BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051K24

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761445.1|  PREDICTED: long chain base biosynthesis prot...    352   9e-116   Nicotiana sylvestris
dbj|BAE96963.1|  serine palmitpoyltransferase subunit2                  352   1e-115   Nicotiana tabacum [American tobacco]
ref|XP_009611514.1|  PREDICTED: long chain base biosynthesis prot...    351   3e-115   Nicotiana tomentosiformis
ref|XP_002284409.1|  PREDICTED: long chain base biosynthesis prot...    351   3e-115   Vitis vinifera
dbj|BAG68298.1|  serine palmitoyltransferase                            350   6e-115   Nicotiana benthamiana
emb|CBI15735.3|  unnamed protein product                                351   6e-115   Vitis vinifera
ref|XP_011083372.1|  PREDICTED: long chain base biosynthesis prot...    350   1e-114   Sesamum indicum [beniseed]
ref|XP_010249161.1|  PREDICTED: long chain base biosynthesis prot...    350   1e-114   Nelumbo nucifera [Indian lotus]
ref|XP_006446964.1|  hypothetical protein CICLE_v10017847mg             349   1e-114   Citrus clementina [clementine]
gb|EYU24476.1|  hypothetical protein MIMGU_mgv1a004686mg                343   1e-111   Erythranthe guttata [common monkey flower]
ref|XP_008231042.1|  PREDICTED: long chain base biosynthesis prot...    341   3e-111   Prunus mume [ume]
ref|XP_004235384.1|  PREDICTED: long chain base biosynthesis prot...    341   4e-111   
ref|XP_008341247.1|  PREDICTED: long chain base biosynthesis prot...    340   6e-111   Malus domestica [apple tree]
ref|XP_006364387.1|  PREDICTED: long chain base biosynthesis prot...    340   7e-111   Solanum tuberosum [potatoes]
ref|XP_008379061.1|  PREDICTED: long chain base biosynthesis prot...    338   2e-110   
emb|CDO98665.1|  unnamed protein product                                338   3e-110   Coffea canephora [robusta coffee]
ref|XP_010678318.1|  PREDICTED: long chain base biosynthesis prot...    338   3e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209963.1|  hypothetical protein PRUPE_ppa004890mg             338   3e-110   Prunus persica
ref|XP_011042943.1|  PREDICTED: long chain base biosynthesis prot...    338   5e-110   Populus euphratica
ref|XP_009378026.1|  PREDICTED: long chain base biosynthesis prot...    337   7e-110   Pyrus x bretschneideri [bai li]
ref|XP_007031988.1|  Long chain base2 isoform 2                         336   1e-109   
ref|XP_011073130.1|  PREDICTED: long chain base biosynthesis prot...    337   1e-109   Sesamum indicum [beniseed]
ref|XP_007038096.1|  Long chain base2 isoform 2                         337   2e-109   
ref|XP_006347368.1|  PREDICTED: long chain base biosynthesis prot...    336   3e-109   Solanum tuberosum [potatoes]
ref|XP_004241473.1|  PREDICTED: long chain base biosynthesis prot...    336   3e-109   Solanum lycopersicum
ref|XP_002318160.1|  serine palmitoyltransferase family protein         336   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_007031987.1|  Long chain base2 isoform 1                         335   4e-109   Theobroma cacao [chocolate]
ref|XP_010096046.1|  Serine palmitoyltransferase 2                      336   5e-109   
emb|CAB44316.1|  serine palmitoyltransferase                            335   5e-109   Solanum tuberosum [potatoes]
dbj|BAF01511.1|  serine palmitoyltransferase-like protein               325   1e-108   Arabidopsis thaliana [mouse-ear cress]
gb|KDP41837.1|  hypothetical protein JCGZ_26855                         334   2e-108   Jatropha curcas
dbj|BAC55228.1|  serine palmitoyltransferase                            333   2e-108   Lotus japonicus
ref|XP_008464380.1|  PREDICTED: long chain base biosynthesis prot...    332   8e-108   Cucumis melo [Oriental melon]
ref|XP_007215280.1|  hypothetical protein PRUPE_ppa004859mg             332   8e-108   
gb|KEH25646.1|  long chain base biosynthesis 2a-like protein            332   1e-107   Medicago truncatula
gb|KHN13380.1|  Serine palmitoyltransferase 2                           332   1e-107   Glycine soja [wild soybean]
ref|XP_003548027.1|  PREDICTED: long chain base biosynthesis prot...    332   2e-107   Glycine max [soybeans]
ref|XP_009150176.1|  PREDICTED: long chain base biosynthesis prot...    331   2e-107   Brassica rapa
ref|XP_004161364.1|  PREDICTED: LOW QUALITY PROTEIN: long chain b...    330   3e-107   
ref|XP_004138028.1|  PREDICTED: long chain base biosynthesis prot...    330   3e-107   Cucumis sativus [cucumbers]
ref|XP_004304557.1|  PREDICTED: long chain base biosynthesis prot...    330   4e-107   Fragaria vesca subsp. vesca
ref|XP_006404217.1|  hypothetical protein EUTSA_v10010322mg             330   4e-107   Eutrema salsugineum [saltwater cress]
dbj|BAH19645.1|  AT5G23670                                              322   4e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KJB51269.1|  hypothetical protein B456_008G209600                    330   4e-107   Gossypium raimondii
ref|XP_010907607.1|  PREDICTED: long chain base biosynthesis prot...    330   5e-107   Elaeis guineensis
gb|KHG30176.1|  Serine palmitoyltransferase 2                           330   5e-107   Gossypium arboreum [tree cotton]
ref|XP_003518128.1|  PREDICTED: long chain base biosynthesis prot...    330   7e-107   Glycine max [soybeans]
emb|CDX87007.1|  BnaC03g52770D                                          330   7e-107   
gb|KJB51268.1|  hypothetical protein B456_008G209600                    330   1e-106   Gossypium raimondii
gb|KHN00617.1|  Serine palmitoyltransferase 2                           330   1e-106   Glycine soja [wild soybean]
ref|XP_008791061.1|  PREDICTED: long chain base biosynthesis prot...    328   2e-106   Phoenix dactylifera
gb|ABW97708.1|  serine palmitoyltransferase long chain base subunit     328   3e-106   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006290987.1|  hypothetical protein CARUB_v10017101mg             327   5e-106   Capsella rubella
ref|XP_010929641.1|  PREDICTED: long chain base biosynthesis prot...    327   6e-106   Elaeis guineensis
ref|XP_010036863.1|  PREDICTED: long chain base biosynthesis prot...    327   1e-105   Eucalyptus grandis [rose gum]
ref|XP_008775142.1|  PREDICTED: long chain base biosynthesis prot...    327   1e-105   Phoenix dactylifera
ref|XP_007151745.1|  hypothetical protein PHAVU_004G071100g             326   1e-105   Phaseolus vulgaris [French bean]
ref|NP_190447.1|  serine palmitoyltransferase 1                         325   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151545.1|  PREDICTED: long chain base biosynthesis prot...    325   5e-105   Brassica rapa
ref|XP_010660694.1|  PREDICTED: long chain base biosynthesis prot...    325   6e-105   Vitis vinifera
emb|CDX68498.1|  BnaC01g25760D                                          325   6e-105   
ref|XP_002275468.1|  PREDICTED: long chain base biosynthesis prot...    325   6e-105   Vitis vinifera
ref|XP_002875925.1|  hypothetical protein ARALYDRAFT_485232             325   8e-105   
ref|XP_010515202.1|  PREDICTED: long chain base biosynthesis prot...    324   9e-105   Camelina sativa [gold-of-pleasure]
gb|KFK34178.1|  hypothetical protein AALP_AA5G110700                    324   1e-104   Arabis alpina [alpine rockcress]
emb|CDX83048.1|  BnaA01g20480D                                          323   2e-104   
ref|XP_009421040.1|  PREDICTED: long chain base biosynthesis prot...    323   3e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403784.1|  PREDICTED: long chain base biosynthesis prot...    323   4e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287613.1|  hypothetical protein CARUB_v10000825mg             323   4e-104   Capsella rubella
ref|XP_008353440.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    337   5e-104   
ref|XP_007038095.1|  Long chain base2 isoform 1                         323   5e-104   
ref|XP_002512864.1|  serine palmitoyltransferase, putative              322   6e-104   Ricinus communis
ref|XP_002872066.1|  LCB2 subunit protein                               322   9e-104   Arabidopsis lyrata subsp. lyrata
dbj|BAB03231.1|  serine palmitoyltransferase                            322   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197756.1|  serine palmitoyltransferase subunit LCB2              322   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073129.1|  PREDICTED: long chain base biosynthesis prot...    322   1e-103   
ref|XP_009403558.1|  PREDICTED: long chain base biosynthesis prot...    320   1e-103   
ref|XP_010503519.1|  PREDICTED: long chain base biosynthesis prot...    321   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010493489.1|  PREDICTED: long chain base biosynthesis prot...    321   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010421176.1|  PREDICTED: long chain base biosynthesis prot...    321   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010454654.1|  PREDICTED: long chain base biosynthesis prot...    321   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_006394630.1|  hypothetical protein EUTSA_v10004251mg             319   2e-103   
ref|XP_011073128.1|  PREDICTED: long chain base biosynthesis prot...    321   4e-103   
ref|XP_004516386.1|  PREDICTED: long chain base biosynthesis prot...    320   6e-103   Cicer arietinum [garbanzo]
ref|XP_009419359.1|  PREDICTED: long chain base biosynthesis prot...    319   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403557.1|  PREDICTED: long chain base biosynthesis prot...    319   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK27657.1|  hypothetical protein AALP_AA8G411600                    319   1e-102   Arabis alpina [alpine rockcress]
ref|XP_009404745.1|  PREDICTED: long chain base biosynthesis prot...    318   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010519476.1|  PREDICTED: long chain base biosynthesis prot...    318   2e-102   Tarenaya hassleriana [spider flower]
gb|KDO47369.1|  hypothetical protein CISIN_1g040324mg                   318   2e-102   Citrus sinensis [apfelsine]
ref|XP_006446965.1|  hypothetical protein CICLE_v10015046mg             318   2e-102   Citrus clementina [clementine]
ref|XP_006828786.1|  hypothetical protein AMTR_s00001p00112910          317   5e-102   Amborella trichopoda
ref|XP_011002110.1|  PREDICTED: long chain base biosynthesis prot...    317   5e-102   Populus euphratica
ref|XP_006468870.1|  PREDICTED: long chain base biosynthesis prot...    317   8e-102   Citrus sinensis [apfelsine]
gb|EEE52176.1|  hypothetical protein OsJ_34042                          315   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002321740.1|  serine palmitoyltransferase family protein         315   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_004979342.1|  PREDICTED: long chain base biosynthesis prot...    315   4e-101   Setaria italica
ref|NP_001148953.1|  serine palmitoyltransferase 2                      315   4e-101   
ref|XP_003577540.1|  PREDICTED: long chain base biosynthesis prot...    314   8e-101   Brachypodium distachyon [annual false brome]
ref|NP_001067972.1|  Os11g0516000                                       314   1e-100   
ref|NP_001151995.1|  LOC100285632                                       313   3e-100   Zea mays [maize]
ref|XP_006662956.1|  PREDICTED: long chain base biosynthesis prot...    312   6e-100   Oryza brachyantha
ref|XP_002450805.1|  hypothetical protein SORBIDRAFT_05g018880          312   6e-100   Sorghum bicolor [broomcorn]
ref|XP_009150174.1|  PREDICTED: long chain base biosynthesis prot...    307   4e-99    Brassica rapa
ref|XP_008656901.1|  PREDICTED: long chain base biosynthesis prot...    309   9e-99    
ref|XP_004971156.1|  PREDICTED: long chain base biosynthesis prot...    308   2e-98    Setaria italica
ref|XP_002459025.1|  hypothetical protein SORBIDRAFT_03g044700          308   2e-98    Sorghum bicolor [broomcorn]
emb|CDY69570.1|  BnaAnng30850D                                          305   2e-98    Brassica napus [oilseed rape]
ref|NP_001045279.1|  Os01g0928800                                       308   3e-98    
ref|XP_006645277.1|  PREDICTED: long chain base biosynthesis prot...    307   6e-98    Oryza brachyantha
ref|XP_003564989.1|  PREDICTED: long chain base biosynthesis prot...    306   1e-97    Brachypodium distachyon [annual false brome]
