
             L+AKS+
Sbjct  1116  LLAKSS  1121



>gb|AES63731.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula]
Length=1111

 Score =   134 bits (336),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKGAI+A +KLPD SVQADV+SVL+E+ME++TL+L +SLLPVL  LLDSK ERH  VS
Sbjct  976   NDIKGAISALRKLPDQSVQADVISVLMEKMEILTLDLLASLLPVLTGLLDSKTERHVKVS  1035

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLK  A+FG  + +  SA PSVGVDLH EQR ECC +C   LQ +Q I+P LI+RGG
Sbjct  1036  LDMLLKFAAVFGSTITATISAPPSVGVDLHREQRRECCNECFMELQKVQTILPMLIRRGG  1095

Query  407   LVAKSA  390
             L+AKS+
Sbjct  1096  LLAKSS  1101



>ref|XP_010547296.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Tarenaya hassleriana]
Length=979

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL DHSVQADV+S+L ++ E++ L+LFS LLPVL  LL S+ ER  NVS
Sbjct  844  NDVKGAIGALRKLSDHSVQADVISILSDKTEILKLDLFSQLLPVLSGLLGSRTERSVNVS  903

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+RS  SA   VGVDLHAEQR+E CR C   LQ +Q+I+P L +RGG
Sbjct  904  LEMLLKLVAVFGPVIRSTVSAPRIVGVDLHAEQRLEICRSCFEELQKVQKILPVLSRRGG  963

Query  407  LVAKSA  390
            L+++ A
Sbjct  964  LISRKA  969



>ref|XP_010547289.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Tarenaya hassleriana]
Length=980

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL DHSVQADV+S+L ++ E++ L+LFS LLPVL  LL S+ ER  NVS
Sbjct  845  NDVKGAIGALRKLSDHSVQADVISILSDKTEILKLDLFSQLLPVLSGLLGSRTERSVNVS  904

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+RS  SA   VGVDLHAEQR+E CR C   LQ +Q+I+P L +RGG
Sbjct  905  LEMLLKLVAVFGPVIRSTVSAPRIVGVDLHAEQRLEICRSCFEELQKVQKILPVLSRRGG  964

Query  407  LVAKSA  390
            L+++ A
Sbjct  965  LISRKA  970



>ref|XP_010547320.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Tarenaya hassleriana]
Length=861

 Score =   130 bits (327),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL DHSVQADV+S+L ++ E++ L+LFS LLPVL  LL S+ ER  NVS
Sbjct  726  NDVKGAIGALRKLSDHSVQADVISILSDKTEILKLDLFSQLLPVLSGLLGSRTERSVNVS  785

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+RS  SA   VGVDLHAEQR+E CR C   LQ +Q+I+P L +RGG
Sbjct  786  LEMLLKLVAVFGPVIRSTVSAPRIVGVDLHAEQRLEICRSCFEELQKVQKILPVLSRRGG  845

Query  407  LVAKSA  390
            L+++ A
Sbjct  846  LISRKA  851



>ref|XP_010547314.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Tarenaya hassleriana]
Length=977

 Score =   130 bits (327),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL DHSVQADV+S+L ++ E++ L+LFS LLPVL  LL S+ ER  NVS
Sbjct  842  NDVKGAIGALRKLSDHSVQADVISILSDKTEILKLDLFSQLLPVLSGLLGSRTERSVNVS  901

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+RS  SA   VGVDLHAEQR+E CR C   LQ +Q+I+P L +RGG
Sbjct  902  LEMLLKLVAVFGPVIRSTVSAPRIVGVDLHAEQRLEICRSCFEELQKVQKILPVLSRRGG  961

Query  407  LVAKSA  390
            L+++ A
Sbjct  962  LISRKA  967



>ref|XP_010547304.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Tarenaya hassleriana]
Length=978

 Score =   130 bits (327),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL DHSVQADV+S+L ++ E++ L+LFS LLPVL  LL S+ ER  NVS
Sbjct  843  NDVKGAIGALRKLSDHSVQADVISILSDKTEILKLDLFSQLLPVLSGLLGSRTERSVNVS  902

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FGPV+RS  SA   VGVDLHAEQR+E CR C   LQ +Q+I+P L +RGG
Sbjct  903  LEMLLKLVAVFGPVIRSTVSAPRIVGVDLHAEQRLEICRSCFEELQKVQKILPVLSRRGG  962

Query  407  LVAKSA  390
            L+++ A
Sbjct  963  LISRKA  968



>emb|CDY52222.1| BnaA01g35940D [Brassica napus]
Length=1122

 Score =   128 bits (321),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKGAI A KKL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  +VS
Sbjct  987   NDIKGAIMALKKLSDHSVQADVISILTDKPEILTLDLFSQLAPVLTGLLGSRTERPVSVS  1046

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR SVGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1047  LEMLLKLVAVFGAVVQSNVSARRSVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1106

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1107  LIARKA  1112



>ref|XP_009104461.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Brassica rapa]
Length=1124

 Score =   128 bits (321),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKGAI A KKL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  +VS
Sbjct  989   NDIKGAIMALKKLSDHSVQADVISILTDKPEILTLDLFSQLAPVLTGLLGSRTERPVSVS  1048

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR SVGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1049  LEMLLKLVAVFGAVVQSNVSARRSVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1108

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1109  LIARKA  1114



>ref|XP_009104469.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Brassica rapa]
Length=1122

 Score =   127 bits (320),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKGAI A KKL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  +VS
Sbjct  987   NDIKGAIMALKKLSDHSVQADVISILTDKPEILTLDLFSQLAPVLTGLLGSRTERPVSVS  1046

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR SVGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1047  LEMLLKLVAVFGAVVQSNVSARRSVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1106

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1107  LIARKA  1112



>ref|XP_008776508.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Phoenix dactylifera]
Length=846

 Score =   125 bits (315),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG INA +K+ DH+V AD+VS+L+E+ + ITL+L +  LP+L  LL SK ERH ++S
Sbjct  711  NDVKGVINAMEKMSDHAVSADLVSILMEKGDAITLDLCTCFLPLLTGLLGSKFERHTSIS  770

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+ IFGPV+ SA SA PSVGVDL AE+R++ CR C    + ++ I+P+L +RGG
Sbjct  771  LEMLLKLIKIFGPVIHSALSAVPSVGVDLQAEERLKKCRSCFIGFEKVKHILPSLTRRGG  830

Query  407  LVAKSA  390
             VA+SA
Sbjct  831  SVARSA  836



>ref|NP_176316.4| protein DWD hypersensitive to ABA 3 [Arabidopsis thaliana]
 gb|AEE33803.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=1181

 Score =   126 bits (316),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DIKGAI A +KL DHSVQADV+++L ++ E++TL+LFS L PVL  LL SK ER  NVS
Sbjct  1046  SDIKGAIAALRKLSDHSVQADVINILTDKTEILTLDLFSQLAPVLTGLLGSKTERPVNVS  1105

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG V++S  SAR  VGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1106  LEMLLKLVAVFGTVIQSTVSARRVVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1165

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1166  LIARKA  1171



>ref|NP_001185277.1| protein DWD hypersensitive to ABA 3 [Arabidopsis thaliana]
 gb|AEE33804.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=1179

 Score =   126 bits (316),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DIKGAI A +KL DHSVQADV+++L ++ E++TL+LFS L PVL  LL SK ER  NVS
Sbjct  1044  SDIKGAIAALRKLSDHSVQADVINILTDKTEILTLDLFSQLAPVLTGLLGSKTERPVNVS  1103

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG V++S  SAR  VGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1104  LEMLLKLVAVFGTVIQSTVSARRVVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1163

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1164  LIARKA  1169



>ref|XP_010430118.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Camelina sativa]
Length=1180

 Score =   125 bits (314),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DIKGAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVS
Sbjct  1045  SDIKGAIMALRKLSDHSVQADVISILTDKTEILTLDLFSQLAPVLTGLLGSRTERPVNVS  1104

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR  VGVDLHAE+R++ C+ C A LQ + +I+P L +RGG
Sbjct  1105  LEMLLKLVAVFGTVVQSTVSARRVVGVDLHAEERLQICQSCSAELQKVHKILPLLTRRGG  1164

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1165  LIARKA  1170



>ref|XP_010473325.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1231

 Score =   125 bits (314),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DIKGAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVS
Sbjct  1096  SDIKGAIMALRKLSDHSVQADVISILTDKTEILTLDLFSQLAPVLTGLLGSRTERPVNVS  1155

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR  VGVDLHAE+R++ C+ C A LQ + +I+P L +RGG
Sbjct  1156  LEMLLKLVAVFGTVVQSTVSARRVVGVDLHAEERLQMCQSCSAELQKVHKILPLLTRRGG  1215

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1216  LIARKA  1221



>ref|XP_010473326.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1229

 Score =   125 bits (314),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DIKGAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVS
Sbjct  1094  SDIKGAIMALRKLSDHSVQADVISILTDKTEILTLDLFSQLAPVLTGLLGSRTERPVNVS  1153

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR  VGVDLHAE+R++ C+ C A LQ + +I+P L +RGG
Sbjct  1154  LEMLLKLVAVFGTVVQSTVSARRVVGVDLHAEERLQMCQSCSAELQKVHKILPLLTRRGG  1213

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1214  LIARKA  1219



>ref|XP_010933308.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=825

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG INA +K+ DH+V AD+VS+L+E  + ITL+L + LLP+L  LL+SKI+RH ++S
Sbjct  689  NDVKGVINAMEKMSDHAVSADLVSILMEMSDAITLDLCTYLLPLLTGLLESKIDRHTSIS  748

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+ IFGPV+ SA SA PSVGVDL  E+R+E C+ C    + +++I+P+L +RGG
Sbjct  749  LEMLLKLIKIFGPVIHSALSAVPSVGVDLQVEERLEKCKTCFIEFEKVKRILPSLTRRGG  808

Query  407  LVAKSA  390
             +A+SA
Sbjct  809  SIARSA  814



>ref|XP_010933310.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Elaeis guineensis]
Length=774

 Score =   124 bits (311),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG INA +K+ DH+V AD+VS+L+E  + ITL+L + LLP+L  LL+SKI+RH ++S
Sbjct  638  NDVKGVINAMEKMSDHAVSADLVSILMEMSDAITLDLCTYLLPLLTGLLESKIDRHTSIS  697

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+ IFGPV+ SA SA PSVGVDL  E+R+E C+ C    + +++I+P+L +RGG
Sbjct  698  LEMLLKLIKIFGPVIHSALSAVPSVGVDLQVEERLEKCKTCFIEFEKVKRILPSLTRRGG  757

Query  407  LVAKSA  390
             +A+SA
Sbjct  758  SIARSA  763



>ref|XP_010933307.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=847

 Score =   124 bits (312),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG INA +K+ DH+V AD+VS+L+E  + ITL+L + LLP+L  LL+SKI+RH ++S
Sbjct  711  NDVKGVINAMEKMSDHAVSADLVSILMEMSDAITLDLCTYLLPLLTGLLESKIDRHTSIS  770

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+ IFGPV+ SA SA PSVGVDL  E+R+E C+ C    + +++I+P+L +RGG
Sbjct  771  LEMLLKLIKIFGPVIHSALSAVPSVGVDLQVEERLEKCKTCFIEFEKVKRILPSLTRRGG  830

Query  407  LVAKSA  390
             +A+SA
Sbjct  831  SIARSA  836



>ref|XP_010933311.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Elaeis guineensis]
Length=622

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG INA +K+ DH+V AD+VS+L+E  + ITL+L + LLP+L  LL+SKI+RH ++S
Sbjct  486  NDVKGVINAMEKMSDHAVSADLVSILMEMSDAITLDLCTYLLPLLTGLLESKIDRHTSIS  545

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+ IFGPV+ SA SA PSVGVDL  E+R+E C+ C    + +++I+P+L +RGG
Sbjct  546  LEMLLKLIKIFGPVIHSALSAVPSVGVDLQVEERLEKCKTCFIEFEKVKRILPSLTRRGG  605

Query  407  LVAKSA  390
             +A+SA
Sbjct  606  SIARSA  611



>gb|EPS68225.1| hypothetical protein M569_06544, partial [Genlisea aurea]
Length=758

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KLPDH+VQADVV VL+++ME+ITL+LFS LLP+L  LL S +ERH + S
Sbjct  625  NDVKGAIEALRKLPDHAVQADVVGVLVQKMELITLDLFSCLLPMLEGLLSSPVERHGSTS  684

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEM++KL A+FG  VRS  SA  +VGVD+H E+R E C+QC  HLQ IQ+++P L++R G
Sbjct  685  LEMVMKLWAVFGSTVRSTVSAPQAVGVDIHGEERFEWCKQCACHLQSIQRMLPELVKREG  744

Query  407  LVAKSA  390
             + + A
Sbjct  745  NIGRYA  750



>ref|XP_006300659.1| hypothetical protein CARUB_v10019681mg [Capsella rubella]
 gb|EOA33557.1| hypothetical protein CARUB_v10019681mg [Capsella rubella]
Length=1184

 Score =   124 bits (312),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DIKGAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVS
Sbjct  1049  SDIKGAIMALRKLSDHSVQADVISILTDKTEILTLDLFSQLAPVLTGLLGSRTERPVNVS  1108

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG V++S  SAR  VGVDLHAE+R++ C+ C A LQ + +I+P L +RGG
Sbjct  1109  LEMLLKLVAVFGTVIQSTVSARRVVGVDLHAEERLQICQSCSAELQKVHKILPLLTRRGG  1168

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1169  LIARKA  1174



>ref|XP_007025735.1| Katanin P80 subunit, putative isoform 3 [Theobroma cacao]
 gb|EOY28357.1| Katanin P80 subunit, putative isoform 3 [Theobroma cacao]
Length=927

 Score =   124 bits (311),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 72/94 (77%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +KLPDHSVQADV+SVL+E+ME++TL+LFS L+PVL+ LLDSK+ERH NVS
Sbjct  832  NDIKGAIGALRKLPDHSVQADVISVLMEKMEILTLDLFSGLIPVLMGLLDSKMERHVNVS  891

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQR  486
            LEMLLKLVA+FGP++RS  SAR  VGVDLHAEQR
Sbjct  892  LEMLLKLVAVFGPMIRSTVSARRGVGVDLHAEQR  925



>ref|XP_006392030.1| hypothetical protein EUTSA_v10023227mg [Eutrema salsugineum]
 gb|ESQ29316.1| hypothetical protein EUTSA_v10023227mg [Eutrema salsugineum]
Length=1127