ref|XP_009150173.1|  PREDICTED: long chain base biosynthesis prot...    306   1e-97    Brassica rapa
ref|XP_002450804.1|  hypothetical protein SORBIDRAFT_05g018870          305   2e-97    
gb|EMT23338.1|  Serine palmitoyltransferase 2                           305   2e-97    
ref|XP_008678155.1|  PREDICTED: long chain base biosynthesis prot...    304   5e-97    Zea mays [maize]
ref|XP_008678154.1|  PREDICTED: long chain base biosynthesis prot...    303   1e-96    Zea mays [maize]
emb|CDM85908.1|  unnamed protein product                                308   1e-95    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001045278.1|  Os01g0928700                                       300   4e-95    
gb|EMS46639.1|  Serine palmitoyltransferase 2                           297   4e-94    Triticum urartu
ref|XP_010093950.1|  Serine palmitoyltransferase 2                      297   1e-93    
ref|XP_010322021.1|  PREDICTED: long chain base biosynthesis prot...    295   1e-93    
gb|EMS48138.1|  Serine palmitoyltransferase 2                           295   2e-93    Triticum urartu
ref|XP_008239635.1|  PREDICTED: long chain base biosynthesis prot...    294   2e-93    Prunus mume [ume]
gb|ABR18369.1|  unknown                                                 292   3e-92    Picea sitchensis
gb|ADN33867.1|  serine palmitoyltransferase                             279   2e-91    Cucumis melo subsp. melo
ref|NP_190448.1|  Pyridoxal phosphate (PLP)-dependent transferase...    285   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KCW48525.1|  hypothetical protein EUGRSUZ_K02201                     290   3e-91    Eucalyptus grandis [rose gum]
ref|XP_006645276.1|  PREDICTED: long chain base biosynthesis prot...    288   1e-90    Oryza brachyantha
pir||T49275  serine C-palmitoyltransferase (EC 2.3.1.50) [similar...    283   3e-90 
ref|XP_006645275.1|  PREDICTED: long chain base biosynthesis prot...    286   1e-89    Oryza brachyantha
ref|XP_008678152.1|  PREDICTED: long chain base biosynthesis prot...    286   2e-89    
gb|EAY77076.1|  hypothetical protein OsI_05036                          282   3e-88    Oryza sativa Indica Group [Indian rice]
sp|Q8RYL1.1|LCB2B_ORYSJ  RecName: Full=Long chain base biosynthes...    282   3e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006394629.1|  hypothetical protein EUTSA_v10004251mg             277   2e-87    
ref|XP_009411041.1|  PREDICTED: long chain base biosynthesis prot...    279   3e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002978032.1|  hypothetical protein SELMODRAFT_108076             271   2e-84    Selaginella moellendorffii
ref|XP_009394362.1|  PREDICTED: long chain base biosynthesis prot...    274   1e-83    
ref|XP_002966707.1|  hypothetical protein SELMODRAFT_86377              269   3e-83    Selaginella moellendorffii
ref|XP_001783810.1|  predicted protein                                  256   4e-78    
ref|XP_008778939.1|  PREDICTED: long chain base biosynthesis prot...    249   8e-75    
gb|EEC72089.1|  hypothetical protein OsI_05034                          242   1e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_008671350.1|  PREDICTED: long chain base biosynthesis prot...    232   2e-70    
ref|XP_002875926.1|  hypothetical protein ARALYDRAFT_485233             219   8e-66    
ref|XP_005647033.1|  PLP-dependent transferase                          218   1e-63    Coccomyxa subellipsoidea C-169
ref|XP_005848468.1|  hypothetical protein CHLNCDRAFT_144864             216   7e-63    Chlorella variabilis
emb|CDX87006.1|  BnaC03g52760D                                          211   7e-62    
ref|XP_005917126.1|  PREDICTED: serine palmitoyltransferase 2-like      204   4e-61    
emb|CAG00103.1|  unnamed protein product                                206   3e-59    Tetraodon nigroviridis
ref|XP_003971560.1|  PREDICTED: serine palmitoyltransferase 2-like      205   5e-58    Takifugu rubripes [tiger puffer]
ref|XP_011401811.1|  Serine palmitoyltransferase 2                      203   5e-58    Auxenochlorella protothecoides
ref|XP_008280215.1|  PREDICTED: serine palmitoyltransferase 2-like      204   7e-58    Stegastes partitus
ref|XP_005724923.1|  PREDICTED: serine palmitoyltransferase 2-like      204   1e-57    Pundamilia nyererei
ref|XP_010789508.1|  PREDICTED: serine palmitoyltransferase 2-like      194   3e-57    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003440868.1|  PREDICTED: serine palmitoyltransferase 2-like      201   7e-57    Oreochromis niloticus
ref|XP_007566208.1|  PREDICTED: serine palmitoyltransferase 2           201   9e-57    Poecilia formosa
ref|XP_010880781.1|  PREDICTED: serine palmitoyltransferase 2-like      201   2e-56    Esox lucius
ref|XP_004083402.1|  PREDICTED: serine palmitoyltransferase 2-like      200   2e-56    Oryzias latipes [Japanese rice fish]
ref|XP_008310964.1|  PREDICTED: serine palmitoyltransferase 2 iso...    200   3e-56    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008396458.1|  PREDICTED: serine palmitoyltransferase 2-like      199   4e-56    Poecilia reticulata
ref|XP_004349889.1|  serine palmitoyltransferase                        198   5e-56    Capsaspora owczarzaki ATCC 30864
gb|ADY39561.1|  putative serine palmitoyltransferase                    190   6e-56    Hottentotta judaicus
ref|XP_005809327.1|  PREDICTED: serine palmitoyltransferase 2-like      199   8e-56    Xiphophorus maculatus
gb|AAM82589.1|AF525281_1  serine palmitoyltransferase                   186   2e-55    Brassica oleracea
ref|XP_002186044.1|  predicted protein                                  196   2e-55    Phaeodactylum tricornutum CCAP 1055/1
emb|CDQ72138.1|  unnamed protein product                                197   3e-55    Oncorhynchus mykiss
ref|NP_001108213.1|  serine palmitoyltransferase, long chain base...    197   4e-55    Danio rerio [leopard danio]
ref|XP_010739223.1|  PREDICTED: serine palmitoyltransferase 2           196   6e-55    Larimichthys crocea [croceine croaker]
ref|XP_005820282.1|  hypothetical protein GUITHDRAFT_98377              197   2e-54    Guillardia theta CCMP2712
emb|CAF94268.1|  unnamed protein product                                193   5e-54    Tetraodon nigroviridis
tpg|DAA46316.1|  TPA: hypothetical protein ZEAMMB73_317015              192   7e-54    
ref|XP_004344667.1|  serine palmitoyltransferase, long chain base...    192   9e-54    Acanthamoeba castellanii str. Neff
ref|XP_003962837.1|  PREDICTED: serine palmitoyltransferase 2-like      193   1e-53    Takifugu rubripes [tiger puffer]
ref|XP_006632191.1|  PREDICTED: serine palmitoyltransferase 2-like      192   2e-53    Lepisosteus oculatus
dbj|BAE21805.1|  unnamed protein product                                185   2e-53    Mus musculus [mouse]
tpg|DAA63385.1|  TPA: hypothetical protein ZEAMMB73_716052              192   2e-53    
ref|XP_004542426.1|  PREDICTED: serine palmitoyltransferase 2-like      192   2e-53    
ref|XP_003445532.1|  PREDICTED: serine palmitoyltransferase 2-lik...    192   2e-53    Oreochromis niloticus
dbj|BAC37842.1|  unnamed protein product                                185   3e-53    Mus musculus [mouse]
tpg|DAA63387.1|  TPA: hypothetical protein ZEAMMB73_716052              193   3e-53    
ref|XP_005750502.1|  PREDICTED: serine palmitoyltransferase 2-like      191   6e-53    Pundamilia nyererei
gb|EFA83279.1|  serine C-palmitoyltransferase subunit                   190   7e-53    Heterostelium album PN500
ref|XP_008275494.1|  PREDICTED: serine palmitoyltransferase 2-like      191   7e-53    Stegastes partitus
ref|XP_010118582.1|  PREDICTED: serine palmitoyltransferase 2           185   8e-53    Chlamydotis macqueenii
dbj|GAM19483.1|  hypothetical protein SAMD00019534_026580               189   1e-52    Acytostelium subglobosum LB1
ref|XP_002287833.1|  predicted protein                                  191   1e-52    Thalassiosira pseudonana CCMP1335
ref|XP_006036023.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    188   1e-52    Alligator sinensis
gb|EPZ34220.1|  Pyridoxal phosphate-dependent transferase domain-...    189   1e-52    Rozella allomycis CSF55
ref|XP_002734813.1|  PREDICTED: serine palmitoyltransferase 2-like      190   1e-52    Saccoglossus kowalevskii
ref|XP_009948862.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-52    Leptosomus discolor
ref|XP_002951879.1|  hypothetical protein VOLCADRAFT_92508              193   2e-52    Volvox carteri f. nagariensis
ref|XP_007248546.1|  PREDICTED: serine palmitoyltransferase 2           190   2e-52    
ref|NP_001085763.1|  serine palmitoyltransferase, long chain base...    189   2e-52    Xenopus laevis [clawed frog]
ref|XP_002734812.1|  PREDICTED: serine palmitoyltransferase 2-like      189   3e-52    Saccoglossus kowalevskii
ref|XP_002613183.1|  hypothetical protein BRAFLDRAFT_210501             187   3e-52    Branchiostoma floridae
ref|XP_011401812.1|  Serine palmitoyltransferase 2                      191   3e-52    Auxenochlorella protothecoides
ref|XP_010214677.1|  PREDICTED: serine palmitoyltransferase 2           186   5e-52    Tinamus guttatus
ref|XP_005710134.1|  serine palmitoyltransferase, LCB2 subunit          187   7e-52    Chondrus crispus [carageen]
tpg|DAA38120.1|  TPA: hypothetical protein ZEAMMB73_853430              184   7e-52    
ref|NP_001018455.1|  serine palmitoyltransferase 2                      187   9e-52    Danio rerio [leopard danio]
ref|XP_009565075.1|  PREDICTED: serine palmitoyltransferase 2           186   1e-51    Cuculus canorus
ref|XP_010742461.1|  PREDICTED: serine palmitoyltransferase 2-like      188   1e-51    
ref|XP_010010806.1|  PREDICTED: serine palmitoyltransferase 2           186   1e-51    Nestor notabilis
gb|EPY81318.1|  serine palmitoyltransferase 2                           186   1e-51    Camelus ferus
emb|CCI48496.1|  unnamed protein product                                186   2e-51    Albugo candida
ref|XP_003441227.1|  PREDICTED: serine palmitoyltransferase 3 iso...    187   2e-51    Oreochromis niloticus
ref|XP_005990149.1|  PREDICTED: serine palmitoyltransferase 2           187   2e-51    Latimeria chalumnae
ref|XP_010876930.1|  PREDICTED: serine palmitoyltransferase 2           187   2e-51    Esox lucius
ref|XP_006746809.1|  PREDICTED: serine palmitoyltransferase 2           184   2e-51    Leptonychotes weddellii
ref|XP_009317686.1|  PREDICTED: serine palmitoyltransferase 2           186   2e-51    Pygoscelis adeliae
ref|XP_005605438.1|  PREDICTED: serine palmitoyltransferase 2           186   2e-51    
ref|XP_005936388.1|  PREDICTED: serine palmitoyltransferase 3-lik...    186   2e-51    
ref|XP_009512509.1|  PREDICTED: serine palmitoyltransferase 2           186   2e-51    Phalacrocorax carbo [common cormorant]
ref|XP_005749399.1|  PREDICTED: serine palmitoyltransferase 3-lik...    186   2e-51    Pundamilia nyererei
ref|XP_009279012.1|  PREDICTED: serine palmitoyltransferase 2           185   2e-51    Aptenodytes forsteri
ref|XP_005502422.1|  PREDICTED: serine palmitoyltransferase 2           185   3e-51    Columba livia [carrier pigeon]
ref|XP_009644944.1|  PREDICTED: serine palmitoyltransferase 2           185   3e-51    Egretta garzetta
ref|XP_006157148.1|  PREDICTED: serine palmitoyltransferase 2           186   3e-51    Tupaia chinensis
ref|XP_010333697.1|  PREDICTED: serine palmitoyltransferase 2           185   3e-51    Saimiri boliviensis boliviensis
ref|XP_006778946.1|  PREDICTED: serine palmitoyltransferase 2           186   4e-51    
gb|EHH62679.1|  hypothetical protein EGM_21088                          185   4e-51    Macaca fascicularis [crab eating macaque]
gb|EHH28079.1|  hypothetical protein EGK_18422                          185   4e-51    Macaca mulatta [rhesus macaque]
ref|XP_004559826.1|  PREDICTED: serine palmitoyltransferase 3-like      186   4e-51    Maylandia zebra
ref|XP_005749398.1|  PREDICTED: serine palmitoyltransferase 3-lik...    186   4e-51    Pundamilia nyererei
ref|XP_009988351.1|  PREDICTED: serine palmitoyltransferase 2           184   4e-51    Tauraco erythrolophus
ref|XP_005417509.1|  PREDICTED: serine palmitoyltransferase 2           185   4e-51    Geospiza fortis
ref|XP_011488917.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    186   5e-51    
ref|XP_009580257.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    184   5e-51    Fulmarus glacialis
ref|XP_005534958.1|  serine palmitoyltransferase                        187   5e-51    Cyanidioschyzon merolae strain 10D
ref|XP_009080576.1|  PREDICTED: serine palmitoyltransferase 2           184   5e-51    Acanthisitta chloris
gb|EMC83907.1|  Serine palmitoyltransferase 2                           185   5e-51    
emb|CEG69772.1|  Putative Aminotransferase class I/classII              185   6e-51    Rhizopus microsporus
ref|XP_009885296.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    184   6e-51    Charadrius vociferus
ref|XP_002200055.2|  PREDICTED: serine palmitoyltransferase 2           185   6e-51    
ref|XP_005936386.1|  PREDICTED: serine palmitoyltransferase 3-lik...    186   6e-51    
ref|XP_008923197.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    184   6e-51    
ref|XP_005148932.1|  PREDICTED: serine palmitoyltransferase 2           184   6e-51    Melopsittacus undulatus
ref|XP_009705333.1|  PREDICTED: serine palmitoyltransferase 2           184   6e-51    Cariama cristata
ref|XP_006263848.1|  PREDICTED: serine palmitoyltransferase 2           186   6e-51    
ref|XP_006184643.1|  PREDICTED: serine palmitoyltransferase 2           186   6e-51    
emb|CEI88574.1|  Putative Serine palmitoyltransferase                   185   6e-51    Rhizopus microsporus
gb|EOB05513.1|  Serine palmitoyltransferase 2                           185   7e-51    Anas platyrhynchos [duck]
ref|XP_010842693.1|  PREDICTED: serine palmitoyltransferase 2           184   7e-51    Bison bison bison
ref|XP_009937612.1|  PREDICTED: serine palmitoyltransferase 2           184   7e-51    Opisthocomus hoazin [hoatzin]
ref|XP_009973956.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    184   7e-51    Tyto alba [Schleiereule]
ref|XP_004359950.1|  serine C-palmitoyltransferase subunit              184   7e-51    Cavenderia fasciculata
ref|XP_010946223.1|  PREDICTED: serine palmitoyltransferase 2           186   7e-51    Camelus bactrianus [camel]
ref|XP_009472775.1|  PREDICTED: serine palmitoyltransferase 2           184   7e-51    Nipponia nippon
ref|XP_009475844.1|  PREDICTED: serine palmitoyltransferase 2           184   7e-51    Pelecanus crispus
ref|XP_006206208.1|  PREDICTED: serine palmitoyltransferase 2           186   7e-51    
ref|XP_009907650.1|  PREDICTED: serine palmitoyltransferase 2           184   7e-51    Picoides pubescens
ref|XP_005474018.1|  PREDICTED: serine palmitoyltransferase 3 iso...    186   7e-51    
ref|XP_006807001.1|  PREDICTED: serine palmitoyltransferase 3-lik...    185   7e-51    Neolamprologus brichardi [lyretail cichlid]
ref|XP_007986302.1|  PREDICTED: serine palmitoyltransferase 2           185   7e-51    Chlorocebus sabaeus
gb|EFX74435.1|  hypothetical protein DAPPUDRAFT_307317                  185   7e-51    Daphnia pulex
ref|XP_008534913.1|  PREDICTED: serine palmitoyltransferase 2           186   8e-51    Equus przewalskii [Przewalski horse]
ref|XP_005013979.1|  PREDICTED: serine palmitoyltransferase 2           184   8e-51    
ref|XP_004887616.1|  PREDICTED: serine palmitoyltransferase 2           185   8e-51    
ref|XP_009992209.1|  PREDICTED: serine palmitoyltransferase 2           184   8e-51    Chaetura pelagica
ref|XP_005390267.1|  PREDICTED: serine palmitoyltransferase 2 iso...    185   8e-51    
ref|XP_005812989.1|  PREDICTED: serine palmitoyltransferase 2-like      186   9e-51    
ref|XP_008117220.1|  PREDICTED: serine palmitoyltransferase 2           184   9e-51    Anolis carolinensis [Carolina anole]
gb|EPQ03912.1|  Serine palmitoyltransferase 2                           185   9e-51    Myotis brandtii
ref|XP_004837176.1|  PREDICTED: serine palmitoyltransferase 2           185   9e-51    Heterocephalus glaber [naked mole rat]
ref|XP_510095.3|  PREDICTED: serine palmitoyltransferase 2              185   1e-50    
ref|NP_004854.1|  serine palmitoyltransferase 2                         185   1e-50    Homo sapiens [man]
ref|XP_005561961.1|  PREDICTED: serine palmitoyltransferase 2 iso...    185   1e-50    
ref|XP_005561960.1|  PREDICTED: serine palmitoyltransferase 2 iso...    185   1e-50    Macaca fascicularis [crab eating macaque]
ref|XP_005321334.1|  PREDICTED: serine palmitoyltransferase 2           184   1e-50    Ictidomys tridecemlineatus
ref|XP_003808928.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    Pan paniscus [bonobo]
ref|XP_003260859.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001032174.1|  serine palmitoyltransferase 2                      185   1e-50    Rattus norvegicus [brown rat]
ref|XP_008503410.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    184   1e-50    Calypte anna
ref|XP_009210304.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    185   1e-50    
ref|XP_004649436.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    Jaculus jaculus
ref|XP_010710079.1|  PREDICTED: serine palmitoyltransferase 2           184   1e-50    Meleagris gallopavo [common turkey]
ref|XP_002719617.2|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010974728.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    185   1e-50    Camelus dromedarius [camel]
ref|XP_003787114.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    
ref|XP_005520283.1|  PREDICTED: serine palmitoyltransferase 2           184   1e-50    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010381027.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    
ref|XP_006087019.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    
ref|XP_008400962.1|  PREDICTED: serine palmitoyltransferase 2-like      185   1e-50    
gb|EDL81646.1|  protein-O-mannosyltransferase 2, isoform CRA_a          185   1e-50    
ref|XP_005860247.1|  PREDICTED: serine palmitoyltransferase 2           185   1e-50    
ref|XP_006807000.1|  PREDICTED: serine palmitoyltransferase 3-lik...    184   1e-50    
ref|XP_002754273.2|  PREDICTED: serine palmitoyltransferase 2           184   1e-50    
ref|XP_010582073.1|  PREDICTED: serine palmitoyltransferase 2           183   1e-50    
ref|NP_035609.1|  serine palmitoyltransferase 2                         184   1e-50    
ref|XP_007095366.1|  PREDICTED: serine palmitoyltransferase 2           184   1e-50    
ref|XP_010643886.1|  PREDICTED: serine palmitoyltransferase 2           183   1e-50    
gb|ELR47117.1|  Serine palmitoyltransferase 2                           184   2e-50    
ref|XP_009100102.1|  PREDICTED: serine palmitoyltransferase 2           183   2e-50    
ref|XP_008637852.1|  PREDICTED: serine palmitoyltransferase 2           183   2e-50    
ref|XP_002908237.1|  serine palmitoyltransferase, putative              182   2e-50    
ref|XP_005390266.1|  PREDICTED: serine palmitoyltransferase 2 iso...    184   2e-50    
ref|XP_005479814.1|  PREDICTED: serine palmitoyltransferase 2           183   2e-50    
gb|AFW88152.1|  hypothetical protein ZEAMMB73_846491                    179   2e-50    
ref|XP_002938915.1|  PREDICTED: serine palmitoyltransferase 2           184   2e-50    
ref|XP_005908476.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    184   2e-50    
ref|XP_010391694.1|  PREDICTED: serine palmitoyltransferase 2           183   2e-50    
ref|XP_005047542.1|  PREDICTED: serine palmitoyltransferase 2 iso...    183   2e-50    
dbj|BAA25452.2|  KIAA0526 protein                                       185   2e-50    
ref|NP_001006483.1|  serine palmitoyltransferase 2                      184   2e-50    
ref|XP_008701100.1|  PREDICTED: serine palmitoyltransferase 2           184   2e-50    
ref|XP_006925548.1|  PREDICTED: serine palmitoyltransferase 2           184   2e-50    
ref|XP_010186730.1|  PREDICTED: serine palmitoyltransferase 3-like      178   2e-50    
emb|CCI10352.1|  unnamed protein product                                182   2e-50    
ref|XP_011355387.1|  PREDICTED: serine palmitoyltransferase 2 iso...    184   2e-50    
ref|XP_003472501.1|  PREDICTED: serine palmitoyltransferase 2           184   3e-50    
ref|XP_008055245.1|  PREDICTED: serine palmitoyltransferase 2           184   3e-50    
ref|XP_004426463.1|  PREDICTED: serine palmitoyltransferase 2           184   3e-50    
ref|XP_005967637.1|  PREDICTED: serine palmitoyltransferase 2           183   3e-50    
ref|XP_009868294.1|  PREDICTED: serine palmitoyltransferase 2           182   3e-50    
gb|ERE72836.1|  serine palmitoyltransferase 2                           182   3e-50    
ref|XP_003987918.1|  PREDICTED: serine palmitoyltransferase 2           184   3e-50    
ref|XP_011355388.1|  PREDICTED: serine palmitoyltransferase 2 iso...    184   3e-50    
ref|XP_002926395.1|  PREDICTED: serine palmitoyltransferase 2           184   3e-50    
ref|XP_004681719.1|  PREDICTED: serine palmitoyltransferase 2           184   3e-50    
ref|XP_004399370.1|  PREDICTED: serine palmitoyltransferase 2           183   3e-50    
ref|XP_004739221.1|  PREDICTED: serine palmitoyltransferase 2           183   4e-50    
ref|XP_005656496.1|  PREDICTED: serine palmitoyltransferase 2           184   4e-50    
ref|XP_006052949.1|  PREDICTED: serine palmitoyltransferase 2           183   4e-50    
ref|NP_001092551.1|  serine palmitoyltransferase 2                      183   4e-50    
gb|ETP54405.1|  hypothetical protein F442_00863                         182   4e-50    
ref|XP_008890516.1|  hypothetical protein PPTG_00772                    182   4e-50    
ref|XP_007459840.1|  PREDICTED: serine palmitoyltransferase 2           183   4e-50    
ref|XP_008588506.1|  PREDICTED: serine palmitoyltransferase 2 iso...    182   4e-50    
gb|KFZ48660.1|  Serine palmitoyltransferase 3                           177   4e-50    
ref|XP_007531255.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    182   5e-50    
emb|CBN76133.1|  Serine palmitoyltransferase                            181   5e-50    
ref|XP_010865155.1|  PREDICTED: serine palmitoyltransferase 3           179   5e-50    
ref|XP_007939522.1|  PREDICTED: serine palmitoyltransferase 2           183   5e-50    
ref|XP_008890515.1|  hypothetical protein PPTG_00771                    182   5e-50    
ref|XP_008588501.1|  PREDICTED: serine palmitoyltransferase 2 iso...    182   5e-50    
ref|XP_008137006.1|  PREDICTED: serine palmitoyltransferase 2           183   6e-50    
ref|XP_003408845.1|  PREDICTED: serine palmitoyltransferase 2           183   6e-50    
ref|XP_007431401.1|  PREDICTED: serine palmitoyltransferase 2 iso...    180   6e-50    
ref|XP_005438817.1|  PREDICTED: serine palmitoyltransferase 2           182   6e-50    
ref|XP_004010868.1|  PREDICTED: serine palmitoyltransferase 2           182   7e-50    
ref|XP_004453603.1|  PREDICTED: serine palmitoyltransferase 2           182   7e-50    
ref|XP_002711016.1|  PREDICTED: serine palmitoyltransferase 3           182   7e-50    
ref|XP_005243943.1|  PREDICTED: serine palmitoyltransferase 2           181   7e-50    
ref|XP_006990382.1|  PREDICTED: serine palmitoyltransferase 2           182   8e-50    
ref|XP_005686244.1|  PREDICTED: serine palmitoyltransferase 2-like      183   9e-50    
ref|XP_002908238.1|  serine palmitoyltransferase, putative              181   9e-50    
gb|KIZ01369.1|  serine palmitoyltransferase                             182   1e-49    
ref|XP_004262337.1|  PREDICTED: serine palmitoyltransferase 2           182   1e-49    
ref|XP_008838153.1|  PREDICTED: serine palmitoyltransferase 2           182   1e-49    
ref|XP_004376519.1|  PREDICTED: serine palmitoyltransferase 3           182   1e-49    
emb|CEP14917.1|  hypothetical protein                                   182   1e-49    
ref|XP_005084054.1|  PREDICTED: serine palmitoyltransferase 2           182   1e-49    
ref|NP_001233609.1|  serine palmitoyltransferase 2                      182   1e-49    
ref|XP_010161310.1|  PREDICTED: serine palmitoyltransferase 3-like      174   1e-49    
ref|XP_010199542.1|  PREDICTED: serine palmitoyltransferase 3           175   1e-49    
ref|XP_004584633.1|  PREDICTED: serine palmitoyltransferase 2           182   1e-49    
gb|KFP31443.1|  Serine palmitoyltransferase 3                           175   2e-49    
ref|XP_009523452.1|  hypothetical protein PHYSODRAFT_559005             180   2e-49    
ref|XP_003411518.2|  PREDICTED: serine palmitoyltransferase 3           181   2e-49    