 Score =   124 bits (311),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  764   DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
             DIKGAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVSL
Sbjct  993   DIKGAITALRKLSDHSVQADVISILTDKTEILTLDLFSELAPVLTGLLGSRTERPINVSL  1052

Query  584   EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
             EMLLKLVA+FG VV+S  SAR  VGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGGL
Sbjct  1053  EMLLKLVAVFGTVVQSTVSARRMVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGGL  1112

Query  404   VAKSA  390
             + + A
Sbjct  1113  IGRKA  1117



>emb|CDY03812.1| BnaC01g29290D [Brassica napus]
Length=1123

 Score =   124 bits (310),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             NDIKGAI A KKL D SVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  +VS
Sbjct  988   NDIKGAIMALKKLSDPSVQADVISILTDKPEILTLDLFSQLAPVLTGLLGSRTERPVSVS  1047

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR SVGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1048  LEMLLKLVAVFGAVVQSNVSARRSVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1107

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1108  LIARKA  1113



>gb|KFK40724.1| hypothetical protein AALP_AA2G032800 [Arabis alpina]
Length=1230

 Score =   123 bits (309),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DI GAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVS
Sbjct  1095  SDINGAIMALRKLSDHSVQADVISILADKTEILTLDLFSQLAPVLTGLLGSRTERPINVS  1154

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR  VGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1155  LEMLLKLVAVFGTVVQSTVSARRVVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1214

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1215  LIARKA  1220



>gb|KFK40725.1| hypothetical protein AALP_AA2G032800 [Arabis alpina]
Length=1232

 Score =   123 bits (309),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +DI GAI A +KL DHSVQADV+S+L ++ E++TL+LFS L PVL  LL S+ ER  NVS
Sbjct  1097  SDINGAIMALRKLSDHSVQADVISILADKTEILTLDLFSQLAPVLTGLLGSRTERPINVS  1156

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG VV+S  SAR  VGVDLHAE+R++ C+ C A LQ +Q+I+P L +RGG
Sbjct  1157  LEMLLKLVAVFGTVVQSTVSARRVVGVDLHAEERLQICQSCSAELQKVQKILPLLTRRGG  1216

Query  407   LVAKSA  390
             L+A+ A
Sbjct  1217  LIARKA  1222



>ref|XP_008800146.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Phoenix dactylifera]
Length=839

 Score =   122 bits (307),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAINA  KLPDHSVQ D++S+L E+++  TLELFS LLP+L+ L +S+ ERH  +S
Sbjct  704  NGIKGAINAVAKLPDHSVQVDLISILKEKIDRFTLELFSCLLPLLVGLSNSRTERHLIIS  763

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLL+LV IFGPV+    SA   VGVDL AEQR+E C  C  HL++I+Q++P+LI+RGG
Sbjct  764  LEMLLELVKIFGPVIHLTMSASSLVGVDLQAEQRLERCSHCFNHLEMIKQLLPSLIRRGG  823

Query  407  LVAKSA  390
            L+A+ A
Sbjct  824  LIARHA  829



>ref|XP_010533875.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Tarenaya hassleriana]
Length=971

 Score =   122 bits (306),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A KKL DHSVQADV+ +L ++ EV+ L+LFS LLP+L  LL S+ ER  NVSL
Sbjct  837  DIKGAIGALKKLSDHSVQADVIGILTDKTEVLKLDLFSELLPILSGLLGSRAERPVNVSL  896

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLVA FG V+RS  SA   VGVDLHAE+R+E CR C A LQ +Q+I+P L +RGG+
Sbjct  897  EMLLKLVAAFGSVIRSTVSAPRIVGVDLHAEERLEICRSCFAELQKVQKILPVLAKRGGI  956

Query  404  VAKSA  390
            +++ +
Sbjct  957  ISRKS  961



>ref|XP_010533874.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Tarenaya hassleriana]
Length=972

 Score =   122 bits (306),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A KKL DHSVQADV+ +L ++ EV+ L+LFS LLP+L  LL S+ ER  NVSL
Sbjct  838  DIKGAIGALKKLSDHSVQADVIGILTDKTEVLKLDLFSELLPILSGLLGSRAERPVNVSL  897

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLVA FG V+RS  SA   VGVDLHAE+R+E CR C A LQ +Q+I+P L +RGG+
Sbjct  898  EMLLKLVAAFGSVIRSTVSAPRIVGVDLHAEERLEICRSCFAELQKVQKILPVLAKRGGI  957

Query  404  VAKSA  390
            +++ +
Sbjct  958  ISRKS  962



>ref|XP_010533879.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Tarenaya hassleriana]
Length=853

 Score =   122 bits (305),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A KKL DHSVQADV+ +L ++ EV+ L+LFS LLP+L  LL S+ ER  NVSL
Sbjct  719  DIKGAIGALKKLSDHSVQADVIGILTDKTEVLKLDLFSELLPILSGLLGSRAERPVNVSL  778

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLVA FG V+RS  SA   VGVDLHAE+R+E CR C A LQ +Q+I+P L +RGG+
Sbjct  779  EMLLKLVAAFGSVIRSTVSAPRIVGVDLHAEERLEICRSCFAELQKVQKILPVLAKRGGI  838

Query  404  VAKSA  390
            +++ +
Sbjct  839  ISRKS  843



>ref|XP_010533878.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Tarenaya hassleriana]
Length=969

 Score =   122 bits (305),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A KKL DHSVQADV+ +L ++ EV+ L+LFS LLP+L  LL S+ ER  NVSL
Sbjct  835  DIKGAIGALKKLSDHSVQADVIGILTDKTEVLKLDLFSELLPILSGLLGSRAERPVNVSL  894

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLVA FG V+RS  SA   VGVDLHAE+R+E CR C A LQ +Q+I+P L +RGG+
Sbjct  895  EMLLKLVAAFGSVIRSTVSAPRIVGVDLHAEERLEICRSCFAELQKVQKILPVLAKRGGI  954

Query  404  VAKSA  390
            +++ +
Sbjct  955  ISRKS  959



>ref|XP_010533877.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Tarenaya hassleriana]
Length=970

 Score =   122 bits (305),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A KKL DHSVQADV+ +L ++ EV+ L+LFS LLP+L  LL S+ ER  NVSL
Sbjct  836  DIKGAIGALKKLSDHSVQADVIGILTDKTEVLKLDLFSELLPILSGLLGSRAERPVNVSL  895

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            EMLLKLVA FG V+RS  SA   VGVDLHAE+R+E CR C A LQ +Q+I+P L +RGG+
Sbjct  896  EMLLKLVAAFGSVIRSTVSAPRIVGVDLHAEERLEICRSCFAELQKVQKILPVLAKRGGI  955

Query  404  VAKSA  390
            +++ +
Sbjct  956  ISRKS  960



>ref|XP_010905608.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Elaeis guineensis]
 ref|XP_010905609.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Elaeis guineensis]
Length=774

 Score =   120 bits (300),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAINA  KLPDHSVQ D++S+L E++++ TLELFS LLP+L+ LL+S+ ERH  V+
Sbjct  639  NGIKGAINAVVKLPDHSVQVDLISILKEKIDLFTLELFSCLLPLLVGLLNSRTERHLIVA  698

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLL+LV IFGPV+ S  SA   VGVDL AEQR+E C  C  HL+ I+Q++P+LI+R G
Sbjct  699  LEMLLELVKIFGPVIHSTMSASSLVGVDLQAEQRLERCSNCFNHLEKIKQMLPSLIRREG  758

Query  407  LVAKSA  390
            L+ + A
Sbjct  759  LLGRHA  764



>gb|ABK26032.1| unknown [Picea sitchensis]
Length=163

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A  K+ DHSV ADV+SVLIER E+ TL++ + +LP+L  LL S+I+RH  V+
Sbjct  28   NDLKGAIDATGKMGDHSVSADVISVLIERSEIFTLDICTVILPLLTRLLQSEIDRHLTVA  87

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +E LL LV  FG V+R+   A P++GVDL AEQR+E C  C   L+ I+QI+  LI+RGG
Sbjct  88   METLLVLVKTFGDVIRTTMGASPAIGVDLQAEQRLERCNLCYIELENIKQILVPLIRRGG  147

Query  407  LVAKSA  390
             +AKSA
Sbjct  148  AIAKSA  153



>ref|XP_010905607.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Elaeis guineensis]
Length=797

 Score =   120 bits (300),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAINA  KLPDHSVQ D++S+L E++++ TLELFS LLP+L+ LL+S+ ERH  V+
Sbjct  662  NGIKGAINAVVKLPDHSVQVDLISILKEKIDLFTLELFSCLLPLLVGLLNSRTERHLIVA  721

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLL+LV IFGPV+ S  SA   VGVDL AEQR+E C  C  HL+ I+Q++P+LI+R G
Sbjct  722  LEMLLELVKIFGPVIHSTMSASSLVGVDLQAEQRLERCSNCFNHLEKIKQMLPSLIRREG  781

Query  407  LVAKSA  390
            L+ + A
Sbjct  782  LLGRHA  787



>ref|XP_010905604.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=839

 Score =   120 bits (300),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAINA  KLPDHSVQ D++S+L E++++ TLELFS LLP+L+ LL+S+ ERH  V+
Sbjct  704  NGIKGAINAVVKLPDHSVQVDLISILKEKIDLFTLELFSCLLPLLVGLLNSRTERHLIVA  763

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLL+LV IFGPV+ S  SA   VGVDL AEQR+E C  C  HL+ I+Q++P+LI+R G
Sbjct  764  LEMLLELVKIFGPVIHSTMSASSLVGVDLQAEQRLERCSNCFNHLEKIKQMLPSLIRREG  823

Query  407  LVAKSA  390
            L+ + A
Sbjct  824  LLGRHA  829



>ref|XP_009418645.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Musa acuminata subsp. malaccensis]
Length=775

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG I+A +K+ DH+V ADV+S L+++ ++ITL++ ++LLP+L +LL+SK++RH  +S
Sbjct  639  NDIKGVISAIEKMSDHAVSADVLSSLMDKSDIITLDICTALLPLLASLLESKMDRHLGIS  698

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFGPV+ S  SA PSVGVDL AEQR+E C  C   L+ ++  I  LI+RGG
Sbjct  699  LEMLLKLVRIFGPVISSTLSAGPSVGVDLQAEQRLERCNLCFIELEKVKHRISLLIRRGG  758

Query  407  LVAKSA  390
             +AKSA
Sbjct  759  SIAKSA  764



>ref|XP_007025736.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOY28358.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma 
cacao]
Length=963

 Score =   119 bits (298),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/95 (76%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSV-QADVVSVLIERMEVITlelfssllpvllalldSKIERHANV  591
            NDIKGAI A +KLPDHSV QADV+SVL+E+ME++TL+LFS L+PVL+ LLDSK+ERH NV
Sbjct  813  NDIKGAIGALRKLPDHSVVQADVISVLMEKMEILTLDLFSGLIPVLMGLLDSKMERHVNV  872

Query  590  SLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQR  486
            SLEMLLKLVA+FGP++RS  SAR  VGVDLHAEQR
Sbjct  873  SLEMLLKLVAVFGPMIRSTVSARRGVGVDLHAEQR  907



>ref|XP_010492426.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Camelina sativa]
Length=1014

 Score =   119 bits (298),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  879   NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  938

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  939   LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQLCSAGLHKIQRILPVLARRGG  998

Query  407   LVAKSA  390
             L+ + A
Sbjct  999   LITRKA  1004



>ref|XP_006848621.1| hypothetical protein AMTR_s00171p00033150 [Amborella trichopoda]
 gb|ERN10202.1| hypothetical protein AMTR_s00171p00033150 [Amborella trichopoda]
Length=800

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAINA +K+ DHSV ADV+S+L+E+ + ITLE+ + LLP+L +LLDSK++RH  +S
Sbjct  664  NDVKGAINAMQKMSDHSVFADVISILMEKSDSITLEICTCLLPLLSSLLDSKMDRHIGIS  723

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE LLKLV +FGPV+ S  SA  SVGVDL AEQR+E C  C   L+ ++  IP+L ++GG
Sbjct  724  LEALLKLVRVFGPVIHSTLSASSSVGVDLQAEQRLERCNLCFIELEKVKHAIPSLAKKGG  783

Query  407  LVAKSA  390
             VAK A
Sbjct  784  SVAKFA  789



>gb|KHG05933.1| hypothetical protein F383_10434 [Gossypium arboreum]
Length=904

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 69/94 (73%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKG+I A +KLPDHSVQADV+ VL+E+ME++ L+LFS LLPVL+ LLDSK+ERH N+S
Sbjct  793  NDIKGSIGALRKLPDHSVQADVIGVLMEKMEILNLDLFSGLLPVLMGLLDSKMERHINIS  852

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQR  486
            LEMLL+LVA+FGP++RS  SAR SVGVDLHAEQR
Sbjct  853  LEMLLRLVAVFGPMIRSTVSARCSVGVDLHAEQR  886



>ref|XP_010492410.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1019

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  884   NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  943

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  944   LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQLCSAGLHKIQRILPVLARRGG  1003

Query  407   LVAKSA  390
             L+ + A
Sbjct  1004  LITRKA  1009



>emb|CDY34658.1| BnaC08g42170D [Brassica napus]
Length=766

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  631  SDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  690

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  SA   VGVDLHA++RI+ C+ C A L  IQ+I+P L +RGG
Sbjct  691  LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERIQICQVCSAGLHKIQRILPILARRGG  750

Query  407  LVAKSA  390
            L+ + A
Sbjct  751  LITRKA  756



>ref|XP_010492441.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Camelina sativa]
Length=991

 Score =   119 bits (297),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  856  NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  915

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  916  LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQLCSAGLHKIQRILPVLARRGG  975

Query  407  LVAKSA  390
            L+ + A
Sbjct  976  LITRKA  981



>ref|XP_010492450.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X6 [Camelina sativa]
Length=1009

 Score =   119 bits (297),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  874  NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  933

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  934  LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQLCSAGLHKIQRILPVLARRGG  993

Query  407  LVAKSA  390
            L+ + A
Sbjct  994  LITRKA  999



>ref|XP_010492433.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Camelina sativa]
Length=1011

 Score =   119 bits (297),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  876   NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  935

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  936   LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQLCSAGLHKIQRILPVLARRGG  995

Query  407   LVAKSA  390
             L+ + A
Sbjct  996   LITRKA  1001



>ref|XP_010492418.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1017

 Score =   119 bits (297),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  882   NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  941