ref|XP_008940980.1|  PREDICTED: serine palmitoyltransferase 3-like      175   2e-49    
gb|ETM56090.1|  hypothetical protein L914_00839                         172   2e-49    
ref|XP_008588493.1|  PREDICTED: serine palmitoyltransferase 2 iso...    181   2e-49    
gb|KFQ19135.1|  Serine palmitoyltransferase 3                           175   2e-49    
ref|XP_004699112.1|  PREDICTED: serine palmitoyltransferase 2           182   2e-49    
ref|XP_001373999.2|  PREDICTED: serine palmitoyltransferase 2           181   2e-49    
ref|XP_006884832.1|  PREDICTED: serine palmitoyltransferase 2           182   2e-49    
ref|XP_001692248.1|  component of serine palmitoyltransferase           179   3e-49    
ref|XP_005995089.1|  PREDICTED: serine palmitoyltransferase 3 iso...    180   3e-49    
ref|XP_007184598.1|  PREDICTED: serine palmitoyltransferase 2           181   3e-49    
ref|XP_004624949.1|  PREDICTED: serine palmitoyltransferase 2           180   4e-49    
ref|XP_009579627.1|  PREDICTED: serine palmitoyltransferase 3-like      175   4e-49    
ref|XP_005995088.1|  PREDICTED: serine palmitoyltransferase 3 iso...    180   4e-49    
ref|XP_005343462.1|  PREDICTED: serine palmitoyltransferase 2           181   4e-49    
ref|XP_009809724.1|  PREDICTED: serine palmitoyltransferase 3-like      175   5e-49    
gb|KFV97396.1|  Serine palmitoyltransferase 3                           175   5e-49    
ref|XP_002155095.2|  PREDICTED: serine palmitoyltransferase 2-like      180   5e-49    
ref|XP_009511498.1|  PREDICTED: serine palmitoyltransferase 3-like      174   5e-49    
ref|XP_006894811.1|  PREDICTED: serine palmitoyltransferase 3           180   6e-49    
ref|XP_007431400.1|  PREDICTED: serine palmitoyltransferase 2 iso...    180   7e-49    
gb|EWM21787.1|  serine palmitoyltransferase                             181   7e-49    
ref|XP_009022446.1|  hypothetical protein HELRODRAFT_66644              179   8e-49    
ref|XP_005706634.1|  serine palmitoyltransferase                        180   9e-49    
ref|XP_003289939.1|  serine C-palmitoyltransferase subunit              178   9e-49    
ref|XP_006864826.1|  PREDICTED: serine palmitoyltransferase 2           179   1e-48    
gb|EIE85063.1|  hypothetical protein RO3G_09773                         179   1e-48    
gb|ESA21945.1|  hypothetical protein GLOINDRAFT_342892                  179   1e-48    
ref|XP_007068889.1|  PREDICTED: serine palmitoyltransferase 2           179   1e-48    
emb|CEI99151.1|  Putative Serine palmitoyltransferase                   172   1e-48    
ref|XP_004661509.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    179   2e-48    
ref|XP_537524.3|  PREDICTED: serine palmitoyltransferase 2              179   2e-48    
ref|XP_635115.1|  serine C-palmitoyltransferase subunit                 177   2e-48    
emb|CDS03531.1|  hypothetical protein LRAMOSA00933                      179   2e-48    
ref|XP_008763045.1|  PREDICTED: serine palmitoyltransferase 2 iso...    179   2e-48    
gb|KFH71158.1|  serine palmitoyltransferase                             178   2e-48    
ref|XP_006816918.1|  PREDICTED: serine palmitoyltransferase 2-like      179   2e-48    
ref|XP_004697882.1|  PREDICTED: serine palmitoyltransferase 3           178   2e-48    
ref|XP_006186834.1|  PREDICTED: serine palmitoyltransferase 3-like      171   3e-48    
ref|XP_004611033.1|  PREDICTED: serine palmitoyltransferase 3           178   3e-48    
ref|XP_002682326.1|  serine C-palmitoyltransferase                      177   4e-48    
ref|XP_004333725.1|  serine palmitoyltransferase, long chain base...    177   4e-48    
ref|XP_004371137.1|  PREDICTED: serine palmitoyltransferase 2           177   5e-48    
gb|KFH65713.1|  serine palmitoyltransferase                             177   5e-48    
ref|XP_009708146.1|  PREDICTED: serine palmitoyltransferase 3           176   5e-48    
emb|CDH48525.1|  serine palmitoyltransferase                            178   6e-48    
gb|KFP60479.1|  Serine palmitoyltransferase 3                           177   6e-48    
ref|XP_005301718.1|  PREDICTED: serine palmitoyltransferase 2 iso...    177   7e-48    
ref|XP_005160430.1|  PREDICTED: serine palmitoyltransferase 3 iso...    177   7e-48    
ref|XP_005634837.1|  PREDICTED: serine palmitoyltransferase 3 iso...    177   7e-48    
ref|XP_005301717.1|  PREDICTED: serine palmitoyltransferase 2 iso...    177   7e-48    
ref|XP_005147521.1|  PREDICTED: serine palmitoyltransferase 3           177   8e-48    
ref|XP_004475329.1|  PREDICTED: serine palmitoyltransferase 3           177   8e-48    
ref|XP_008303954.1|  PREDICTED: serine palmitoyltransferase 3           177   9e-48    
gb|ELK34571.1|  Serine palmitoyltransferase 3                           174   9e-48    
ref|XP_009932517.1|  PREDICTED: serine palmitoyltransferase 3           176   1e-47    
ref|XP_007165324.1|  PREDICTED: serine palmitoyltransferase 3           177   1e-47    
ref|XP_008562961.1|  PREDICTED: serine palmitoyltransferase 3           177   1e-47    
ref|XP_005525490.1|  PREDICTED: serine palmitoyltransferase 3           177   1e-47    
ref|XP_007546379.1|  PREDICTED: serine palmitoyltransferase 3           176   1e-47    
ref|XP_005488564.1|  PREDICTED: serine palmitoyltransferase 3           176   1e-47    
ref|XP_006116050.1|  PREDICTED: serine palmitoyltransferase 2           176   1e-47    
gb|ELU16750.1|  hypothetical protein CAPTEDRAFT_165279                  176   1e-47    
ref|NP_001003562.1|  serine palmitoyltransferase 3                      176   1e-47    
ref|XP_009911585.1|  PREDICTED: serine palmitoyltransferase 3           175   1e-47    
ref|XP_784261.1|  PREDICTED: serine palmitoyltransferase 2-like         176   1e-47    
ref|XP_007105166.1|  PREDICTED: serine palmitoyltransferase 3-like      176   1e-47    
ref|XP_007890493.1|  PREDICTED: serine palmitoyltransferase 3           176   1e-47    
gb|KFV72394.1|  Serine palmitoyltransferase 3                           176   1e-47    
ref|XP_009483184.1|  PREDICTED: serine palmitoyltransferase 3           175   1e-47    
emb|CDS13464.1|  hypothetical protein LRAMOSA05640                      177   2e-47    
ref|XP_005795269.1|  PREDICTED: serine palmitoyltransferase 3-like      176   2e-47    
ref|XP_010986859.1|  PREDICTED: serine palmitoyltransferase 3 iso...    173   2e-47    
gb|KFU91545.1|  Serine palmitoyltransferase 3                           176   2e-47    
ref|XP_008499119.1|  PREDICTED: serine palmitoyltransferase 3           175   2e-47    
ref|XP_009893730.1|  PREDICTED: serine palmitoyltransferase 3           175   2e-47    
gb|KFP99674.1|  Serine palmitoyltransferase 3                           176   2e-47    
gb|KFO29017.1|  Serine palmitoyltransferase 3                           175   2e-47    
ref|XP_006143721.1|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
ref|XP_010150842.1|  PREDICTED: serine palmitoyltransferase 3           175   2e-47    
ref|XP_542889.2|  PREDICTED: serine palmitoyltransferase 3 isofor...    176   2e-47    
gb|KFZ66955.1|  Serine palmitoyltransferase 2                           170   2e-47    
gb|KFP06332.1|  Serine palmitoyltransferase 3                           175   2e-47    
ref|XP_004634397.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    176   2e-47    
ref|XP_005238658.1|  PREDICTED: serine palmitoyltransferase 3           175   2e-47    
ref|XP_005974698.1|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
ref|XP_005604533.1|  PREDICTED: serine palmitoyltransferase 3 iso...    174   2e-47    
ref|XP_010118931.1|  PREDICTED: serine palmitoyltransferase 3           175   2e-47    
ref|XP_005380940.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    176   2e-47    
ref|XP_009952463.1|  PREDICTED: serine palmitoyltransferase 3           175   2e-47    
ref|XP_011368579.1|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
ref|XP_009905195.1|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
gb|KFV97820.1|  Serine palmitoyltransferase 3                           175   2e-47    
gb|KFQ62240.1|  Serine palmitoyltransferase 3                           175   2e-47    
ref|XP_005428099.1|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
ref|XP_002197576.2|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
gb|KGL88305.1|  Serine palmitoyltransferase 3                           175   2e-47    
ref|XP_009998479.1|  PREDICTED: serine palmitoyltransferase 3           176   2e-47    
emb|CDH52203.1|  serine palmitoyltransferase                            176   3e-47    
ref|XP_007064226.1|  PREDICTED: serine palmitoyltransferase 3           175   3e-47    
gb|KFP41872.1|  Serine palmitoyltransferase 2                           169   3e-47    
ref|XP_010632397.1|  PREDICTED: serine palmitoyltransferase 3           175   3e-47    
ref|XP_009280805.1|  PREDICTED: serine palmitoyltransferase 3           174   3e-47    
dbj|GAN08133.1|  serine palmitoyltransferase 2                          175   3e-47    
ref|XP_005687874.1|  PREDICTED: serine palmitoyltransferase 3           175   3e-47    
gb|KFQ13427.1|  Serine palmitoyltransferase 3                           175   3e-47    
gb|EPB87588.1|  serine palmitoyltransferase                             175   3e-47    
gb|KFQ10729.1|  Serine palmitoyltransferase 2                           171   3e-47    
dbj|GAN03028.1|  serine palmitoyltransferase protein                    176   3e-47    
ref|XP_007526137.1|  PREDICTED: serine palmitoyltransferase 3           175   3e-47    
ref|XP_005320528.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
ref|XP_004276523.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
gb|EPB82229.1|  serine palmitoyltransferase                             176   4e-47    
gb|KFW89092.1|  Serine palmitoyltransferase 3                           174   4e-47    
ref|XP_009317836.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
ref|XP_006921647.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
ref|XP_004014209.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
ref|XP_005761998.1|  serine palmitoyltransferase                        179   4e-47    
emb|CEG83685.1|  Putative Aminotransferase class I/classII              172   4e-47    
ref|XP_003788058.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
ref|XP_010284205.1|  PREDICTED: serine palmitoyltransferase 3           175   4e-47    
ref|XP_008428429.1|  PREDICTED: serine palmitoyltransferase 3           175   5e-47    
ref|XP_004433805.1|  PREDICTED: serine palmitoyltransferase 3           175   5e-47    
gb|AID57147.1|  serine palmitoyltransferase 1                           179   6e-47    
emb|CEG83281.1|  Putative Aminotransferase class I/classII              172   6e-47    
ref|XP_006114764.1|  PREDICTED: serine palmitoyltransferase 3-like      172   6e-47    
ref|XP_005604532.1|  PREDICTED: serine palmitoyltransferase 3 iso...    174   7e-47    
gb|ERE72837.1|  serine palmitoyltransferase 2                           174   7e-47    
ref|XP_008931233.1|  PREDICTED: serine palmitoyltransferase 3           174   7e-47    
ref|XP_004876895.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    174   7e-47    
emb|CCW64767.1|  unnamed protein product                                174   7e-47    
ref|XP_010307007.1|  PREDICTED: serine palmitoyltransferase 3           173   8e-47    
ref|XP_001492553.1|  PREDICTED: serine palmitoyltransferase 3 iso...    174   8e-47    
gb|EOB01188.1|  Serine palmitoyltransferase 3                           174   9e-47    
ref|XP_004754268.1|  PREDICTED: serine palmitoyltransferase 3           174   9e-47    
emb|CEP10201.1|  hypothetical protein                                   176   9e-47    
gb|KFR10371.1|  Serine palmitoyltransferase 3                           173   9e-47    
ref|XP_007450261.1|  PREDICTED: serine palmitoyltransferase 3           174   9e-47    
ref|XP_004416213.1|  PREDICTED: serine palmitoyltransferase 3           174   1e-46    
ref|XP_001635053.1|  predicted protein                                  174   1e-46    
gb|KFO13972.1|  Serine palmitoyltransferase 3                           173   1e-46    
ref|XP_008139320.1|  PREDICTED: serine palmitoyltransferase 3           174   1e-46    
ref|XP_006036854.1|  PREDICTED: serine palmitoyltransferase 3           174   1e-46    