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  942   LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQLCSAGLHKIQRILPVLARRGG  1001

Query  407   LVAKSA  390
             L+ + A
Sbjct  1002  LITRKA  1007



>emb|CDY15006.1| BnaCnng04090D [Brassica napus]
Length=1014

 Score =   118 bits (296),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  764   DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
             DIKGAI A KKL DHS QADV+S+L ++ +++TL+LFS L PVL  L+ S+ ER  +VSL
Sbjct  880   DIKGAIMALKKLSDHSFQADVISILTDKTDILTLDLFSQLAPVLTGLVGSRTERPVSVSL  939

Query  584   EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
             EMLLKLVA+FG VV+S  SAR SVGVD+HAE+R++ C+ C A LQ IQ+I+P L +R GL
Sbjct  940   EMLLKLVAVFGTVVQSTVSARRSVGVDIHAEERLQICQSCSAELQKIQKILPLLTRRVGL  999

Query  404   VAKSA  390
             +A+ A
Sbjct  1000  IARKA  1004



>ref|NP_172582.2| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AEE28692.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=1021

 Score =   118 bits (296),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 73/126 (58%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +D+KGAI A +KL D SVQADV+S+L E++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  886   SDVKGAIGALRKLTDQSVQADVISILTEKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  945

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA +R+E C+ C A L  IQ+I+P L +RGG
Sbjct  946   LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHANERLEICQICSAGLHKIQRILPVLARRGG  1005

Query  407   LVAKSA  390
             L+ + A
Sbjct  1006  LITRKA  1011



>ref|XP_006417385.1| hypothetical protein EUTSA_v10006699mg [Eutrema salsugineum]
 gb|ESQ35738.1| hypothetical protein EUTSA_v10006699mg [Eutrema salsugineum]
Length=970

 Score =   118 bits (296),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 73/126 (58%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++EV+TL++FS L+PVL +LL S+ ER  +VS
Sbjct  835  SDVKGAIGALRKLTDQSVQADVISILTDKIEVLTLDMFSQLVPVLTSLLGSRTERPVHVS  894

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FG ++RS  SA   VGVDLHA++RI+ C+ C A L  IQ+I+P L +RGG
Sbjct  895  LEMLLKLVAVFGTIIRSTVSAPRIVGVDLHADERIQICQICSAGLHKIQRILPILARRGG  954

Query  407  LVAKSA  390
            L+A+ A
Sbjct  955  LIARKA  960



>ref|XP_002889852.1| hypothetical protein ARALYDRAFT_471250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66111.1| hypothetical protein ARALYDRAFT_471250 [Arabidopsis lyrata subsp. 
lyrata]
Length=1024

 Score =   118 bits (296),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  889   SDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  948

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA++R+E C+ C A L  IQ+I+P L +RGG
Sbjct  949   LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLEICQICSAGLHKIQRILPVLARRGG  1008

Query  407   LVAKSA  390
             L+ + A
Sbjct  1009  LITRKA  1014



>ref|XP_006468674.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Citrus sinensis]
Length=811

 Score =   117 bits (293),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  675  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  734

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL++RGG
Sbjct  735  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGG  794

Query  407  LVAKSA  390
             VAKSA
Sbjct  795  SVAKSA  800



>ref|XP_006468672.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Citrus sinensis]
Length=819

 Score =   117 bits (293),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  683  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL++RGG
Sbjct  743  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGG  802

Query  407  LVAKSA  390
             VAKSA
Sbjct  803  SVAKSA  808



>gb|KDO77056.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=811

 Score =   117 bits (293),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  675  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  734

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL++RGG
Sbjct  735  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGG  794

Query  407  LVAKSA  390
             VAKSA
Sbjct  795  SVAKSA  800



>ref|XP_006306661.1| hypothetical protein CARUB_v10008176mg [Capsella rubella]
 gb|EOA39559.1| hypothetical protein CARUB_v10008176mg [Capsella rubella]
Length=1024

 Score =   117 bits (294),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +D+KGAI A K L D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  889   SDVKGAIGALKNLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  948

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             L+MLLKLVA+FG V+RS  SA   VGVDLHA++R+E C+ C A L  IQ+I+P L +RGG
Sbjct  949   LDMLLKLVAVFGTVIRSTVSAPRVVGVDLHADERLEVCQICSAGLHKIQRILPVLARRGG  1008

Query  407   LVAKSA  390
             L+ + A
Sbjct  1009  LITRKA  1014



>gb|KDO77058.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
 gb|KDO77059.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=819

 Score =   117 bits (293),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  683  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL++RGG
Sbjct  743  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGG  802

Query  407  LVAKSA  390
             VAKSA
Sbjct  803  SVAKSA  808



>gb|KFK43409.1| hypothetical protein AALP_AA1G122100 [Arabis alpina]
Length=977

 Score =   116 bits (291),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L ++ E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  842  SDVKGAIGALRKLTDQSVQADVISILTDKTEILTLDMFSQLVPVLTSLLGSRTERPVNVS  901

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLVA+FG V+RS  SA   VG+DLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  902  LEMLLKLVAVFGTVIRSTVSAPRVVGIDLHADERLQICQVCSAGLHKIQRILPVLARRGG  961

Query  407  LVAKSA  390
            L+ + A
Sbjct  962  LITRKA  967



>gb|KDO77060.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=625

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  489  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  548

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL++RGG
Sbjct  549  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGG  608

Query  407  LVAKSA  390
             VAKSA
Sbjct  609  SVAKSA  614



>ref|XP_009118200.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Brassica rapa]
Length=910

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  775  SDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  834

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  +A   VGVDLHA++RI+ C+ C A L  IQ+I+P L +RGG
Sbjct  835  LDMLLKLVAVFGTVIRSTVTAPRIVGVDLHADERIQICQVCSAGLHKIQRILPILARRGG  894

Query  407  LVAKSA  390
            L+ + A
Sbjct  895  LITRKA  900



>ref|XP_009118199.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Brassica rapa]
Length=912

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  777  SDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  836

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  +A   VGVDLHA++RI+ C+ C A L  IQ+I+P L +RGG
Sbjct  837  LDMLLKLVAVFGTVIRSTVTAPRIVGVDLHADERIQICQVCSAGLHKIQRILPILARRGG  896

Query  407  LVAKSA  390
            L+ + A
Sbjct  897  LITRKA  902



>emb|CDY34846.1| BnaA09g47720D [Brassica napus]
Length=912

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  777  SDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  836

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  +A   VGVDLHA++RI+ C+ C A L  IQ+I+P L +RGG
Sbjct  837  LDMLLKLVAVFGTVIRSTVTAPRIVGVDLHADERIQICQVCSAGLHKIQRILPILARRGG  896

Query  407  LVAKSA  390
            L+ + A
Sbjct  897  LITRKA  902



>gb|KFK43408.1| hypothetical protein AALP_AA1G122100 [Arabis alpina]
Length=1026

 Score =   116 bits (291),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767   NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
             +D+KGAI A +KL D SVQADV+S+L ++ E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  891   SDVKGAIGALRKLTDQSVQADVISILTDKTEILTLDMFSQLVPVLTSLLGSRTERPVNVS  950

Query  587   LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
             LEMLLKLVA+FG V+RS  SA   VG+DLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  951   LEMLLKLVAVFGTVIRSTVSAPRVVGIDLHADERLQICQVCSAGLHKIQRILPVLARRGG  1010

Query  407   LVAKSA  390
             L+ + A
Sbjct  1011  LITRKA  1016



>ref|XP_010274906.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Nelumbo nucifera]
Length=799

 Score =   115 bits (289),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A  K+ DH+V ADV+S+L E+M+++TLE+ + LLP+L  LL+S  +RH  +S
Sbjct  663  NDVKGAISAMDKMSDHAVVADVISILAEKMDMVTLEICACLLPLLTGLLESNFDRHLGIS  722

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EMLLKLV  FG V+ S  SA  SVGVD+ AEQR+E C  C   LQ +++ +P+L++RGG
Sbjct  723  MEMLLKLVRTFGSVIHSTLSASSSVGVDIQAEQRLERCNVCFIELQKVKRSLPSLVRRGG  782

Query  407  LVAKSA  390
             VAKSA
Sbjct  783  SVAKSA  788



>ref|XP_010458498.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1009

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  874  NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  933

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+ S  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  934  LDMLLKLVAVFGTVIHSTVSAPRIVGVDLHADERLQICQVCSAGLHKIQRILPVLARRGG  993

Query  407  LVAKSA  390
            L+ + A
Sbjct  994  LITRKA  999



>ref|XP_010458499.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1007

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  872  NDVKGAIGALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  931

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+ S  SA   VGVDLHA++R++ C+ C A L  IQ+I+P L +RGG
Sbjct  932  LDMLLKLVAVFGTVIHSTVSAPRIVGVDLHADERLQICQVCSAGLHKIQRILPVLARRGG  991

Query  407  LVAKSA  390
            L+ + A
Sbjct  992  LITRKA  997



>ref|XP_006448506.1| hypothetical protein CICLE_v10014294mg [Citrus clementina]
 gb|ESR61746.1| hypothetical protein CICLE_v10014294mg [Citrus clementina]
Length=818

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  683  NDVKGAISAMQKMADHTVLADVMSIVTEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL++RGG
Sbjct  743  LDILLKLVRTFGLMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGG  802

Query  407  LVAKSA  390
             VAKSA
Sbjct  803  SVAKSA  808



>ref|XP_009392834.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=770

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I+  +K+ DH+V ADV+S L ++ E+ITL++ +SLLP+L  LL+SKI+RH +VS
Sbjct  634  NDVKGVIDTIEKMSDHAVCADVLSSLKDKSEIITLDICASLLPLLTGLLESKIDRHLSVS  693

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IF PV+RS  SA PSVGVDL AEQR+E C  C   L+ I+  I +LI+RGG
Sbjct  694  LEMLLKLVKIFVPVIRSTLSAGPSVGVDLQAEQRLERCNLCFIELEKIKNSISSLIRRGG  753

Query  407  LVAKSA  390
             + K+A
Sbjct  754  SIGKAA  759



>ref|XP_009392835.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=761

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I+  +K+ DH+V ADV+S L ++ E+ITL++ +SLLP+L  LL+SKI+RH +VS
Sbjct  625  NDVKGVIDTIEKMSDHAVCADVLSSLKDKSEIITLDICASLLPLLTGLLESKIDRHLSVS  684

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IF PV+RS  SA PSVGVDL AEQR+E C  C   L+ I+  I +LI+RGG
Sbjct  685  LEMLLKLVKIFVPVIRSTLSAGPSVGVDLQAEQRLERCNLCFIELEKIKNSISSLIRRGG  744

Query  407  LVAKSA  390
             + K+A
Sbjct  745  SIGKAA  750



>ref|XP_010918467.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Elaeis guineensis]
Length=647

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ D++V AD++S+L+E+   +TL+L++ LLP+L +LL+SKI+R+ ++S
Sbjct  511  NDLKGVIRAMEKMSDYAVSADILSILMEKGHAVTLDLYTCLLPLLASLLESKIDRYTSIS  570

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKL+ IFGPV+ SA SA PSVGVDL AE+R+E C  C   L+ I+ I+P+L +RGG
Sbjct  571  LEMLLKLIKIFGPVIHSALSAVPSVGVDLQAEERLEKCNLCFIELEKIKHILPSLTRRGG  630

Query  407  LVAKS  393
             +A+S
Sbjct  631  SIAES  635



>ref|XP_009392832.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=789

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I+  +K+ DH+V ADV+S L ++ E+ITL++ +SLLP+L  LL+SKI+RH +VS
Sbjct  653  NDVKGVIDTIEKMSDHAVCADVLSSLKDKSEIITLDICASLLPLLTGLLESKIDRHLSVS  712

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IF PV+RS  SA PSVGVDL AEQR+E C  C   L+ I+  I +LI+RGG
Sbjct  713  LEMLLKLVKIFVPVIRSTLSAGPSVGVDLQAEQRLERCNLCFIELEKIKNSISSLIRRGG  772

Query  407  LVAKSA  390
             + K+A
Sbjct  773  SIGKAA  778



>ref|XP_009392833.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=780

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I+  +K+ DH+V ADV+S L ++ E+ITL++ +SLLP+L  LL+SKI+RH +VS
Sbjct  644  NDVKGVIDTIEKMSDHAVCADVLSSLKDKSEIITLDICASLLPLLTGLLESKIDRHLSVS  703

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IF PV+RS  SA PSVGVDL AEQR+E C  C   L+ I+  I +LI+RGG
Sbjct  704  LEMLLKLVKIFVPVIRSTLSAGPSVGVDLQAEQRLERCNLCFIELEKIKNSISSLIRRGG  763

Query  407  LVAKSA  390
             + K+A
Sbjct  764  SIGKAA  769



>emb|CBI35338.3| unnamed protein product [Vitis vinifera]
Length=989

 Score =   114 bits (285),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +K+ DHSV ADV+S+L E+ +V+TLE+ +SLLP+L +LL+S+++RH  +S
Sbjct  853  NDIKGAIGAMEKMADHSVFADVISILREKPDVVTLEICTSLLPLLTSLLESEMDRHLGIS  912

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ I+  +P L +RGG
Sbjct  913  LEMLLKLVRIFGSVIHSTLSASSSVGVDIQAEQRLERCNLCFIELEKIKHCLPALTRRGG  972

Query  407  LVAKSA  390
             VAK A
Sbjct  973  SVAKLA  978



>gb|KHN07303.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=723

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 89/126 (71%), Gaps = 23/126 (18%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND K AI+A +KLPD SVQADV+SVL+E+ME++TL+LFS LLPVL  LLDS IERH  VS
Sbjct  611  NDTKSAISALRKLPDLSVQADVISVLVEKMEILTLDLFSCLLPVLTGLLDSNIERHVKVS  670

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FGP VRS  SA PSVGVDLHAEQR                       RGG
Sbjct  671  LDMLLKLVAVFGPTVRSTISAPPSVGVDLHAEQR-----------------------RGG  707

Query  407  LVAKSA  390
            L+AKSA
Sbjct  708  LLAKSA  713



>ref|XP_008778233.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 WD40 repeat-containing 
subunit B1 homolog [Phoenix dactylifera]
Length=817

 Score =   114 bits (284),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND++G INA +K+ DH+V ADV+S+  E+ + ++L++ S LLPVL +LL+SK++RH  +S
Sbjct  678  NDLRGLINAVEKMSDHAVSADVISIWTEKSDNVSLDICSGLLPVLTSLLESKMDRHLGIS  737

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV  FGPV+ S  SA PSVGVDL AEQR E C  C   L+  +  + TL +RGG
Sbjct  738  LEMLLKLVRTFGPVIYSTLSAAPSVGVDLQAEQRRERCSLCFIELEKAKHSLSTLTRRGG  797

Query  407  LVAKSA  390
             +AK+A
Sbjct  798  FIAKAA  803



>ref|XP_010655954.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
 ref|XP_010655955.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
 ref|XP_010655956.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
 ref|XP_010655957.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Vitis vinifera]
Length=797

 Score =   113 bits (283),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +K+ DHSV ADV+S+L E+ +V+TLE+ +SLLP+L +LL+S+++RH  +S
Sbjct  661  NDIKGAIGAMEKMADHSVFADVISILREKPDVVTLEICTSLLPLLTSLLESEMDRHLGIS  720

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ I+  +P L +RGG
Sbjct  721  LEMLLKLVRIFGSVIHSTLSASSSVGVDIQAEQRLERCNLCFIELEKIKHCLPALTRRGG  780

Query  407  LVAKSA  390
             VAK A
Sbjct  781  SVAKLA  786



>ref|XP_010940397.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=650

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND +G INA +K+ DH+V ADVVS+  E+ + +TL++F+ LLPVL +LL+SK++RH  +S
Sbjct  511  NDFRGVINAVEKMSDHAVSADVVSIWTEKSDNVTLDIFTCLLPVLTSLLESKMDRHLGIS  570

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV  FGPV+ S  SA PSVGVDL AEQR E C  C   L+  +  + TL  RGG
Sbjct  571  LEMLLKLVRTFGPVIYSTLSAGPSVGVDLQAEQRRERCNLCFIELEKAKHSLSTLTGRGG  630

Query  407  LVAKSA  390
             +AK+A
Sbjct  631  SIAKAA  636



>ref|XP_011463422.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X4 [Fragaria vesca subsp. vesca]
Length=796

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ DH+V ADVVS++ ++M+++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  660  NDVKGVIGAMEKMSDHAVIADVVSIMADKMDIVTLDVCTCLLPLLTGLLESNMDRHLGIS  719

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L +RGG
Sbjct  720  LEMLLKLVRIFGSVIYSTLSASSSVGVDIEAEQRLERCNLCFMELEKVKGCLPALTRRGG  779

Query  407  LVAKSA  390
             +AKSA
Sbjct  780  SIAKSA  785



>ref|XP_011463420.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Fragaria vesca subsp. vesca]
Length=817

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ DH+V ADVVS++ ++M+++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  681  NDVKGVIGAMEKMSDHAVIADVVSIMADKMDIVTLDVCTCLLPLLTGLLESNMDRHLGIS  740

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L +RGG
Sbjct  741  LEMLLKLVRIFGSVIYSTLSASSSVGVDIEAEQRLERCNLCFMELEKVKGCLPALTRRGG  800

Query  407  LVAKSA  390
             +AKSA
Sbjct  801  SIAKSA  806



>ref|XP_011463419.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Fragaria vesca subsp. vesca]
Length=818

 Score =   113 bits (282),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ DH+V ADVVS++ ++M+++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  682  NDVKGVIGAMEKMSDHAVIADVVSIMADKMDIVTLDVCTCLLPLLTGLLESNMDRHLGIS  741

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L +RGG
Sbjct  742  LEMLLKLVRIFGSVIYSTLSASSSVGVDIEAEQRLERCNLCFMELEKVKGCLPALTRRGG  801

Query  407  LVAKSA  390
             +AKSA
Sbjct  802  SIAKSA  807



>ref|XP_010940396.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=784

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 69/126 (55%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND +G INA +K+ DH+V ADVVS+  E+ + +TL++F+ LLPVL +LL+SK++RH  +S
Sbjct  645  NDFRGVINAVEKMSDHAVSADVVSIWTEKSDNVTLDIFTCLLPVLTSLLESKMDRHLGIS  704

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV  FGPV+ S  SA PSVGVDL AEQR E C  C   L+  +  + TL  RGG
Sbjct  705  LEMLLKLVRTFGPVIYSTLSAGPSVGVDLQAEQRRERCNLCFIELEKAKHSLSTLTGRGG  764

Query  407  LVAKSA  390
             +AK+A
Sbjct  765  SIAKAA  770



>ref|XP_006468673.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Citrus sinensis]
Length=818

 Score =   112 bits (280),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  683  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL+ RGG
Sbjct  743  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLM-RGG  801

Query  407  LVAKSA  390
             VAKSA
Sbjct  802  SVAKSA  807



>gb|KDO77057.1| hypothetical protein CISIN_1g003448mg [Citrus sinensis]
Length=818

 Score =   112 bits (280),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S+++E++E++TL++ S LLP+L  LL+S ++RH ++S
Sbjct  683  NDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSIS  742

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ SA SA  SVGVD+ AEQRIE C +C   L+ ++  +PTL+ RGG
Sbjct  743  LDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLM-RGG  801

Query  407  LVAKSA  390
             VAKSA
Sbjct  802  SVAKSA  807



>ref|XP_010476017.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Camelina sativa]
Length=1008

 Score =   112 bits (280),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  873  SDVKGAIEALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  932

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+  L +RGG
Sbjct  933  LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQICSAGLHKIQRILLVLARRGG  992

Query  407  LVAKSA  390
            L+ + A
Sbjct  993  LITRKA  998



>ref|XP_010476018.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Camelina sativa]
Length=1006

 Score =   112 bits (280),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  871  SDVKGAIEALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  930

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+  L +RGG
Sbjct  931  LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQICSAGLHKIQRILLVLARRGG  990

Query  407  LVAKSA  390
            L+ + A
Sbjct  991  LITRKA  996



>emb|CDP16884.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   111 bits (278),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 63/126 (50%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGA++A +K+ DH V ADV+S++ E+ +++TL++ + LLP+L  LL+S+++RH N+S
Sbjct  752  HDVKGALSAMEKMGDHGVIADVISLVTEKADIVTLDICTCLLPLLNGLLESEMDRHQNIS  811

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FG V+ S+ SA  SVGVD+ AEQR+E C  C   L+ +++ +P L +RGG
Sbjct  812  LEMLLKLVRVFGSVIYSSISAPSSVGVDIEAEQRLERCNTCFVELEKVKRCLPVLCRRGG  871

Query  407  LVAKSA  390
             +AKSA
Sbjct  872  SIAKSA  877



>ref|XP_007221941.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica]
 gb|EMJ23140.1| hypothetical protein PRUPE_ppa001553mg [Prunus persica]
Length=803

 Score =   111 bits (278),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 63/126 (50%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ DH+V ADVVS++ E+++++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  667  NDVKGVIGAMEKMADHAVIADVVSIMTEKIDIVTLDICTCLLPLLNGLLESNMDRHLGIS  726

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +  L +RGG
Sbjct  727  LEMLLKLVRVFGSVIYSTLSASSSVGVDIEAEQRLERCNNCFMELEKVKTCLSALTRRGG  786

Query  407  LVAKSA  390
             +AKSA
Sbjct  787  SIAKSA  792



>gb|KHN27492.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=219

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I    K+ DH+V ADVVS+++E++++ITLE+ + LLP+L  LL S++ERH  +S
Sbjct  83   NDVKEVIGIMAKMDDHAVIADVVSIIMEKIDIITLEICAGLLPLLTDLLQSEMERHLGIS  142

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA   VGVD+ AE R+E C  C   L+ +++ +P+L +RGG
Sbjct  143  LEMLLKLVRIFGSVIYSTVSATQPVGVDIEAENRLERCNLCFTELEKVKRFLPSLSRRGG  202

Query  407  LVAKSA  390
             +AKSA
Sbjct  203  SIAKSA  208



>ref|XP_010935617.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Elaeis guineensis]
Length=781

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND +G I A +K+ DH+V ADVVS+  E+ + ITL++F+ LLPVL +LL+SK++RH  +S
Sbjct  645  NDFRGVIQAMEKMSDHAVSADVVSIWTEKSDNITLDIFTCLLPVLTSLLESKMDRHLGIS  704

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LLKLV  FGPV+ S  SA PSVGVDL AEQR E C  C   L+  +  + TL +RGG
Sbjct  705  LEILLKLVRTFGPVIHSTLSAAPSVGVDLQAEQRRERCNLCFIELEKAKHSLFTLTRRGG  764

Query  407  LVAKSA  390
              AK+A
Sbjct  765  STAKAA  770



>gb|KJB47123.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=810

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E+++++TL++ + LLP+L +LL S+++RH  + 
Sbjct  674  NDVKGAISAMEKMADHAVLADVLSIVTEKIDIVTLDICTCLLPLLSSLLGSEMDRHLCIC  733

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PT+ +RGG
Sbjct  734  LDMLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPTVTRRGG  793

Query  407  LVAKSA  390
             VAKSA
Sbjct  794  SVAKSA  799



>gb|KJB47121.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=856

 Score =   110 bits (274),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E+++++TL++ + LLP+L +LL S+++RH  + 
Sbjct  720  NDVKGAISAMEKMADHAVLADVLSIVTEKIDIVTLDICTCLLPLLSSLLGSEMDRHLCIC  779

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PT+ +RGG
Sbjct  780  LDMLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPTVTRRGG  839

Query  407  LVAKSA  390
             VAKSA
Sbjct  840  SVAKSA  845



>gb|KJB47120.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=829

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E+++++TL++ + LLP+L +LL S+++RH  + 
Sbjct  693  NDVKGAISAMEKMADHAVLADVLSIVTEKIDIVTLDICTCLLPLLSSLLGSEMDRHLCIC  752

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PT+ +RGG
Sbjct  753  LDMLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPTVTRRGG  812

Query  407  LVAKSA  390
             VAKSA
Sbjct  813  SVAKSA  818



>ref|XP_008221114.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Prunus mume]
Length=803

 Score =   109 bits (272),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KG I A +K+ DH+V ADVVS++ E+++++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  667  DDVKGVIGAMEKMADHAVIADVVSIMTEKIDIVTLDICTCLLPLLNGLLESNMDRHLGIS  726

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +  L +RGG
Sbjct  727  LEMLLKLVRVFGSVIYSTLSASSSVGVDIEAEQRLERCNNCFMELEKVKTCLSALTRRGG  786

Query  407  LVAKSA  390
             +AKSA
Sbjct  787  SIAKSA  792



>ref|NP_001170410.1| uncharacterized protein LOC100384397 [Zea mays]
 gb|ACN36928.1| unknown [Zea mays]
 gb|AFW84897.1| hypothetical protein ZEAMMB73_564557 [Zea mays]
Length=271

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  761  IKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLE  582
            IKGAI A  KLPD++VQADVVS L  ++++  LE FS+ LPVL  LL SK ERHA VSLE
Sbjct  135  IKGAIAAVAKLPDNAVQADVVSALKGKLDLFNLEFFSNFLPVLAGLLCSKTERHAMVSLE  194

Query  581  MLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLV  402
            MLL L+ IFGPV+ SA SA   VGVD+ AEQR++ C +C  HLQ IQQ +  LI RGG  
Sbjct  195  MLLDLIKIFGPVIHSALSANLGVGVDIQAEQRLQRCSRCFNHLQKIQQSLNPLILRGGQT  254

Query  401  AKSA  390
            A+ A
Sbjct  255  AQLA  258



>gb|AFW59900.1| hypothetical protein ZEAMMB73_759012 [Zea mays]
Length=203

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G ++A +++ DH+V AD+ SVL+E+ +VITL+L +S+LP    LL+SKI+RH  V+
Sbjct  66   NDIRGVLSAMERMGDHAVCADMASVLMEKSDVITLDLCTSILPAATDLLESKIDRHLGVA  125

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+L+KLV  FGP++ S  S+ P VGVDL AEQR E C  C   L+  +  +P+L +R G
Sbjct  126  LELLVKLVRTFGPMIHSTVSSGPCVGVDLEAEQRRERCNLCFIELENAKNKLPSLTRRKG  185

Query  407  LVAKSA  390
             VA +A
Sbjct  186  AVANAA  191



>ref|XP_010655958.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Vitis vinifera]
 ref|XP_010655959.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Vitis vinifera]
Length=796

 Score =   108 bits (270),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +K+ DHSV ADV+S+L E+ +V+TLE+ +SLLP+L +LL+S+++RH  +S
Sbjct  661  NDIKGAIGAMEKMADHSVFADVISILREKPDVVTLEICTSLLPLLTSLLESEMDRHLGIS  720

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ I+  +P L  RGG
Sbjct  721  LEMLLKLVRIFGSVIHSTLSASSSVGVDIQAEQRLERCNLCFIELEKIKHCLPAL-TRGG  779

Query  407  LVAKSA  390
             VAK A
Sbjct  780  SVAKLA  785



>ref|XP_007043149.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOX98980.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=1199

 Score =   109 bits (272),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 62/125 (50%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI+A +K+ D++V ADV+S++ E+M+++TL++ + LLP+L  LL S ++RH ++SL
Sbjct  720  DIKGAISAMEKMADYAVVADVMSIITEKMDIVTLDICTCLLPLLSGLLGSDMDRHLSISL  779

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            +MLLKL+ +FG ++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PTL +RGG 
Sbjct  780  DMLLKLIRVFGSMIYSTLSASTPVGVDIEAEQRFERCNLCFIELEKVKRCLPTLTRRGGS  839

Query  404  VAKSA  390
            VAKSA
Sbjct  840  VAKSA  844



>ref|XP_004970183.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Setaria italica]
Length=833

 Score =   108 bits (270),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 74/124 (60%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  761  IKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLE  582
            IKGAI A  KLPD++VQADVVS L  ++++  LE+FSS LP+L  LL SK ERHA VSLE
Sbjct  697  IKGAIAAVGKLPDNAVQADVVSALKGKLDLFNLEIFSSFLPILAGLLCSKTERHATVSLE  756

Query  581  MLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLV  402
            MLL L+ IFGPV+ S  SA   VGVDL AEQR++ C +C  HLQ IQQ++  LI RGG  
Sbjct  757  MLLDLIKIFGPVIHSTLSANSGVGVDLQAEQRLQRCTRCFNHLQKIQQVLHPLIMRGGQS  816