>ref|XP_009761445.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
sylvestris]
Length=489

 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI++LKYTCPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEFLKYTCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV V FPATPLLLARARICISAAH+REDL KALEVISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVIVGFPATPLLLARARICISAAHSREDLNKALEVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQLEENR+KLE
Sbjct  477  KKQQLEENRVKLE  489



>dbj|BAE96963.1| serine palmitpoyltransferase subunit2 [Nicotiana tabacum]
 gb|ABW97709.1| serine palmitoyltransferase long chain base subunit [Nicotiana 
benthamiana]
Length=489

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI++LKYTCPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEFLKYTCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV V FPATPLLLARARICISAAH+REDL KALEVISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVIVGFPATPLLLARARICISAAHSREDLNKALEVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQLEENR+KLE
Sbjct  477  KKQQLEENRVKLE  489



>ref|XP_009611514.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
tomentosiformis]
Length=489

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI++LKYTCPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEFLKYTCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV V FPATPLLLARARICISAAH+REDL KALEVISRVGD+VGIKYFPAEP
Sbjct  417  ECLKQNVAVVIVGFPATPLLLARARICISAAHSREDLNKALEVISRVGDVVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQLEENR+KLE
Sbjct  477  KKQQLEENRVKLE  489



>ref|XP_002284409.1| PREDICTED: long chain base biosynthesis protein 2a [Vitis vinifera]
Length=489

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDLIK LEVISRVGDLV IKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKGLEVISRVGDLVAIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +KQQLEE R+KLE
Sbjct  477  RKQQLEEGRVKLE  489



>dbj|BAG68298.1| serine palmitoyltransferase [Nicotiana benthamiana]
Length=489

 Score =   350 bits (899),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI++LK+TCPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEFLKHTCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV V FPATPLLLARARICISAAH+REDL KALEVISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVIVGFPATPLLLARARICISAAHSREDLNKALEVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQLEENR+KLE
Sbjct  477  KKQQLEENRVKLE  489



>emb|CBI15735.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   351 bits (901),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  321  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  380

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  381  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  440

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDLIK LEVISRVGDLV IKYFPAEP
Sbjct  441  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKGLEVISRVGDLVAIKYFPAEP  500

Query  220  KKQQLEENRLKLE  182
            +KQQLEE R+KLE
Sbjct  501  RKQQLEEGRVKLE  513



>ref|XP_011083372.1| PREDICTED: long chain base biosynthesis protein 2a [Sesamum indicum]
Length=489

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLAKIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVVTVAFPATPLLLARARICISAAHTREDL+KALEVIS VGDLVGIKYFPAEP
Sbjct  417  ECLRRNVAVVTVAFPATPLLLARARICISAAHTREDLVKALEVISSVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQLE  R+KLE
Sbjct  477  KKQQLEGERVKLE  489



>ref|XP_010249161.1| PREDICTED: long chain base biosynthesis protein 2a [Nelumbo nucifera]
Length=489

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSP+MPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPIMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTVAFPATPLLLARARICISAAHT+EDLIKALEVIS+VGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAIVTVAFPATPLLLARARICISAAHTKEDLIKALEVISQVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQ E+ RLKL+
Sbjct  477  KKQQEEDGRLKLD  489



>ref|XP_006446964.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 ref|XP_006468873.1| PREDICTED: long chain base biosynthesis protein 2a-like [Citrus 
sinensis]
 gb|ESR60204.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 gb|KDO47368.1| hypothetical protein CISIN_1g046230mg [Citrus sinensis]
Length=489

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/193 (94%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAA+QIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+HT+EDLIKALEVISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +KQ  EE R+KLE
Sbjct  477  RKQMEEEERMKLE  489



>gb|EYU24476.1| hypothetical protein MIMGU_mgv1a004686mg [Erythranthe guttata]
Length=515

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 190/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+DVDIMMGTFTKS GSCGGYIAGS+ELIQ+LKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  323  VDTSDVDIMMGTFTKSFGSCGGYIAGSQELIQFLKYTCPAHLYATSISPPAAQQIISSIK  382

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGSSRGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  383  VLLGEDGSSRGAQKLAKIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  442

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++NVAVVTVAFPATPLLLARARICISAAH+REDL+KALEVIS VGDLVGIKYFPAEP
Sbjct  443  ECLKRNVAVVTVAFPATPLLLARARICISAAHSREDLVKALEVISTVGDLVGIKYFPAEP  502

Query  220  KKQQLEENRLKLE  182
            KKQQLE +R+KLE
Sbjct  503  KKQQLEGDRVKLE  515



>ref|XP_008231042.1| PREDICTED: long chain base biosynthesis protein 2a-like [Prunus 
mume]
Length=489

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGS+ELIQYLKYTCPAHLYATSISPPAA+QIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSEELIQYLKYTCPAHLYATSISPPAAEQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDL+KALEV  RVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLLKALEVFGRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK Q EE  LKLE
Sbjct  477  KKLQEEERLLKLE  489



>ref|XP_004235384.1| PREDICTED: long chain base biosynthesis protein 2b [Solanum lycopersicum]
Length=489

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKY+CPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEYLKYSCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP+KIPAFSR
Sbjct  357  VILGEDGTSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+ NVAVV V FPATPLLLARARICISAAH+REDL KALEV S VGDL GIKYFPAEP
Sbjct  417  ECLKHNVAVVIVGFPATPLLLARARICISAAHSREDLNKALEVFSEVGDLTGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +KQQ+EENR+KLE
Sbjct  477  QKQQVEENRVKLE  489



>ref|XP_008341247.1| PREDICTED: long chain base biosynthesis protein 2a [Malus domestica]
Length=490

 Score =   340 bits (872),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/190 (93%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQII AIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VLLGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDLIKALEV  RVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKALEVFGRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRL  191
            KK Q EE RL
Sbjct  477  KKAQAEEERL  486



>ref|XP_006364387.1| PREDICTED: long chain base biosynthesis protein 2b-like [Solanum 
tuberosum]
Length=489

 Score =   340 bits (872),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKY+CPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEYLKYSCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP KIPAFSR
Sbjct  357  VILGEDGTSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPGKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++NVAVV V FPATPLLLARARICISAAH+REDL  ALEVIS+VGDL GIKYFPAEP
Sbjct  417  ECLKRNVAVVIVGFPATPLLLARARICISAAHSREDLNIALEVISKVGDLTGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +KQQ+EENR+KLE
Sbjct  477  QKQQVEENRVKLE  489



>ref|XP_008379061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Malus 
domestica]
Length=490

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/190 (93%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+TADVDIMMGTFTKS GSCGGYI+GSKELIQYLKYTCPAHLYATSISPPAAQQII AIK
Sbjct  297  VNTADVDIMMGTFTKSFGSCGGYISGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VLLGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDLIKALEVI RVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKALEVIGRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRL  191
            KK Q EE RL
Sbjct  477  KKAQAEEERL  486