Query  401  AKSA  390
            A+ A
Sbjct  817  AQLA  820



>ref|XP_011070501.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Sesamum indicum]
Length=791

 Score =   108 bits (269),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 64/126 (51%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A  K+ DHSV ADV+S+L ER++++TL++ S LLP+L  L++S ++RH +++
Sbjct  655  HDIKGAVSAISKMGDHSVAADVMSLLAERIDMVTLDICSCLLPLLSGLIESDMDRHQDIA  714

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LLKLV +FG V+ S+ SA  SVGVD+ AEQR+E C  C   L+ ++  +P L +RGG
Sbjct  715  LEVLLKLVRLFGSVIYSSLSAPSSVGVDIEAEQRLERCNLCYVELEKVKGCLPVLSRRGG  774

Query  407  LVAKSA  390
             +AKSA
Sbjct  775  SIAKSA  780



>ref|XP_010688600.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=798

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DHSV ADVVS+L E+ +++TLE+ + LLP+L +LL+S ++RH  +S
Sbjct  661  NDVKGAIAAMEKMADHSVIADVVSILTEKTDIVTLEICACLLPLLASLLESDMDRHLCIS  720

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+ML+KLV +FG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L++RGG
Sbjct  721  LDMLVKLVRVFGSVIYSTVSASSSVGVDIEAEQRLERCNLCYIELERVKLCLPALMRRGG  780

Query  407  LVAKSA  390
             VAKSA
Sbjct  781  SVAKSA  786



>ref|XP_011463423.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X5 [Fragaria vesca subsp. vesca]
Length=795

 Score =   108 bits (269),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ DH+V ADVVS++ ++M+++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  660  NDVKGVIGAMEKMSDHAVIADVVSIMADKMDIVTLDVCTCLLPLLTGLLESNMDRHLGIS  719

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L  RGG
Sbjct  720  LEMLLKLVRIFGSVIYSTLSASSSVGVDIEAEQRLERCNLCFMELEKVKGCLPAL-TRGG  778

Query  407  LVAKSA  390
             +AKSA
Sbjct  779  SIAKSA  784



>ref|XP_006646391.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Oryza brachyantha]
Length=832

 Score =   108 bits (269),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAI A  KLPD++VQADVVS L  ++++  LE+FSS LPVL  LL SK ERHA VS
Sbjct  694  NGIKGAIAAVAKLPDNAVQADVVSTLKGKLDLFNLEIFSSFLPVLAGLLSSKTERHAVVS  753

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LL L+ IFGPV+ S  SA  +VGVD+ AEQR++ C +C  HLQ I+QI+  LI RGG
Sbjct  754  LELLLDLIKIFGPVIHSTLSAHSAVGVDIQAEQRLQRCSRCFNHLQKIRQILHPLIMRGG  813

Query  407  LVAKSA  390
              A+ A
Sbjct  814  QSAQLA  819



>ref|XP_011463421.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Fragaria vesca subsp. vesca]
Length=817

 Score =   108 bits (269),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG I A +K+ DH+V ADVVS++ ++M+++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  682  NDVKGVIGAMEKMSDHAVIADVVSIMADKMDIVTLDVCTCLLPLLTGLLESNMDRHLGIS  741

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L  RGG
Sbjct  742  LEMLLKLVRIFGSVIYSTLSASSSVGVDIEAEQRLERCNLCFMELEKVKGCLPAL-TRGG  800

Query  407  LVAKSA  390
             +AKSA
Sbjct  801  SIAKSA  806



>ref|XP_010521766.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Tarenaya hassleriana]
 ref|XP_010521774.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Tarenaya hassleriana]
Length=841

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+K +I A +K+ D++V ADV+SV+ E+ +++TL+  +S+LP+L ALL S++ERH +VS
Sbjct  705  SDVKNSIEAIEKMADNAVVADVLSVVTEKNDILTLDTCTSILPLLTALLGSEMERHLSVS  764

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV ++G ++ S+ SA  SVGVD+ AEQR+E C +C   L+ ++  +P+L++RGG
Sbjct  765  LDLLLKLVRMYGSLIYSSLSAPSSVGVDIEAEQRMERCSRCFVELEKVKACLPSLVRRGG  824

Query  407  LVAKSA  390
            LVAKSA
Sbjct  825  LVAKSA  830



>gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Erythranthe guttata]
Length=164

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA+ A  K+ DHSV ADV+ +L E+ +++TL++ S LLP+L  L++S ++RH +++
Sbjct  28   HDIKGALGAINKMGDHSVLADVMCLLAEKTDMVTLDICSCLLPLLSGLIESDMDRHQDIA  87

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FG V+ S+ SA  SVGVD+ AEQR+E C  C   L+ +++ +P L ++GG
Sbjct  88   LDMLLKLVRVFGSVIYSSLSAPSSVGVDIEAEQRLERCNLCYTELEKVKRSLPHLSRKGG  147

Query  407  LVAKSA  390
             +AKSA
Sbjct  148  SIAKSA  153



>ref|XP_008802561.1| PREDICTED: LOW QUALITY PROTEIN: katanin p80 WD40 repeat-containing 
subunit B1 homolog [Phoenix dactylifera]
Length=781

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G I+A +K+ DH+V ADVVS+  ER + ITL++F+ LLPVL +LL+SK++RH  +S
Sbjct  645  NDIRGVIHAMEKMSDHAVSADVVSIWTERSDNITLDIFTCLLPVLTSLLESKMDRHLGIS  704

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LLKLV  FG V+ S  SA PSVGVDL AEQR E C  C   L+  +  + TL +RGG
Sbjct  705  LEILLKLVRTFGLVIHSTLSAAPSVGVDLQAEQRRERCNLCFIELEKAKHSLSTLTRRGG  764

Query  407  LVAK  396
              AK
Sbjct  765  STAK  768



>ref|XP_010476019.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Camelina sativa]
Length=744

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KGAI A +KL D SVQADV+S+L +++E++TL++FS L+PVL +LL S+ ER  NVS
Sbjct  609  SDVKGAIEALRKLTDQSVQADVISILTDKIEILTLDMFSQLVPVLTSLLGSRTERPVNVS  668

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLVA+FG V+RS  SA   VGVDLHA++R++ C+ C A L  IQ+I+  L +RGG
Sbjct  669  LDMLLKLVAVFGTVIRSTVSAPRIVGVDLHADERLQICQICSAGLHKIQRILLVLARRGG  728

Query  407  LVAKSA  390
            L+ + A
Sbjct  729  LITRKA  734



>ref|XP_004489185.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Cicer arietinum]
Length=747

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+ G +    K+ DH+V ADVVS+++E+M+++TL+L + LLP+L  LL S+ +RH ++S
Sbjct  611  NDVTGVLGTMAKMGDHTVIADVVSIIMEKMDIVTLDLCTGLLPLLSDLLQSETDRHLSIS  670

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EMLL LV IFG V+ S  SA+PSVGVD+ AE R+E C  C   L+ +++ +P+L++RGG
Sbjct  671  VEMLLNLVRIFGSVIYSTLSAKPSVGVDIEAENRLERCNLCFVELEKVKRFLPSLMRRGG  730

Query  407  LVAKSA  390
             +AK A
Sbjct  731  SIAKFA  736



>ref|NP_001044436.1| Os01g0780400 [Oryza sativa Japonica Group]
 dbj|BAD52853.1| katanin p80 (WD40-containing) subunit B 1-like protein [Oryza 
sativa Japonica Group]
 dbj|BAF06350.1| Os01g0780400 [Oryza sativa Japonica Group]
Length=838

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAI A  KLPD++V ADVVS L  ++++  L++F S LPVL  LL SK ERHA VS
Sbjct  700  NGIKGAIAAVAKLPDNAVLADVVSTLKGKLDLFNLDIFLSFLPVLAGLLTSKAERHAIVS  759

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LL L+ IFGPV+RS  SA  +VGVD+ AEQR++ C +C  HLQ IQQ++  LI RGG
Sbjct  760  LELLLDLIKIFGPVIRSTLSAHSAVGVDIQAEQRLQRCSRCFNHLQKIQQVLHPLIMRGG  819

Query  407  LVAKSA  390
              A+ A
Sbjct  820  QSAQLA  825



>gb|KJB12376.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=816

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  680  NDIKGAISAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  739

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL +RGG
Sbjct  740  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTLTRRGG  799

Query  407  LVAKSA  390
             VAKSA
Sbjct  800  SVAKSA  805



>ref|XP_008655324.1| PREDICTED: uncharacterized protein LOC100384397 isoform X4 [Zea 
mays]
Length=835

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  761  IKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLE  582
            IKGAI A  KLPD++VQADVVS L  ++++  LE FS+ LPVL  LL SK ERHA VSLE
Sbjct  699  IKGAIAAVAKLPDNAVQADVVSALKGKLDLFNLEFFSNFLPVLAGLLCSKTERHAMVSLE  758

Query  581  MLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLV  402
            MLL L+ IFGPV+ SA SA   VGVD+ AEQR++ C +C  HLQ IQQ +  LI RGG  
Sbjct  759  MLLDLIKIFGPVIHSALSANLGVGVDIQAEQRLQRCSRCFNHLQKIQQSLNPLILRGGQT  818

Query  401  AKSA  390
            A+ A
Sbjct  819  AQLA  822



>gb|KJB12374.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=853

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  717  NDIKGAISAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  776

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL +RGG
Sbjct  777  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTLTRRGG  836

Query  407  LVAKSA  390
             VAKSA
Sbjct  837  SVAKSA  842



>ref|XP_002513719.1| katanin P80 subunit, putative [Ricinus communis]
 gb|EEF48666.1| katanin P80 subunit, putative [Ricinus communis]
Length=803

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH V ADV+SV+ E+++++TL++ + LLP+L  LL+S ++RH ++S
Sbjct  667  NDVKGAISAMEKMADHGVLADVISVINEKIDIVTLDVCTCLLPLLAGLLESDMDRHLSIS  726

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ +PTL++RGG
Sbjct  727  LDVLLKLVRTFGSMIYSTVSASTPVGVDIEAEQRLERCNLCFVELEKVKRCLPTLMRRGG  786

Query  407  LVAK  396
             VAK
Sbjct  787  SVAK  790



>gb|KJB12373.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=849

 Score =   107 bits (266),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  713  NDIKGAISAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  772

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL +RGG
Sbjct  773  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTLTRRGG  832

Query  407  LVAKSA  390
             VAKSA
Sbjct  833  SVAKSA  838



>ref|XP_009793706.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Nicotiana sylvestris]
Length=798

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D++V AD+VS L E++++ITLE+ + LLP+L  LL SK++RH ++S
Sbjct  662  HDIKGAVSALEKMADNAVLADLVSFLTEKIDIITLEICTCLLPLLTGLLQSKLDRHQDIS  721

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKLV +FGP++ ++ S   SVGVD+ AE+R+E C  C   L+ ++  +P L +RGG
Sbjct  722  LNMLLKLVRVFGPLIYTSLSTPTSVGVDIEAEKRMERCNLCFIELEKVKNHLPALSRRGG  781

Query  407  LVAKSA  390
             +AKSA
Sbjct  782  SIAKSA  787



>ref|XP_008655322.1| PREDICTED: uncharacterized protein LOC100384397 isoform X2 [Zea 
mays]
Length=858

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  761  IKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLE  582
            IKGAI A  KLPD++VQADVVS L  ++++  LE FS+ LPVL  LL SK ERHA VSLE
Sbjct  722  IKGAIAAVAKLPDNAVQADVVSALKGKLDLFNLEFFSNFLPVLAGLLCSKTERHAMVSLE  781

Query  581  MLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLV  402
            MLL L+ IFGPV+ SA SA   VGVD+ AEQR++ C +C  HLQ IQQ +  LI RGG  
Sbjct  782  MLLDLIKIFGPVIHSALSANLGVGVDIQAEQRLQRCSRCFNHLQKIQQSLNPLILRGGQT  841

Query  401  AKSA  390
            A+ A
Sbjct  842  AQLA  845



>ref|XP_009793704.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Nicotiana sylvestris]
Length=811

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D++V AD+VS L E++++ITLE+ + LLP+L  LL SK++RH ++S
Sbjct  675  HDIKGAVSALEKMADNAVLADLVSFLTEKIDIITLEICTCLLPLLTGLLQSKLDRHQDIS  734

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKLV +FGP++ ++ S   SVGVD+ AE+R+E C  C   L+ ++  +P L +RGG
Sbjct  735  LNMLLKLVRVFGPLIYTSLSTPTSVGVDIEAEKRMERCNLCFIELEKVKNHLPALSRRGG  794

Query  407  LVAKSA  390
             +AKSA
Sbjct  795  SIAKSA  800



>ref|XP_008655323.1| PREDICTED: uncharacterized protein LOC100384397 isoform X3 [Zea 
mays]
Length=838

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  761  IKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLE  582
            IKGAI A  KLPD++VQADVVS L  ++++  LE FS+ LPVL  LL SK ERHA VSLE
Sbjct  702  IKGAIAAVAKLPDNAVQADVVSALKGKLDLFNLEFFSNFLPVLAGLLCSKTERHAMVSLE  761

Query  581  MLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLV  402
            MLL L+ IFGPV+ SA SA   VGVD+ AEQR++ C +C  HLQ IQQ +  LI RGG  
Sbjct  762  MLLDLIKIFGPVIHSALSANLGVGVDIQAEQRLQRCSRCFNHLQKIQQSLNPLILRGGQT  821

Query  401  AKSA  390
            A+ A
Sbjct  822  AQLA  825



>gb|KHG00735.1| hypothetical protein F383_07474 [Gossypium arboreum]
Length=846

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  710  NDIKGAIGAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  769

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL +RGG
Sbjct  770  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTLTRRGG  829

Query  407  LVAKSA  390
             VAKSA
Sbjct  830  SVAKSA  835



>gb|KHG19796.1| hypothetical protein F383_00950 [Gossypium arboreum]
Length=856

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH+V ADV+S++ E+++ +TL++ + LLP+L +LL S+++RH  + 
Sbjct  720  NDIKGAISAMEKMADHAVLADVLSIVTEKIDTVTLDICTCLLPLLSSLLGSEMDRHLCIC  779

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +P++ +RGG
Sbjct  780  LDVLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPSVTRRGG  839

Query  407  LVAKSA  390
             VAKSA
Sbjct  840  SVAKSA  845



>gb|KJB47119.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=855

 Score =   105 bits (263),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E+++++TL++ + LLP+L +LL S+++RH  + 
Sbjct  720  NDVKGAISAMEKMADHAVLADVLSIVTEKIDIVTLDICTCLLPLLSSLLGSEMDRHLCIC  779

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PT + RGG
Sbjct  780  LDMLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPT-VTRGG  838

Query  407  LVAKSA  390
             VAKSA
Sbjct  839  SVAKSA  844



>gb|KJB47118.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=809

 Score =   105 bits (262),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E+++++TL++ + LLP+L +LL S+++RH  + 
Sbjct  674  NDVKGAISAMEKMADHAVLADVLSIVTEKIDIVTLDICTCLLPLLSSLLGSEMDRHLCIC  733

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PT + RGG
Sbjct  734  LDMLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPT-VTRGG  792

Query  407  LVAKSA  390
             VAKSA
Sbjct  793  SVAKSA  798



>gb|KJB47122.1| hypothetical protein B456_008G011900 [Gossypium raimondii]
Length=828

 Score =   105 bits (262),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI+A +K+ DH+V ADV+S++ E+++++TL++ + LLP+L +LL S+++RH  + 
Sbjct  693  NDVKGAISAMEKMADHAVLADVLSIVTEKIDIVTLDICTCLLPLLSSLLGSEMDRHLCIC  752

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FGP++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PT + RGG
Sbjct  753  LDMLLKLVRVFGPMIYSTLSASTPVGVDIEAEQRFERCNLCFVELEKVKRCLPT-VTRGG  811

Query  407  LVAKSA  390
             VAKSA
Sbjct  812  SVAKSA  817



>ref|XP_008663730.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Zea mays]
 gb|AFW59904.1| hypothetical protein ZEAMMB73_759012 [Zea mays]
Length=910

 Score =   105 bits (263),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G ++A +++ DH+V AD+ SVL+E+ +VITL+L +S+LP    LL+SKI+RH  V+
Sbjct  773  NDIRGVLSAMERMGDHAVCADMASVLMEKSDVITLDLCTSILPAATDLLESKIDRHLGVA  832

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+L+KLV  FGP++ S  S+ P VGVDL AEQR E C  C   L+  +  +P+L +R G
Sbjct  833  LELLVKLVRTFGPMIHSTVSSGPCVGVDLEAEQRRERCNLCFIELENAKNKLPSLTRRKG  892

Query  407  LVAKSA  390
             VA +A
Sbjct  893  AVANAA  898



>gb|KJB31921.1| hypothetical protein B456_005G214400 [Gossypium raimondii]
Length=895

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A +K+ DH+V ADV+S++IE+M+++TL++ + LLP+L  LL S ++RH ++ L
Sbjct  760  DIKGAIGAIEKMADHAVLADVMSIVIEKMDIVTLDICTCLLPLLSGLLGSDMDRHLSICL  819

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            +MLLKLV +FG ++ S  SA   VGVD+ AEQR E C  C   L+ +++ +PTL +RGG 
Sbjct  820  DMLLKLVRVFGSMIYSTISASTPVGVDIEAEQRFERCNLCFIELEKVKRCLPTLTRRGGS  879

Query  404  VAKSA  390
            VAKS+
Sbjct  880  VAKSS  884



>gb|KEH24722.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula]
Length=760

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+   I+   K+ DH+V ADVVS+++E+++++TL+L + LLP+L  LL S+++RH ++S
Sbjct  624  NDVTEVISTMAKMGDHAVIADVVSIIMEKIDMVTLDLCTGLLPLLTDLLQSEMDRHLSIS  683

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EMLL LV +FG V+ S  SA+PSVGVD+ AE+R+E C  C   L+ ++  +P+L++RGG
Sbjct  684  VEMLLNLVRVFGSVIYSTLSAKPSVGVDIEAEKRLERCNVCFVELEKVKGFLPSLMRRGG  743

Query  407  LVAKSA  390
             VAKSA
Sbjct  744  SVAKSA  749



>ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
 ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Cucumis sativus]
Length=795

 Score =   105 bits (261),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ DH+V ADV+S++  R+EV+TL++ + +LPVL  LL+S ++R+ ++S
Sbjct  659  HDIKGAVSAMEKMADHAVAADVISIMTNRIEVVTLDICTCILPVLSGLLESDLDRYLDIS  718

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EML+KLV  FG V+ S  SA  SVGV++ AEQR+E C  C   L+ +++ +P LI++ G
Sbjct  719  MEMLVKLVRTFGSVIYSTLSATSSVGVNIEAEQRLERCNLCFIELEKVKRCLPALIRKRG  778

Query  407  LVAKSA  390
             VAKSA
Sbjct  779  SVAKSA  784



>ref|XP_008445915.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Cucumis melo]
Length=844

 Score =   105 bits (261),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ DH+V ADV+S++  R+EV+TL++ + +LPVL  LL+S ++R+ ++S
Sbjct  708  HDIKGAVSAMEKMADHAVAADVISIMTNRIEVVTLDICTCILPVLSGLLESDLDRYLDIS  767

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EML+KLV  FG V+ S  SA  SVGV++ AEQR+E C  C   L+ +++ +P LI++ G
Sbjct  768  MEMLVKLVRTFGSVIYSTLSATSSVGVNIEAEQRLERCNLCFIELEKVKRCLPALIRKRG  827

Query  407  LVAKSA  390
             VAKSA
Sbjct  828  SVAKSA  833



>ref|XP_008445914.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Cucumis melo]
Length=869

 Score =   105 bits (261),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ DH+V ADV+S++  R+EV+TL++ + +LPVL  LL+S ++R+ ++S
Sbjct  733  HDIKGAVSAMEKMADHAVAADVISIMTNRIEVVTLDICTCILPVLSGLLESDLDRYLDIS  792

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EML+KLV  FG V+ S  SA  SVGV++ AEQR+E C  C   L+ +++ +P LI++ G
Sbjct  793  MEMLVKLVRTFGSVIYSTLSATSSVGVNIEAEQRLERCNLCFIELEKVKRCLPALIRKRG  852

Query  407  LVAKSA  390
             VAKSA
Sbjct  853  SVAKSA  858



>gb|KGN51580.1| hypothetical protein Csa_5G580650 [Cucumis sativus]
Length=844

 Score =   105 bits (261),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ DH+V ADV+S++  R+EV+TL++ + +LPVL  LL+S ++R+ ++S
Sbjct  708  HDIKGAVSAMEKMADHAVAADVISIMTNRIEVVTLDICTCILPVLSGLLESDLDRYLDIS  767

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EML+KLV  FG V+ S  SA  SVGV++ AEQR+E C  C   L+ +++ +P LI++ G
Sbjct  768  MEMLVKLVRTFGSVIYSTLSATSSVGVNIEAEQRLERCNLCFIELEKVKRCLPALIRKRG  827

Query  407  LVAKSA  390
             VAKSA
Sbjct  828  SVAKSA  833



>ref|XP_008655321.1| PREDICTED: uncharacterized protein LOC100384397 isoform X1 [Zea 
mays]
Length=859

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  761  IKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLE  582
            IKGAI A  KLPD++VQADVVS L  ++++  LE FS+ LPVL  LL SK ERHA VSLE
Sbjct  723  IKGAIAAVAKLPDNAVQADVVSALKGKLDLFNLEFFSNFLPVLAGLLCSKTERHAMVSLE  782

Query  581  MLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLV  402
            MLL L+ IFGPV+ SA SA   VGVD+ AEQR++ C +C  HLQ IQQ +  LI RGG  
Sbjct  783  MLLDLIKIFGPVIHSALSANLGVGVDIQAEQRLQRCSRCFNHLQKIQQSLNPLILRGGQT  842

Query  401  AKSA  390
            A+ A
Sbjct  843  AQLA  846



>gb|KJB12372.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=847

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  711  NDIKGAISAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  770

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL +RGG
Sbjct  771  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTLTRRGG  830

Query  407  LVAKSA  390
             VAKSA
Sbjct  831  SVAKSA  836



>ref|XP_009395414.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Musa acuminata subsp. malaccensis]
Length=778

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG + A +K+ D++V ADV+  L ++ +++TL++  SLLP+L  LL+S ++RH  VS
Sbjct  642  NDVKGVVGAIEKMSDYAVSADVLGCLKDKGDIVTLDICMSLLPLLTGLLESNMDRHVGVS  701

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLL LV IFGPV+ S  SA PSVGVDL AEQR+E C  C   L+ ++  I ++ +RGG
Sbjct  702  LGMLLTLVRIFGPVIHSTLSAGPSVGVDLQAEQRLERCNSCFIELEKVKHRISSMSRRGG  761

Query  407  LVAKSA  390
             +AK+A
Sbjct  762  SIAKAA  767



>ref|XP_008221115.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Prunus mume]
Length=802

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D+KG I A +K+ DH+V ADVVS++ E+++++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  667  DDVKGVIGAMEKMADHAVIADVVSIMTEKIDIVTLDICTCLLPLLNGLLESNMDRHLGIS  726

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +  L  RGG
Sbjct  727  LEMLLKLVRVFGSVIYSTLSASSSVGVDIEAEQRLERCNNCFMELEKVKTCLSAL-TRGG  785

Query  407  LVAKSA  390
             +AKSA
Sbjct  786  SIAKSA  791



>ref|XP_006653028.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Oryza brachyantha]
Length=937

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 89/127 (70%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G I A +K+ DH+V ADV SVL+E+ E ITL+L + +LPVL  LL+SK +RH  VS
Sbjct  800  NDIRGVIAAMEKMSDHAVSADVASVLMEKSETITLDLCTVILPVLTELLESKTDRHLGVS  859

Query  587  LEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            LE+L+KLV  FG V+ S  SA P SVGVDL AEQR E C  C   L+ ++  +P+L +R 
Sbjct  860  LELLVKLVRTFGSVIHSTVSAGPSSVGVDLQAEQRRERCNLCFIELEKVKNKLPSLSRRK  919

Query  410  GLVAKSA  390
            G VA +A
Sbjct  920  GAVANTA  926



>ref|XP_003525689.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
Length=759

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I    K+ DH+V ADVVS+++E++++ITLE+ + LLP+L  LL S++ERH  +S
Sbjct  623  NDVKEVIGIMAKMDDHAVIADVVSIIMEKIDIITLEICAGLLPLLTDLLQSEMERHLGIS  682

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA   VGVD+ AE R+E C  C   L+ +++ +P+L +RGG
Sbjct  683  LEMLLKLVRIFGSVIYSTVSATQPVGVDIEAENRLERCNLCFTELEKVKRFLPSLSRRGG  742

Query  407  LVAKSA  390
             +AKSA
Sbjct  743  SIAKSA  748



>gb|KDP33053.1| hypothetical protein JCGZ_13639 [Jatropha curcas]
Length=806

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH V ADVVSV+ E+++++TL++ + LLP+L  LL+S ++RH +++
Sbjct  670  NDVKGAIGAMEKMADHGVLADVVSVVTEKIDIVTLDVCTGLLPLLAGLLESDMDRHLSIT  729

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ SA SA   VGVD+ AEQR++    C   L+ +++ +P L++RGG
Sbjct  730  LDMLLKLVRTFGSMIYSAVSASTPVGVDIEAEQRLQRYNLCFVELEKVKRCLPKLMRRGG  789

Query  407  LVAKS  393
             VAKS
Sbjct  790  SVAKS  794



>ref|XP_010688601.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=797

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DHSV ADVVS+L E+ +++TLE+ + LLP+L +LL+S ++RH  +S
Sbjct  661  NDVKGAIAAMEKMADHSVIADVVSILTEKTDIVTLEICACLLPLLASLLESDMDRHLCIS  720

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+ML+KLV +FG V+ S  SA  SVGVD+ AEQR+E C  C   L+ ++  +P L+ RGG
Sbjct  721  LDMLVKLVRVFGSVIYSTVSASSSVGVDIEAEQRLERCNLCYIELERVKLCLPALM-RGG  779

Query  407  LVAKSA  390
             VAKSA
Sbjct  780  SVAKSA  785



>ref|XP_011033108.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
 ref|XP_011033109.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=806

 Score =   103 bits (256),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 59/126 (47%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V +DV+S++ ++++++TL++ + LLP+L  LL+S ++RH ++S
Sbjct  670  NDVKGAIGAMEKMADHAVLSDVISIVADKIDIVTLDICTCLLPLLTKLLESDMDRHLSIS  729

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FG ++ S  SA  SVGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  730  LDMLLKLVRMFGSMIYSTLSASTSVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  789

Query  407  LVAKSA  390
             VAK A
Sbjct  790  SVAKHA  795



>ref|XP_008668688.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Zea mays]
Length=920

 Score =   103 bits (256),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 63/126 (50%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G ++A  ++ DH+V AD+ SVL+E+ E ITL+L +S+LPV+  LL+SKI+RH  V+
Sbjct  783  NDIRGVLSAMDRMGDHAVCADMASVLMEKSETITLDLCTSILPVVTDLLESKIDRHLVVA  842

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+L+KLV  FGP++ S  S+ P VGVDL AEQR E C  C   L+  +  +P+L +R G
Sbjct  843  LELLVKLVRTFGPMIHSTVSSGPCVGVDLEAEQRRERCNLCFIELEKAKNKLPSLTRRKG  902

Query  407  LVAKSA  390
             VA +A
Sbjct  903  AVANAA  908



>ref|XP_004960069.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Setaria italica]
Length=931

 Score =   103 bits (256),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G ++A +K+ DH+V AD+ SVL+E+ E ITL+L +S+LPV+  LL+SK +RH  VS
Sbjct  793  NDIRGVLSAMEKMCDHAVSADMASVLMEKSETITLDLCTSILPVVTDLLESKTDRHLGVS  852

Query  587  LEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            LE+L+KLV  FGP++ S  SA P SVGVDL AEQR E C  C   L+ ++  +P L +R 
Sbjct  853  LELLVKLVRTFGPMIHSTVSAGPSSVGVDLEAEQRRERCNLCFIELEKVKNKLPFLTRRK  912

Query  410  GLVAKSA  390
            G VA +A
Sbjct  913  GAVANAA  919



>ref|XP_006603797.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Glycine max]
Length=759

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I    ++ DH+V ADVVS+++E++++ITLE+ + LLP+L  LL S++ERH  +S
Sbjct  623  NDVKEVIGIMARMDDHAVIADVVSIIMEKIDIITLEICAGLLPLLTDLLQSEMERHLGIS  682