>emb|CDO98665.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDI+MGTFTKS GSCGGYIAGSKELIQY+KYTCPAHLYATSISPPAAQQIISAI+
Sbjct  297  VDTADVDILMGTFTKSFGSCGGYIAGSKELIQYMKYTCPAHLYATSISPPAAQQIISAIR  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMP+MLYNP+KIPAFSR
Sbjct  357  VILGEDGTSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPVMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+  VAVVTVAFPATPLLLARARICISA+HTREDLIKALEV S+VGDL+GIKYFPAEP
Sbjct  417  ECLKNQVAVVTVAFPATPLLLARARICISASHTREDLIKALEVFSKVGDLIGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             KQQ +E R+KLE
Sbjct  477  DKQQQDEGRVKLE  489



>ref|XP_010678318.1| PREDICTED: long chain base biosynthesis protein 2a [Beta vulgaris 
subsp. vulgaris]
Length=489

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLY TSISPPAAQQI+SAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYGTSISPPAAQQIMSAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR
Sbjct  357  VLLGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVV V FPATPLLLARARICISA+HTREDL++ALEVIS VGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVVVGFPATPLLLARARICISASHTREDLVRALEVISNVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +K+  E   +KL+
Sbjct  477  RKEHRENGMVKLD  489



>ref|XP_007209963.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
 gb|EMJ11162.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
Length=487

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 187/193 (97%), Gaps = 2/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKE+IQYLKYTCPAHLYATS+SPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKEVIQYLKYTCPAHLYATSVSPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGTSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL++ALEVISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLRALEVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             KQ  E N +KLE
Sbjct  477  SKQ--ETNAIKLE  487



>ref|XP_011042943.1| PREDICTED: long chain base biosynthesis protein 2a [Populus euphratica]
Length=489

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS+VGDLVGIKYFPAE 
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLKALEVISQVGDLVGIKYFPAES  476

Query  220  KKQQLEENRLKLE  182
             KQ  E   LKLE
Sbjct  477  DKQHQEPGALKLE  489



>ref|XP_009378026.1| PREDICTED: long chain base biosynthesis protein 2a [Pyrus x bretschneideri]
Length=490

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQII AIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VLLGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDLIKALEV  RVGDLVGIKYFPA+P
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKALEVFGRVGDLVGIKYFPAQP  476

Query  220  KKQQLEENRL  191
            KK + EE RL
Sbjct  477  KKAEAEEERL  486



>ref|XP_007031988.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY02914.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=454

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  263  VDPADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  322

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILG+DGS+RGA+KLA+IRENSNFFRSEL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  323  VILGQDGSNRGAQKLAQIRENSNFFRSELIKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  382

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDLIKALEVISRVGDLVGIKYFPAEP
Sbjct  383  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEP  442

Query  220  KKQQLEENRLKLE  182
            +KQQ EE R+KLE
Sbjct  443  EKQQQEE-RMKLE  454



>ref|XP_011073130.1| PREDICTED: long chain base biosynthesis protein 2b isoform X3 
[Sesamum indicum]
Length=489

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGSKELI+YLK+ CPAHLYATSISPPAAQQI+S+IK
Sbjct  297  VDTADIDIMMGTFTKSFGSCGGYIAGSKELIEYLKHNCPAHLYATSISPPAAQQIMSSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++NVAVVTVAFPATPLLLARARICISAAHTREDL KALEVISRVGD+VG+KYFPAEP
Sbjct  417  ECLKRNVAVVTVAFPATPLLLARARICISAAHTREDLTKALEVISRVGDMVGVKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQLE   +K++
Sbjct  477  KKQQLEGEGIKMD  489



>ref|XP_007038096.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY22597.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=489

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLY TSISPPAA+QIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYTTSISPPAARQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QN+AVVTVAFPATPLLLARARICISAAHT+EDL+KALEVIS VGD+VGIKYFPAEP
Sbjct  417  ECLKQNIAVVTVAFPATPLLLARARICISAAHTKEDLLKALEVISEVGDMVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  ++ +KLE
Sbjct  477  KKLEQGKDTIKLE  489



>ref|XP_006347368.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006347369.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Solanum tuberosum]
Length=489

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADV+IMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVEIMMGTFTKSFGSCGGYIAGSKELIEYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILG DGSSRGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGVDGSSRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++ VAVVTVAFPATPLLLARARICISAAH+R+DLIKALEVIS VGDLVGIKYFPAEP
Sbjct  417  ECLKRKVAVVTVAFPATPLLLARARICISAAHSRDDLIKALEVISEVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K+QLE NR+KLE
Sbjct  477  NKEQLEANRVKLE  489



>ref|XP_004241473.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=489

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADV+IMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+I 
Sbjct  297  VDTADVEIMMGTFTKSFGSCGGYIAGSKELIEYLKYTCPAHLYATSISPPAAQQIISSIN  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++ VAVVTVAFPATPLLLARARICISAAH+R+DLIKALEVIS VGDLVGIKYFP EP
Sbjct  417  ECLKRKVAVVTVAFPATPLLLARARICISAAHSRDDLIKALEVISEVGDLVGIKYFPVEP  476

Query  220  KKQQLEENRLKLE  182
             K+QLE NR+KLE
Sbjct  477  NKEQLEANRVKLE  489



>ref|XP_002318160.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEE96380.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKY CPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYNCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS+VGDLVGIKYFPAE 
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLKALEVISQVGDLVGIKYFPAES  476

Query  220  KKQQLEENRLKLE  182
             KQ  E   LKLE
Sbjct  477  DKQHQEPGALKLE  489



>ref|XP_007031987.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY02913.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=489

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  298  VDPADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILG+DGS+RGA+KLA+IRENSNFFRSEL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  358  VILGQDGSNRGAQKLAQIRENSNFFRSELIKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDLIKALEVISRVGDLVGIKYFPAEP
Sbjct  418  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISRVGDLVGIKYFPAEP  477

Query  220  KKQQLEENRLKLE  182
            +KQQ EE R+KLE
Sbjct  478  EKQQQEE-RMKLE  489



>ref|XP_010096046.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB62852.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=508

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  316  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  375

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG++RGA+KL RIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  376  VILGEDGTNRGAQKLLRIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  435

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL++ALEVISRVGDLVGIKYFPAEP
Sbjct  436  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLVQALEVISRVGDLVGIKYFPAEP  495

Query  220  KKQQLEENRLKLE  182
             KQ+ +E+  KL+
Sbjct  496  NKQEQDESLKKLD  508



>emb|CAB44316.1| serine palmitoyltransferase [Solanum tuberosum]
Length=489

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKY+CPAHLYATSISPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIEYLKYSCPAHLYATSISPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIM+YNP KIPAFSR
Sbjct  357  VILGEDGTSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMIYNPGKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+++VAVV V FPATPLLLARARICISAAH+REDL  ALEVIS+VGDL GIKYFPAEP
Sbjct  417  ECLKRSVAVVIVGFPATPLLLARARICISAAHSREDLNIALEVISKVGDLTGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +KQQ+EE+R+KLE
Sbjct  477  QKQQVEESRVKLE  489



>dbj|BAF01511.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
Length=246

 Score =   325 bits (834),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+DVDIMMGTFTKS GSCGGYIAGSK+LIQYLK+ CPAHLYATSIS P+A QIISAIK
Sbjct  54   VDTSDVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKHQCPAHLYATSISTPSATQIISAIK  113

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  114  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  173

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+AVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  174  ECLRENLAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  233

Query  220  KKQQLEENRLKLE  182
            KKQ++E+N +KL+
Sbjct  234  KKQEVEKNGIKLD  246



>gb|KDP41837.1| hypothetical protein JCGZ_26855 [Jatropha curcas]
Length=489

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAA+QIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELIKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+HT+EDLIKALEVIS+VGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISQVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K + +   +KL+
Sbjct  477  NKHEEDNKMVKLD  489



>dbj|BAC55228.1| serine palmitoyltransferase [Lotus japonicus]
Length=489

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGS+ELIQYLKYTCPAHLYATS+SPPAAQQIIS+IK
Sbjct  297  VDTADIDIMMGTFTKSFGSCGGYIAGSQELIQYLKYTCPAHLYATSVSPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLAKIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+H+REDL+ AL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHSREDLVTALQVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             KQQ E   +K +
Sbjct  477  SKQQQEGKTVKYD  489



>ref|XP_008464380.1| PREDICTED: long chain base biosynthesis protein 2a [Cucumis melo]
Length=490

 Score =   332 bits (852),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL QNVAVVTVAFPATPLLLARARICISA+HT++DL+KALEVISRVGDLVGIKYFPAE 
Sbjct  417  ECLNQNVAVVTVAFPATPLLLARARICISASHTKDDLLKALEVISRVGDLVGIKYFPAEA  476

Query  220  KKQQLEEN  197
            +KQQ E +
Sbjct  477  QKQQSEND  484



>ref|XP_007215280.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
 gb|EMJ16479.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
Length=488

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GS GGYIAGS ELIQYLKYTCPAHLYATSISPPAA+QIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSSGGYIAGS-ELIQYLKYTCPAHLYATSISPPAAEQIISAIK  355

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  356  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  415

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDL+KALEV  RVGDLVGIKYFPAEP
Sbjct  416  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLLKALEVFGRVGDLVGIKYFPAEP  475

Query  220  KKQQLEENRLKLE  182
            KK Q EE  LKLE
Sbjct  476  KKLQEEERLLKLE  488



>gb|KEH25646.1| long chain base biosynthesis 2a-like protein [Medicago truncatula]
Length=490

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADIDIMMGTFTKSFGSCGGYIAGSKELIEYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLAKIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+H+REDL KAL+VIS VGDL+GIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHSREDLTKALQVISSVGDLIGIKYFPAEP  476

Query  220  KKQQLEENR  194
             KQQ ++ +
Sbjct  477  TKQQQQDGK  485



>gb|KHN13380.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=490

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQ+LKYTCPAHLYATSISPPAAQQIIS+I+
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQHLKYTCPAHLYATSISPPAAQQIISSIR  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTVAFPATPLLLARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAIVTVAFPATPLLLARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENR  194
             KQQ E  +
Sbjct  477  TKQQQEGGK  485



>ref|XP_003548027.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=490

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQ+LKYTCPAHLYATSISPPAAQQIIS+I+
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQHLKYTCPAHLYATSISPPAAQQIISSIR  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTVAFPATPLLLARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAIVTVAFPATPLLLARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENR  194
             KQQ E  +
Sbjct  477  TKQQQEGGK  485



>ref|XP_009150176.1| PREDICTED: long chain base biosynthesis protein 2b [Brassica 
rapa]
 emb|CDY37911.1| BnaA06g19060D [Brassica napus]
Length=489

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALKVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+ E++R+KL+
Sbjct  477  KKQEEEKDRIKLD  489



>ref|XP_004161364.1| PREDICTED: LOW QUALITY PROTEIN: long chain base biosynthesis 
protein 2a-like [Cucumis sativus]
Length=490

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL QNVAVVTVAFPATPLLLARARICISA+HT++DL+KALEVISRVGDLVGIKYFPAE 
Sbjct  417  ECLNQNVAVVTVAFPATPLLLARARICISASHTKDDLLKALEVISRVGDLVGIKYFPAEA  476

Query  220  KKQQLEEN  197
            +KQ  E +
Sbjct  477  QKQHSEND  484



>ref|XP_004138028.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cucumis 
sativus]
 gb|KGN63448.1| hypothetical protein Csa_1G000720 [Cucumis sativus]
Length=490