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA   VGVD+ AE R+E C  C   L+ +++ +P+L +RGG
Sbjct  683  LEMLLKLVRIFGSVIYSTVSATQPVGVDIEAENRLERCNLCFTELEKVKRFLPSLSRRGG  742

Query  407  LVAKSA  390
             +AKSA
Sbjct  743  SIAKSA  748



>gb|KHN19710.1| Katanin p80 WD40 repeat-containing subunit B1 like 1 [Glycine 
soja]
Length=770

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I    ++ DH+V ADVVS+++E++++ITLE+ + LLP+L  LL S++ERH  +S
Sbjct  634  NDVKEVIGIMARMDDHAVIADVVSIIMEKIDIITLEICAGLLPLLTDLLQSEMERHLGIS  693

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA   VGVD+ AE R+E C  C   L+ +++ +P+L +RGG
Sbjct  694  LEMLLKLVRIFGSVIYSTVSATQPVGVDIEAENRLERCNLCFTELEKVKRFLPSLSRRGG  753

Query  407  LVAKSA  390
             +AKSA
Sbjct  754  SIAKSA  759



>ref|XP_002311885.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa]
 gb|EEE89252.1| hypothetical protein POPTR_0008s00290g [Populus trichocarpa]
Length=802

 Score =   102 bits (255),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V +DV+S++ ++++++TL++ + LLP+L  +L+S ++RH ++S
Sbjct  666  NDVKGAIGAMEKMADHAVLSDVISIVADKIDIVTLDICTCLLPLLTNMLESDMDRHLSIS  725

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV +FG ++ S  SA  SVGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  726  LDMLLKLVRMFGSMIYSTLSASTSVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  785

Query  407  LVAKSA  390
             VAK A
Sbjct  786  SVAKFA  791



>ref|XP_004489186.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Cicer arietinum]
Length=746

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+ G +    K+ DH+V ADVVS+++E+M+++TL+L + LLP+L  LL S+ +RH ++S
Sbjct  611  NDVTGVLGTMAKMGDHTVIADVVSIIMEKMDIVTLDLCTGLLPLLSDLLQSETDRHLSIS  670

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            +EMLL LV IFG V+ S  SA+PSVGVD+ AE R+E C  C   L+ +++ +P+L+ RGG
Sbjct  671  VEMLLNLVRIFGSVIYSTLSAKPSVGVDIEAENRLERCNLCFVELEKVKRFLPSLM-RGG  729

Query  407  LVAKSA  390
             +AK A
Sbjct  730  SIAKFA  735



>ref|XP_009793705.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Nicotiana sylvestris]
Length=810

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D++V AD+VS L E++++ITLE+ + LLP+L  LL SK++RH ++S
Sbjct  675  HDIKGAVSALEKMADNAVLADLVSFLTEKIDIITLEICTCLLPLLTGLLQSKLDRHQDIS  734

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKLV +FGP++ ++ S   SVGVD+ AE+R+E C  C   L+ ++  +P L  RGG
Sbjct  735  LNMLLKLVRVFGPLIYTSLSTPTSVGVDIEAEKRMERCNLCFIELEKVKNHLPAL-SRGG  793

Query  407  LVAKSA  390
             +AKSA
Sbjct  794  SIAKSA  799



>gb|EEC78255.1| hypothetical protein OsI_17928 [Oryza sativa Indica Group]
Length=950

 Score =   102 bits (254),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G I A +K+ DH+V ADV SVL+E+ E ITL+L + +LPVL  LL+SK +RH  VS
Sbjct  813  NDIRGIIAAMEKMSDHAVSADVASVLMEKSETITLDLCTVILPVLTDLLESKTDRHLGVS  872

Query  587  LEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            LE+L+KLV  FG V+ S  SA P SVGVDL AEQR E C  C   L+ ++  +P L +R 
Sbjct  873  LELLVKLVRTFGSVIHSTVSAGPSSVGVDLQAEQRRERCNLCFIELEKVKNKLPFLSRRK  932

Query  410  GLVAKSA  390
            G VA +A
Sbjct  933  GAVANTA  939



>gb|EEE61907.1| hypothetical protein OsJ_16629 [Oryza sativa Japonica Group]
Length=944

 Score =   102 bits (254),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G I A +K+ DH+V ADV SVL+E+ E ITL+L + +LPVL  LL+SK +RH  VS
Sbjct  807  NDIRGIIAAMEKMSDHAVSADVASVLMEKSETITLDLCTVILPVLTDLLESKTDRHLGVS  866

Query  587  LEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            LE+L+KLV  FG V+ S  SA P SVGVDL AEQR E C  C   L+ ++  +P L +R 
Sbjct  867  LELLVKLVRTFGSVIHSTVSAGPSSVGVDLQAEQRRERCNLCFIELEKVKNKLPFLSRRK  926

Query  410  GLVAKSA  390
            G VA +A
Sbjct  927  GAVANTA  933



>emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa Japonica Group]
Length=935

 Score =   102 bits (254),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G I A +K+ DH+V ADV SVL+E+ E ITL+L + +LPVL  LL+SK +RH  VS
Sbjct  798  NDIRGIIAAMEKMSDHAVSADVASVLMEKSETITLDLCTVILPVLTDLLESKTDRHLGVS  857

Query  587  LEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            LE+L+KLV  FG V+ S  SA P SVGVDL AEQR E C  C   L+ ++  +P L +R 
Sbjct  858  LELLVKLVRTFGSVIHSTVSAGPSSVGVDLQAEQRRERCNLCFIELEKVKNKLPFLSRRK  917

Query  410  GLVAKSA  390
            G VA +A
Sbjct  918  GAVANTA  924



>gb|KJB12377.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=815

 Score =   102 bits (254),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  680  NDIKGAISAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  739

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL  RGG
Sbjct  740  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTL-TRGG  798

Query  407  LVAKSA  390
             VAKSA
Sbjct  799  SVAKSA  804



>ref|XP_007150863.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
 ref|XP_007150864.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
 gb|ESW22857.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
 gb|ESW22858.1| hypothetical protein PHAVU_004G000600g [Phaseolus vulgaris]
Length=759

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+   I    K+ DH+V ADVVS+++E++++ITL++ + LLP+L  LL S++ERH  +S
Sbjct  623  NDVNEVIGIMTKMDDHAVIADVVSIIMEKIDIITLDICTGLLPLLTHLLQSEMERHQGIS  682

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV IFG V+ S  SA   VGVD+ AE+R+E C  C   L+ +++ +P+L +RGG
Sbjct  683  LEMLLKLVRIFGSVIYSTVSAPQPVGVDIEAEKRLERCNLCFPELEKVKRFLPSLSRRGG  742

Query  407  LVAKSA  390
             +AKSA
Sbjct  743  SIAKSA  748



>ref|XP_010232433.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Brachypodium distachyon]
Length=830

 Score =   102 bits (253),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAI A  KLPD +VQADVVS L  ++ +  L++FS  LPVL  LL+S+ ERHA VS
Sbjct  692  NGIKGAITAVAKLPDIAVQADVVSTLKGKLGLFNLDIFSGFLPVLAGLLNSRTERHAIVS  751

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LL L+ +FGPV+RS  SA  +V VD+ AEQR++ C +C  HLQ I Q +  LI RGG
Sbjct  752  LELLLDLIKVFGPVIRSTLSASSTVRVDIQAEQRLQRCTRCFNHLQKILQALHPLIMRGG  811

Query  407  LVAKSA  390
              A+ A
Sbjct  812  QSAQLA  817



>ref|XP_003564353.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Brachypodium distachyon]
Length=828

 Score =   102 bits (253),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAI A  KLPD +VQADVVS L  ++ +  L++FS  LPVL  LL+S+ ERHA VS
Sbjct  690  NGIKGAITAVAKLPDIAVQADVVSTLKGKLGLFNLDIFSGFLPVLAGLLNSRTERHAIVS  749

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+LL L+ +FGPV+RS  SA  +V VD+ AEQR++ C +C  HLQ I Q +  LI RGG
Sbjct  750  LELLLDLIKVFGPVIRSTLSASSTVRVDIQAEQRLQRCTRCFNHLQKILQALHPLIMRGG  809

Query  407  LVAKSA  390
              A+ A
Sbjct  810  QSAQLA  815



>emb|CAJ86235.1| H0402C08.11 [Oryza sativa Indica Group]
Length=923

 Score =   102 bits (254),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G I A +K+ DH+V ADV SVL+E+ E ITL+L + +LPVL  LL+SK +RH  VS
Sbjct  786  NDIRGIIAAMEKMSDHAVSADVASVLMEKSETITLDLCTVILPVLTDLLESKTDRHLGVS  845

Query  587  LEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            LE+L+KLV  FG V+ S  SA P SVGVDL AEQR E C  C   L+ ++  +P L +R 
Sbjct  846  LELLVKLVRTFGSVIHSTVSAGPSSVGVDLQAEQRRERCNLCFIELEKVKNKLPFLSRRK  905

Query  410  GLVAKSA  390
            G VA +A
Sbjct  906  GAVANTA  912



>gb|KJB12375.1| hypothetical protein B456_002G014900 [Gossypium raimondii]
Length=848

 Score =   102 bits (253),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDIKGAI+A +K+ DH V ADV+S++ E+++++TLE+ +SLLP+L  LL S ++RH ++ 
Sbjct  713  NDIKGAISAMEKMSDHGVLADVMSIVTEKIDIVTLEICTSLLPLLSGLLGSDMDRHLSIC  772

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV IFG ++ S  SA    GVD+ AEQR E C  C   L+ ++Q +PTL  RGG
Sbjct  773  LDMLLKLVRIFGSMIYSTLSALAPAGVDIEAEQRFERCNLCFIELEKVKQCLPTL-TRGG  831

Query  407  LVAKSA  390
             VAKSA
Sbjct  832  SVAKSA  837



>ref|XP_002316424.2| hypothetical protein POPTR_0010s26190g [Populus trichocarpa]
 gb|EEF02595.2| hypothetical protein POPTR_0010s26190g [Populus trichocarpa]
Length=728

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL+S ++RH+++S
Sbjct  592  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLESDMDRHSSIS  651

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA  SVGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  652  LDMLLKLVRTFGSMIYSTLSASTSVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  711

Query  407  LVAKSA  390
             VAK A
Sbjct  712  SVAKYA  717



>emb|CDX80363.1| BnaC07g30810D [Brassica napus]
Length=850

 Score =   101 bits (252),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 62/125 (50%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I + +K+ D++V ADV+S++ ER E++TL+  +SLLP+L ALL S +++H NVS
Sbjct  713  NDVKNTIGSMEKMADNAVTADVLSIITERNEIMTLDTCTSLLPILAALLASDMDQHLNVS  772

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV ++G  + S+ SA  SVGVD+ AEQRIE   +C   L+ ++  +P+L +RGG
Sbjct  773  LDLLLKLVRMYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACLPSLSRRGG  832

Query  407  LVAKS  393
            LVAKS
Sbjct  833  LVAKS  837



>ref|XP_009622381.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X3 [Nicotiana 
tomentosiformis]
Length=805

 Score =   101 bits (252),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D++V AD+VS L E+ +VITLE+ + LLP+L  LL SK++RH ++S
Sbjct  669  HDIKGAVSALEKMADNAVLADLVSFLTEKNDVITLEICTCLLPLLTGLLQSKLDRHQDIS  728

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKL  +FG ++ ++ S   SVGVD+ AE+R+E C  C   L+ ++  +P L +RGG
Sbjct  729  LTMLLKLAKVFGSLIYTSLSTPTSVGVDIEAEKRMERCNLCFIELEKVKNHLPALSRRGG  788

Query  407  LVAKSA  390
             +AKSA
Sbjct  789  SIAKSA  794



>ref|XP_008355994.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Malus domestica]
Length=107

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  614  KIERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqi  435
            K ERHAN+SLEMLLKLVA+FGPV+ S  S    VGV+L AEQR+ECC+QC  HLQ IQ+I
Sbjct  23   KTERHANISLEMLLKLVAVFGPVIHSTVSGPRPVGVNLQAEQRLECCKQCSIHLQKIQKI  82

Query  434  IPTLIQRGGLVAKSA  390
            +P  ++RGG++A+ A
Sbjct  83   LPVFVRRGGVLARCA  97



>ref|XP_009622378.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622379.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X1 [Nicotiana 
tomentosiformis]
Length=818

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D++V AD+VS L E+ +VITLE+ + LLP+L  LL SK++RH ++S
Sbjct  682  HDIKGAVSALEKMADNAVLADLVSFLTEKNDVITLEICTCLLPLLTGLLQSKLDRHQDIS  741

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKL  +FG ++ ++ S   SVGVD+ AE+R+E C  C   L+ ++  +P L +RGG
Sbjct  742  LTMLLKLAKVFGSLIYTSLSTPTSVGVDIEAEKRMERCNLCFIELEKVKNHLPALSRRGG  801

Query  407  LVAKSA  390
             +AKSA
Sbjct  802  SIAKSA  807



>ref|XP_009597532.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like [Nicotiana tomentosiformis]
Length=798

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D +V ADV+S L E+ ++ITLE+ + LLP+L+ +L+S ++RH ++S
Sbjct  662  HDIKGALSAMEKMADTAVLADVISFLTEKNDIITLEICTCLLPLLVGMLESSLDRHQDIS  721

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKLV +FG V+ S+ SA  SVGVD+ AEQR++    C   L+ ++  +PTL +RGG
Sbjct  722  LNMLLKLVKVFGSVIYSSLSAPASVGVDIEAEQRMDRYNLCFLELEKVKHWLPTLTRRGG  781

Query  407  LVAKSA  390
             +AKSA
Sbjct  782  SIAKSA  787



>ref|XP_010234861.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog, 
partial [Brachypodium distachyon]
Length=816

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 62/127 (49%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERM-EVITlelfssllpvllalldSKIERHANV  591
            NDIKG++NA +++ DH+V AD++SVL+E   E ITL++ +S+LP+   LL+S  ERH N+
Sbjct  673  NDIKGSVNAVQRMLDHAVTADIISVLMESTTECITLDICTSVLPLASNLLESIYERHLNI  732

Query  590  SLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRG  411
            +L M+LKLV  FGP + S  SA P VGVDL AEQR E C  C   L+ +  ++ +L +R 
Sbjct  733  ALGMILKLVKSFGPTICSTLSAAPPVGVDLEAEQRFERCHSCFQELKKVNSVLISLTRRQ  792

Query  410  GLVAKSA  390
            G V +SA
Sbjct  793  GNVGRSA  799



>emb|CDM83145.1| unnamed protein product [Triticum aestivum]
Length=830

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAI A  KLPD +VQADVVS L  ++ +  L++FSSLLPVL  LL+SK ERHA ++
Sbjct  692  NGIKGAIAAVAKLPDIAVQADVVSTLKGKLGLFNLDIFSSLLPVLAGLLNSKTERHAIIA  751

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLL L+ IFGPV+ S  SA   VGVDL AEQR++ C +C  HLQ I Q +  L+ R G
Sbjct  752  LEMLLDLIKIFGPVIHSTLSASSPVGVDLQAEQRLQRCTRCFNHLQKIVQALQPLMMRSG  811

Query  407  LVAKSA  390
              A+ A
Sbjct  812  QSAQLA  817



>ref|XP_001753544.1| predicted protein [Physcomitrella patens]
 gb|EDQ81767.1| predicted protein [Physcomitrella patens]
Length=157

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A KK+ DHSVQ +V+SV +E+ +++TLE+   L+P+L  LL +  +R    +
Sbjct  22   NDMKGAIEAMKKMTDHSVQVEVLSVFMEKSDLLTLEICYLLIPLLNGLLSTDNDRFLMTA  81

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+L KLV  FGP++ +  ++ PS+GVDL AEQR+E C  C   LQ +   +  L+++GG
Sbjct  82   LELLGKLVETFGPIIHATRTSAPSIGVDLQAEQRLERCNMCYHELQAVGHSLLPLMRKGG  141

Query  407  LVAKSA  390
             + K+A
Sbjct  142  DLTKAA  147



>gb|KHG01969.1| hypothetical protein F383_21214 [Gossypium arboreum]
Length=684

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -2

Query  716  VQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSLEMLLKLVAIFGPVVRS  537
            VQ D VSV +++ME++TL+LFSSLLPVL  LLDSKIERH  VSLEMLLKLVA+FGPV+R 
Sbjct  567  VQVDSVSVFMQKMEILTLDLFSSLLPVLTGLLDSKIERHVIVSLEMLLKLVAVFGPVIRL  626

Query  536  AASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGLVAKSA  390
             A A  SV VDLH EQR ECC QC   L+ I +++P L +RGG +A+ A
Sbjct  627  TALAPRSVSVDLHGEQRRECCNQCSMQLEKIHKLLPLLQRRGGTIARCA  675



>ref|XP_008340406.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
 ref|XP_008340407.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
 ref|XP_008340408.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Malus domestica]
Length=803

 Score =   100 bits (248),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG + A +K+ DH+V ADVVS++ E+ +++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  667  NDVKGVLGAMEKMADHAVIADVVSIMTEKFDIVTLDICTCLLPLLTGLLESNMDRHLGIS  726

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FG V+ SA SA  SVGVD+ AE+R+E C  C   L+ ++  +P L +RGG
Sbjct  727  LEMLLKLVRVFGSVIYSAISASSSVGVDIEAEKRLERCNVCFVELEKVKCCLPALTRRGG  786

Query  407  LVAKSA  390
             +AK+A
Sbjct  787  SIAKAA  792



>emb|CDX88026.1| BnaA06g26170D [Brassica napus]
Length=829

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 62/125 (50%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I + +K+ D++V ADV+S++I R E++TL+  +SLLP+L ALL S +++H +VS
Sbjct  692  NDVKNTIGSMEKMADNAVTADVLSIIIARNEIMTLDTCTSLLPILAALLASDMDQHLSVS  751

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV ++G  + S+ SA  SVGVD+ AEQRIE   +C   L+ ++  +P+L +RGG
Sbjct  752  LDMLLKLVRMYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACLPSLSRRGG  811

Query  407  LVAKS  393
            LVAKS
Sbjct  812  LVAKS  816



>tpg|DAA35346.1| TPA: hypothetical protein ZEAMMB73_159052 [Zea mays]
Length=877

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            NDI+G ++A  ++ DH+V AD+ SVL+E+ E ITL+L +S+LPV+  LL+SKI+RH  V+
Sbjct  740  NDIRGVLSAMDRMGDHAVCADMASVLMEKSETITLDLCTSILPVVTDLLESKIDRHLVVA  799

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LE+L+KLV  FGP++ S  S+ P VGVDL AEQR E C  C   L+  +  +P+L +R G
Sbjct  800  LELLVKLVRTFGPMIHSTVSSGPCVGVDLEAEQRRERCNLCFIELEKAKNKLPSLTRRKG  859

Query  407  LVAKSA  390
             VA +A
Sbjct  860  AVANAA  865



>ref|XP_011013730.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Populus euphratica]
Length=748

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL S ++RH+++S
Sbjct  612  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLGSDMDRHSSIS  671

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  672  LDMLLKLVRTFGSMIYSTLSASTPVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  731

Query  407  LVAKSA  390
             VAK A
Sbjct  732  SVAKYA  737



>ref|XP_011046586.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X3 [Populus euphratica]
Length=748

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL S ++RH+++S
Sbjct  612  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLGSDMDRHSSIS  671

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  672  LDMLLKLVRTFGSMIYSTLSASTPVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  731

Query  407  LVAKSA  390
             VAK A
Sbjct  732  SVAKYA  737



>ref|XP_011013727.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
 ref|XP_011013728.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=753

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL S ++RH+++S
Sbjct  617  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLGSDMDRHSSIS  676

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  677  LDMLLKLVRTFGSMIYSTLSASTPVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  736

Query  407  LVAKSA  390
             VAK A
Sbjct  737  SVAKYA  742



>ref|XP_009790404.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Nicotiana sylvestris]
Length=797

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 60/126 (48%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DI+GA++A +K+ D +V ADV+S L E+ ++ITLE+ + LLP+L+ +L+S ++RH ++S
Sbjct  661  HDIRGALSAMEKMADTAVLADVISFLTEKNDIITLEICTCLLPLLVGMLESSLDRHQDIS  720

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLK V +FG V+ S+ SA  SVGVD+ AEQR++    C   L+ ++  +PTL +RGG
Sbjct  721  LNMLLKFVKVFGSVIYSSLSAPASVGVDIEAEQRMDRYNLCFVELEKVKHWLPTLTRRGG  780

Query  407  LVAKSA  390
             +AKSA
Sbjct  781  SIAKSA  786



>ref|XP_011013729.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Populus euphratica]
Length=751

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL S ++RH+++S
Sbjct  615  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLGSDMDRHSSIS  674

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  675  LDMLLKLVRTFGSMIYSTLSASTPVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  734

Query  407  LVAKSA  390
             VAK A
Sbjct  735  SVAKYA  740



>ref|XP_011046583.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
 ref|XP_011046584.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Populus euphratica]
Length=753

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL S ++RH+++S
Sbjct  617  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLGSDMDRHSSIS  676

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  677  LDMLLKLVRTFGSMIYSTLSASTPVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  736

Query  407  LVAKSA  390
             VAK A
Sbjct  737  SVAKYA  742



>ref|XP_011046585.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Populus euphratica]
Length=751

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KGAI A +K+ DH+V ADV+S++ ++++ +TL++ + LLP+L  LL S ++RH+++S
Sbjct  615  NDVKGAIGAMEKMADHAVLADVISIVADKIDTVTLDICTCLLPLLTNLLGSDMDRHSSIS  674

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV  FG ++ S  SA   VGVD+ AEQR+E C  C   L+ +++ + TL ++GG
Sbjct  675  LDMLLKLVRTFGSMIYSTLSASTPVGVDIEAEQRLERCNICFVELEKVKRCLLTLTRKGG  734

Query  407  LVAKSA  390
             VAK A
Sbjct  735  SVAKYA  740



>ref|XP_009351770.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351771.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351772.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351773.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Pyrus x bretschneideri]
Length=803

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+KG + A +K+ DH+V ADVVS++ ++++++TL++ + LLP+L  LL+S ++RH  +S
Sbjct  667  NDVKGVLGAMEKMADHAVIADVVSIMTQKIDIVTLDICTYLLPLLTGLLESNMDRHLGIS  726

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            LEMLLKLV +FG V+ SA SA  SVGVD+ AE+R+E C  C   L+ ++  +P L +RGG
Sbjct  727  LEMLLKLVRVFGSVIYSAISASSSVGVDIEAEKRLERCNICFVELEKVKCCLPALTRRGG  786

Query  407  LVAKSA  390
             +AK+A
Sbjct  787  SIAKAA  792



>ref|XP_009150876.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Brassica rapa]
Length=830

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I + +K+ D++V ADV+S++ ER E++TL+  +SLLP+L ALL S +++H +VS
Sbjct  693  NDVKNTIGSMEKMADNAVTADVLSIITERNEIMTLDTCTSLLPILAALLASDMDQHLSVS  752

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L+MLLKLV ++G  +  + SA  SVGVD+ AEQRIE   +C   L+ ++  +P+L +RGG
Sbjct  753  LDMLLKLVRMYGSPIYLSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACLPSLSRRGG  812

Query  407  LVAKS  393
            LVAKS
Sbjct  813  LVAKS  817



>ref|XP_004231535.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum lycopersicum]
Length=798

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +D KGA+NA +K+ D +V ADV+S L E+ ++ITLE+ + LLP+L  LL+S ++RH ++S
Sbjct  662  HDTKGALNATEKMADPAVLADVISFLTEKNDMITLEICTCLLPLLGGLLESNLDRHQDIS  721

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKLV ++G V+ S+ SA  SVGVD+ AEQR+E    C   L+ ++  +P L +RGG
Sbjct  722  LIMLLKLVKVYGSVIYSSISAPASVGVDIEAEQRMERYNLCFVELEKVKNWLPALTRRGG  781

Query  407  LVAKSA  390
             +AKSA
Sbjct  782  SIAKSA  787



>ref|XP_010067049.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X1 [Eucalyptus grandis]
 gb|KCW65113.1| hypothetical protein EUGRSUZ_G02621 [Eucalyptus grandis]
Length=787

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  764  DIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVSL  585
            DIKGAI A +K+ D+SV ADVVS++ E+++ +TL++F+ LLP+L  LL+S ++RH ++SL
Sbjct  653  DIKGAIGAMEKMADNSVLADVVSIMTEKIDTVTLDIFTCLLPLLNGLLESDLDRHLSISL  712

Query  584  EMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGGL  405
            ++LLKLV +FG +V SA  A   VGVD+ AEQR+E    C   L+ +++ +P L +RGG 
Sbjct  713  DILLKLVRVFGSMVYSAVLASTPVGVDIEAEQRLERYNLCYVELERVKRCLPALTRRGGS  772

Query  404  VAKSA  390
            VAKSA
Sbjct  773  VAKSA  777



>ref|XP_009622380.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
{ECO:0000255|HAMAP-Rule:MF_03022}-like isoform X2 [Nicotiana 
tomentosiformis]
Length=817

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA++A +K+ D++V AD+VS L E+ +VITLE+ + LLP+L  LL SK++RH ++S
Sbjct  682  HDIKGAVSALEKMADNAVLADLVSFLTEKNDVITLEICTCLLPLLTGLLQSKLDRHQDIS  741

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKL  +FG ++ ++ S   SVGVD+ AE+R+E C  C   L+ ++  +P L  RGG
Sbjct  742  LTMLLKLAKVFGSLIYTSLSTPTSVGVDIEAEKRMERCNLCFIELEKVKNHLPAL-SRGG  800

Query  407  LVAKSA  390
             +AKSA
Sbjct  801  SIAKSA  806



>ref|XP_006361541.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Solanum tuberosum]
Length=798

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            +DIKGA+ A +K+ D +V ADV+S L E+ ++ITLE+ + LLP+L  LL+S ++RH ++S
Sbjct  662  HDIKGALIATEKMADPAVLADVISFLTEKNDMITLEICTCLLPLLGGLLESNLDRHQDIS  721

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L MLLKLV ++G V+ S+ SA  SVGVD+ AEQR+E    C   L+ ++  +P+L +RGG
Sbjct  722  LIMLLKLVKVYGSVIYSSMSAPASVGVDIEAEQRMERYNLCFVELEKVKNWLPSLTRRGG  781

Query  407  LVAKSA  390
             +AKSA
Sbjct  782  SIAKSA  787



>ref|XP_006394609.1| hypothetical protein EUTSA_v10005394mg, partial [Eutrema salsugineum]
 gb|ESQ31895.1| hypothetical protein EUTSA_v10005394mg, partial [Eutrema salsugineum]
Length=827

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K  I + +K+ D++V ADV+ ++ ER E++TL+  +SLLP+L ALL S +++H +VS
Sbjct  690  NDVKNTIGSMEKMADNAVIADVLGIITERNEILTLDTCTSLLPILTALLGSDMDQHLSVS  749

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV ++G  + S+ SA  SVGVD+ AEQRIE   +C   L+ ++  +P+L +RGG
Sbjct  750  LDLLLKLVRMYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACLPSLSRRGG  809

Query  407  LVAKS  393
            LVAKS
Sbjct  810  LVAKS  814



>ref|XP_009131065.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
[Brassica rapa]
Length=835

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            ND+K +I++ +K+ D++V ADV+ ++ ER EV+TL+  +SLLP++ ALL S I+RH +V 
Sbjct  698  NDVKNSISSIEKMADNAVVADVLVIITERSEVLTLDTCTSLLPLMSALLGSNIDRHLSVC  757

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLqiiqqiIPTLIQRGG  408
            L++LLKLV ++G  + S+ SA  SVGVD+ AEQR+E   +C   L+ I+  +P+L +RGG
Sbjct  758  LDLLLKLVRMYGSQIYSSLSAPSSVGVDIEAEQRMERYSRCFVELEKIKACLPSLERRGG  817

Query  407  LVAKS  393
            LVAK+
Sbjct  818  LVAKT  822



>ref|XP_010905606.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 
isoform X2 [Elaeis guineensis]
Length=816

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -2

Query  767  NDIKGAINAXKKLPDHSVQADVVSVLIERMEVITlelfssllpvllalldSKIERHANVS  588
            N IKGAINA  KLPDHSVQ D++S+L E++++ TLELFS LLP+L+ LL+S+ ERH  V+
Sbjct  704  NGIKGAINAVVKLPDHSVQVDLISILKEKIDLFTLELFSCLLPLLVGLLNSRTERHLIVA  763

Query  587  LEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIE  480
            LEMLL+LV IFGPV+ S  SA   VGVDL AEQR E
Sbjct  764  LEMLLELVKIFGPVIHSTMSASSLVGVDLQAEQRRE  799



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100