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL QNVAVVTVAFPATPLLLARARICISA+HT++DL+KALEVISRVGDLVGIKYFPAE 
Sbjct  417  ECLNQNVAVVTVAFPATPLLLARARICISASHTKDDLLKALEVISRVGDLVGIKYFPAEA  476

Query  220  KKQQLEEN  197
            +KQ  E +
Sbjct  477  QKQHSEND  484



>ref|XP_004304557.1| PREDICTED: long chain base biosynthesis protein 2a [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLK+TCPAHLYATSISPPAA+QIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKHTCPAHLYATSISPPAAEQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VLLGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDL KAL+VI RVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLQKALDVIGRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +K Q +E  LKL+
Sbjct  477  EKLQEDERVLKLD  489



>ref|XP_006404217.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
 gb|ESQ45670.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
Length=489

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+ E+N +KL+
Sbjct  477  KKQEQEKNSIKLD  489



>dbj|BAH19645.1| AT5G23670 [Arabidopsis thaliana]
Length=242

 Score =   322 bits (824),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  50   VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  109

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  110  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  169

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  170  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  229

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  230  KKIEQSKNDIKLD  242



>gb|KJB51269.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=478

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  279  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  338

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSP+MPIMLYNP+KIPAFSR
Sbjct  339  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPIMPIMLYNPAKIPAFSR  398

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS+VGD+VGIKYFPAEP
Sbjct  399  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLKALEVISQVGDMVGIKYFPAEP  458

Query  220  KK  215
             K
Sbjct  459  NK  460



>ref|XP_010907607.1| PREDICTED: long chain base biosynthesis protein 2a [Elaeis guineensis]
Length=487

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+HTREDLIK LEVIS+VGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHTREDLIKGLEVISKVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E++R KLE
Sbjct  477  PKH--EQDRKKLE  487



>gb|KHG30176.1| Serine palmitoyltransferase 2 [Gossypium arboreum]
Length=496

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKEL+QYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELVQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS+VGD+VGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLKALEVISQVGDMVGIKYFPAEP  476

Query  220  KK  215
             K
Sbjct  477  NK  478



>ref|XP_003518128.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=489

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQ+LKY CPAHLYATSISPPAAQQIIS+I+
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQHLKYACPAHLYATSISPPAAQQIISSIR  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             KQQ     +K +
Sbjct  477  TKQQQGGKSVKFD  489



>emb|CDX87007.1| BnaC03g52770D [Brassica napus]
Length=489

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALKVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+ E++R+KL+
Sbjct  477  KKQEEEKDRIKLD  489



>gb|KJB51268.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=496

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSP+MPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPIMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS+VGD+VGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLKALEVISQVGDMVGIKYFPAEP  476

Query  220  KK  215
             K
Sbjct  477  NK  478



>gb|KHN00617.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=505

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQ+LKY CPAHLYATSISPPAAQQIIS+I+
Sbjct  313  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQHLKYACPAHLYATSISPPAAQQIISSIR  372

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  373  VILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  432

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISAAH+REDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  433  ECLKQNVAVVTVAFPATPLLLARARICISAAHSREDLIKALQVISRVGDLVGIKYFPAEP  492

Query  220  KKQQLEENRLKLE  182
             KQQ     +K +
Sbjct  493  TKQQQGGKSVKFD  505



>ref|XP_008791061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=487

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+HTR+DLIK LEVIS+VGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHTRDDLIKGLEVISKVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E++R KLE
Sbjct  477  PKH--EQDRKKLE  487



>gb|ABW97708.1| serine palmitoyltransferase long chain base subunit [Brassica 
rapa subsp. chinensis]
Length=489

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALKVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+ E++ +KL+
Sbjct  477  KKQEEEKDGIKLD  489



>ref|XP_006290987.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
 gb|EOA23885.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
Length=489

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+AVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENLAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ  ++N +KL+
Sbjct  477  KKQDQDKNGIKLD  489



>ref|XP_010929641.1| PREDICTED: long chain base biosynthesis protein 2a-like [Elaeis 
guineensis]
Length=487

 Score =   327 bits (839),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVA+VTVAFPATPLLLARARICISA+HTREDLIK LEVIS+VGDLVGIKYFP EP
Sbjct  417  ECLRQNVAIVTVAFPATPLLLARARICISASHTREDLIKGLEVISKVGDLVGIKYFPVEP  476

Query  220  KKQQLEENRLK  188
             K + ++ +L+
Sbjct  477  PKHEQDQKKLE  487



>ref|XP_010036863.1| PREDICTED: long chain base biosynthesis protein 2a [Eucalyptus 
grandis]
 gb|KCW48524.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=489

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGY+AGSKELIQYLK TCPAHLYATSISPPAAQQI+SAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYVAGSKELIQYLKNTCPAHLYATSISPPAAQQILSAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNF RSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFCRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+ NVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS VGDLVGIKYFPAEP
Sbjct  417  ECLKHNVAVVTVAFPATPLLLARARICISASHTKEDLVKALEVISSVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLK  188
             K Q EE  +K
Sbjct  477  NKLQKEEGMIK  487



>ref|XP_008775142.1| PREDICTED: long chain base biosynthesis protein 2a [Phoenix dactylifera]
Length=487

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 2/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +ILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  IILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKYFPAEP
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E++R KLE
Sbjct  477  PK--YEQDRKKLE  487



>ref|XP_007151745.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
 gb|ESW23739.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
Length=487

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKEL+ YLK+ CPAHLYATSISPPAAQQIIS+I+
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELVHYLKHACPAHLYATSISPPAAQQIISSIR  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVVTVAFPATPLLLARARICISA+H+REDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHSREDLIKALQVISRVGDLVGIKYFPAEP  476

Query  220  KKQQ  209
             KQQ
Sbjct  477  AKQQ  480



>ref|NP_190447.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
 sp|Q9M304.1|LCB2B_ARATH RecName: Full=Long chain base biosynthesis protein 2b; Short=AtLCB2b; 
AltName: Full=Serine palmitoyltransferase 1; Short=AtSPT1 
[Arabidopsis thaliana]
 emb|CAB87906.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAK96680.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL24364.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 dbj|BAB78461.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM47981.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAP31959.1| At3g48780 [Arabidopsis thaliana]
 gb|AEE78455.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
Length=489

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+DVDIMMGTFTKS GSCGGYIAGSK+LIQYLK+ CPAHLYATSIS P+A QIISAIK
Sbjct  297  VDTSDVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKHQCPAHLYATSISTPSATQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+AVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENLAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ++E+N +KL+
Sbjct  477  KKQEVEKNGIKLD  489



>ref|XP_009151545.1| PREDICTED: long chain base biosynthesis protein 2b-like [Brassica 
rapa]
Length=489

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+  ++ +KL+
Sbjct  477  KKQEEVKDTIKLD  489



>ref|XP_010660694.1| PREDICTED: long chain base biosynthesis protein 2a isoform X1 
[Vitis vinifera]
Length=490

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDI+MGTFTKS GSCGGYIAGSKELIQYLK+T PAHLYATS+SPPA QQIISAIK
Sbjct  298  VDPADVDILMGTFTKSFGSCGGYIAGSKELIQYLKHTSPAHLYATSMSPPAVQQIISAIK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS RGA+KLA+IRENSNFFRSELQ MGFEVLGDNDSPVMPIMLYNP KIPAFSR
Sbjct  358  VILGEDGSCRGAQKLAQIRENSNFFRSELQSMGFEVLGDNDSPVMPIMLYNPGKIPAFSR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV  AFPATPLLLARARICISA+HT+EDLIK LEVISRVGDLVGIKYFPA+P
Sbjct  418  ECLKQNVAVVMSAFPATPLLLARARICISASHTKEDLIKGLEVISRVGDLVGIKYFPAQP  477

Query  220  KKQQLEENRLKLE  182
            K+QQ EE   KL+
Sbjct  478  KEQQQEEKTSKLD  490



>emb|CDX68498.1| BnaC01g25760D [Brassica napus]
Length=489

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISA+K
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYQCPAHLYATSISTPSAQQIISAVK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+  ++ +KL+
Sbjct  477  KKQEEVKDTIKLD  489



>ref|XP_002275468.1| PREDICTED: long chain base biosynthesis protein 2a isoform X2 
[Vitis vinifera]
 emb|CBI21293.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDI+MGTFTKS GSCGGYIAGSKELIQYLK+T PAHLYATS+SPPA QQIISAIK
Sbjct  297  VDPADVDILMGTFTKSFGSCGGYIAGSKELIQYLKHTSPAHLYATSMSPPAVQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS RGA+KLA+IRENSNFFRSELQ MGFEVLGDNDSPVMPIMLYNP KIPAFSR
Sbjct  357  VILGEDGSCRGAQKLAQIRENSNFFRSELQSMGFEVLGDNDSPVMPIMLYNPGKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV  AFPATPLLLARARICISA+HT+EDLIK LEVISRVGDLVGIKYFPA+P
Sbjct  417  ECLKQNVAVVMSAFPATPLLLARARICISASHTKEDLIKGLEVISRVGDLVGIKYFPAQP  476

Query  220  KKQQLEENRLKLE  182
            K+QQ EE   KL+
Sbjct  477  KEQQQEEKTSKLD  489



>ref|XP_002875925.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52184.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLK+ CPAHLYATSIS P+A QIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKHQCPAHLYATSISTPSATQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+ +AVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLREKLAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ++E+N +KL+
Sbjct  477  KKQEVEKNGIKLD  489



>ref|XP_010515202.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
 ref|XP_010426376.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
Length=489

 Score =   324 bits (831),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGSK+LIQYLK+ CPAHLYATSIS P+AQQIISAI+
Sbjct  297  VDTADIDIMMGTFTKSFGSCGGYIAGSKDLIQYLKHHCPAHLYATSISTPSAQQIISAIQ  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+AVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENLAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ  E+N +KL+
Sbjct  477  KKQDEEKNGIKLD  489



>gb|KFK34178.1| hypothetical protein AALP_AA5G110700 [Arabis alpina]
Length=489

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMG EVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGLEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDL+KAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLVKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+ E++ +KL+
Sbjct  477  KKQEEEKDGIKLD  489



>emb|CDX83048.1| BnaA01g20480D [Brassica napus]
Length=489

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS P+AQQIISAI 
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPSAQQIISAIT  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENVAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ+  ++ +KL+
Sbjct  477  KKQEEVKDTIKLD  489



>ref|XP_009421040.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=488

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 181/189 (96%), Gaps = 1/189 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIA SKE+IQ+LKYTCPAHLYATSISPPA QQ+ISAIK
Sbjct  299  VDTADVDIMMGTFTKSFGSCGGYIAASKEIIQFLKYTCPAHLYATSISPPAVQQVISAIK  358

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  359  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  418

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAE-  224
            ECLRQNVAVVTVAFPATPLLLARARICISA+H+REDL+K LEVIS+VGDLVGIKYFPAE 
Sbjct  419  ECLRQNVAVVTVAFPATPLLLARARICISASHSREDLVKGLEVISKVGDLVGIKYFPAES  478

Query  223  PKKQQLEEN  197
            PK  + ++N
Sbjct  479  PKLAEQKKN  487



>ref|XP_009403784.1| PREDICTED: long chain base biosynthesis protein 2a [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  299  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIK  358

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  359  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  418

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+H++EDL+K LEVIS+VGDLVGIKYFPAEP
Sbjct  419  ECLRQNVAVVTVAFPATPLLLARARICISASHSKEDLMKGLEVISKVGDLVGIKYFPAEP  478

Query  220  KKQQLEENR  194
             K   +E +
Sbjct  479  PKHAEQEKK  487



>ref|XP_006287613.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
 gb|EOA20511.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
Length=489

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIKALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQTKNDIKLD  489



>ref|XP_008353440.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417009 
[Malus domestica]
Length=1099

 Score =   337 bits (864),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  760   VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
             VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQII AIK
Sbjct  906   VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIICAIK  965

Query  580   VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             V+LGEDGS+RGA+KLARIRENSNFFRSELQKMGFEV GDNDSPVMPIMLYNP+KIPAFSR
Sbjct  966   VLLGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVXGDNDSPVMPIMLYNPAKIPAFSR  1025

Query  400   ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
             ECL+QNVAVVTVAFPATPLLLARARICISA+HTREDLIKALEV  RVGDLVGIK FPAEP
Sbjct  1026  ECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKALEVFGRVGDLVGIKXFPAEP  1085

Query  220   KKQQLEENRL  191
             KK Q EE RL
Sbjct  1086  KKAQAEEERL  1095



>ref|XP_007038095.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY22596.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=512

 Score =   323 bits (828),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 186/216 (86%), Gaps = 23/216 (11%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSK-----------------------ELIQYLKYT  650
            VDTADVDIMMGTFTKS GSCGGYIAGSK                       ELIQYLKYT
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKLLEGFYSVMMAGAIGKICPVIREELIQYLKYT  356

Query  649  CPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVL  470
            CPAHLY TSISPPAA+QIISAIKVILGEDGSSRGA+KLARIRENSNFFRSELQKMGFEVL
Sbjct  357  CPAHLYTTSISPPAARQIISAIKVILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVL  416

Query  469  GDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICISAAHTREDL  290
            GDNDSPVMPIMLYNP+KIPAFSRECL+QN+AVVTVAFPATPLLLARARICISAAHT+EDL
Sbjct  417  GDNDSPVMPIMLYNPAKIPAFSRECLKQNIAVVTVAFPATPLLLARARICISAAHTKEDL  476

Query  289  IKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  182
            +KALEVIS VGD+VGIKYFPAEPKK +  ++ +KLE
Sbjct  477  LKALEVISEVGDMVGIKYFPAEPKKLEQGKDTIKLE  512



>ref|XP_002512864.1| serine palmitoyltransferase, putative [Ricinus communis]
 gb|EEF49367.1| serine palmitoyltransferase, putative [Ricinus communis]
Length=488

 Score =   322 bits (826),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAA+QIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAEQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            E   + VAVVTVAFPATPLLLARARICISA+HT+EDLIKALEVIS+VGDLVGIKYFPAEP
Sbjct  417  E-XXKGVAVVTVAFPATPLLLARARICISASHTKEDLIKALEVISQVGDLVGIKYFPAEP  475

Query  220  KKQQLEENRLKLE  182
             KQQ ++  +KL+
Sbjct  476  NKQQEDDKIVKLD  488



>ref|XP_002872066.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48325.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQSKNDIKLD  489



>dbj|BAB03231.1| serine palmitoyltransferase [Arabidopsis thaliana]
Length=489

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQSKNDIKLD  489



>ref|NP_197756.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 ref|NP_001031932.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 sp|Q9LSZ9.1|LCB2A_ARATH RecName: Full=Long chain base biosynthesis protein 2a; Short=AtLCB2a; 
AltName: Full=Long chain base biosynthesis protein 
2; Short=AtLCB2 [Arabidopsis thaliana]
 dbj|BAA97234.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAK92764.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM91761.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AED93196.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 gb|AED93197.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
Length=489

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQSKNDIKLD  489



>ref|XP_011073129.1| PREDICTED: long chain base biosynthesis protein 2b isoform X2 
[Sesamum indicum]
Length=498

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 187/224 (83%), Gaps = 31/224 (14%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGSKELI+YLK+ CPAHLYATSISPPAAQQI+S+IK
Sbjct  275  VDTADIDIMMGTFTKSFGSCGGYIAGSKELIEYLKHNCPAHLYATSISPPAAQQIMSSIK  334

Query  580  VILGEDGSSRG-------------------------------AEKLARIRENSNFFRSEL  494
            VILGEDGSSRG                               A+KLARIRENSNFFRSEL
Sbjct  335  VILGEDGSSRGWDLSALCLLHKTMFFVVYLQVTHFLHYVNTGAQKLARIRENSNFFRSEL  394

Query  493  QKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICIS  314
            QKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++NVAVVTVAFPATPLLLARARICIS
Sbjct  395  QKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKRNVAVVTVAFPATPLLLARARICIS  454

Query  313  AAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  182
            AAHTREDL KALEVISRVGD+VG+KYFPAEPKKQQLE   +K++
Sbjct  455  AAHTREDLTKALEVISRVGDMVGVKYFPAEPKKQQLEGEGIKMD  498



>ref|XP_009403558.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403559.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE++QYLKYTCPA+LYATS+SPPA QQ+ISAIK
Sbjct  237  VDPADVDIMMGTFTKSFGSCGGYIAASKEIVQYLKYTCPAYLYATSMSPPAVQQVISAIK  296

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGD+DSPVMPIMLYNP+KIPAFSR
Sbjct  297  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDSDSPVMPIMLYNPAKIPAFSR  356

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISAAH+REDLIK LEVIS+VGDL GIKYFP EP
Sbjct  357  ECLRQNVAVVTVAFPATPLLLARARICISAAHSREDLIKGLEVISKVGDLAGIKYFPVEP  416

Query  220  KKQQLEENRLKLE  182
             K + + ++ KLE
Sbjct  417  PKHETQGHK-KLE  428



>ref|XP_010503519.1| PREDICTED: long chain base biosynthesis protein 2b-like [Camelina 
sativa]
Length=489

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGSK+LIQYLK+ CPAHLYATSIS P+AQQIISAI+
Sbjct  297  VDTADIDIMMGTFTKSFGSCGGYIAGSKDLIQYLKHHCPAHLYATSISTPSAQQIISAIQ  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+AVV V FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA P
Sbjct  417  ECLRENLAVVVVGFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAAP  476

Query  220  KKQQLEENRLKLE  182
            KKQ  E+  +KL+
Sbjct  477  KKQDEEKYGIKLD  489



>ref|XP_010493489.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKEL+QYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELVQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQTKNDIKLD  489



>ref|XP_010421176.1| PREDICTED: long chain base biosynthesis protein 2a [Camelina 
sativa]
Length=489

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKEL+QYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELVQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQTKNDIKLD  489



>ref|XP_010454654.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKEL+QYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELVQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KK +  +N +KL+
Sbjct  477  KKIEQTKNDIKLD  489



>ref|XP_006394630.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31916.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=434

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  242  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  301

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIP+FSR
Sbjct  302  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPSFSR  361

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  362  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  421

Query  220  KKQQLEENRLKLE  182
            KK +  +N  KLE
Sbjct  422  KKIEETKNDTKLE  434



>ref|XP_011073128.1| PREDICTED: long chain base biosynthesis protein 2b isoform X1 
[Sesamum indicum]
Length=520

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 187/224 (83%), Gaps = 31/224 (14%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+DIMMGTFTKS GSCGGYIAGSKELI+YLK+ CPAHLYATSISPPAAQQI+S+IK
Sbjct  297  VDTADIDIMMGTFTKSFGSCGGYIAGSKELIEYLKHNCPAHLYATSISPPAAQQIMSSIK  356

Query  580  VILGEDGSSRG-------------------------------AEKLARIRENSNFFRSEL  494
            VILGEDGSSRG                               A+KLARIRENSNFFRSEL
Sbjct  357  VILGEDGSSRGWDLSALCLLHKTMFFVVYLQVTHFLHYVNTGAQKLARIRENSNFFRSEL  416

Query  493  QKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARICIS  314
            QKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL++NVAVVTVAFPATPLLLARARICIS
Sbjct  417  QKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLKRNVAVVTVAFPATPLLLARARICIS  476

Query  313  AAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKLE  182
            AAHTREDL KALEVISRVGD+VG+KYFPAEPKKQQLE   +K++
Sbjct  477  AAHTREDLTKALEVISRVGDMVGVKYFPAEPKKQQLEGEGIKMD  520



>ref|XP_004516386.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cicer 
arietinum]
Length=489

 Score =   320 bits (819),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKELI+YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELIKYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KL++IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLSKIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQN+AVVTVAFPATPLLLARARICISA+H+REDL KAL+VIS VGDLVGIK    EP
Sbjct  417  ECLRQNIAVVTVAFPATPLLLARARICISASHSREDLTKALQVISSVGDLVGIKXXXXEP  476

Query  220  KKQQLEENRLKLE  182
             KQQ +   +K E
Sbjct  477  MKQQQDGKTVKFE  489



>ref|XP_009419359.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419360.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKY+CPAHLYATS+SPPA QQ+ISAIK
Sbjct  299  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYSCPAHLYATSMSPPAVQQVISAIK  358

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLA IRENSNFFRSELQKMGFEVLGD+DSPVMPIMLYNP+KIPAFSR
Sbjct  359  VILGEDGSSRGAQKLAHIRENSNFFRSELQKMGFEVLGDSDSPVMPIMLYNPAKIPAFSR  418

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTVAFPATPLLLARARICISAAH++EDLIK LEVIS+VGDLVGIKYFPAEP
Sbjct  419  ECLKQNVAIVTVAFPATPLLLARARICISAAHSKEDLIKGLEVISKVGDLVGIKYFPAEP  478

Query  220  KKQQLEENRLKLE  182
               Q + ++ KLE
Sbjct  479  PNHQGQGHK-KLE  490



>ref|XP_009403557.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE++QYLKYTCPA+LYATS+SPPA QQ+ISAIK
Sbjct  299  VDPADVDIMMGTFTKSFGSCGGYIAASKEIVQYLKYTCPAYLYATSMSPPAVQQVISAIK  358

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGD+DSPVMPIMLYNP+KIPAFSR
Sbjct  359  VILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDSDSPVMPIMLYNPAKIPAFSR  418

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISAAH+REDLIK LEVIS+VGDL GIKYFP EP
Sbjct  419  ECLRQNVAVVTVAFPATPLLLARARICISAAHSREDLIKGLEVISKVGDLAGIKYFPVEP  478

Query  220  KKQQLEENRLKLE  182
             K + + ++ KLE
Sbjct  479  PKHETQGHK-KLE  490



>gb|KFK27657.1| hypothetical protein AALP_AA8G411600 [Arabis alpina]
Length=489

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGD+DSPVMPIMLYNP+KIP+FSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDDDSPVMPIMLYNPAKIPSFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGDL GIKYFPAEP
Sbjct  417  ECLRQNVAVVVVGFPATPLLLARARICISASHSREDLIRALKVISKVGDLSGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            +K +  ++ +KL+
Sbjct  477  QKMEQTKHDIKLD  489



>ref|XP_009404745.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=489

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 182/192 (95%), Gaps = 1/192 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIA SKE+IQYLK+TCPAHLYATS+SPPA QQ+ISAIK
Sbjct  299  VDTADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKHTCPAHLYATSMSPPAVQQVISAIK  358

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA IR+NSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  359  VILGEDGSNRGAQKLASIRQNSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  418

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAVVTVAFPATPLLLARARICISA+HTREDL+K L+VIS+VGDLVGIKYFPAEP
Sbjct  419  ECLRRNVAVVTVAFPATPLLLARARICISASHTREDLMKGLDVISKVGDLVGIKYFPAEP  478

Query  220  KKQQLEENRLKL  185
             K  +E+++  L
Sbjct  479  PK-HVEQDKKTL  489



>ref|XP_010519476.1| PREDICTED: long chain base biosynthesis protein 2a [Tarenaya 
hassleriana]
Length=487

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKEL+Q+LK  CPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKELVQFLKKHCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+EL KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELHKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVV V FPATPLLLARARICISA+H+REDLI+AL+VIS+VGD+ GIKYFPAEP
Sbjct  417  ECLRQNVAVVVVGFPATPLLLARARICISASHSREDLIRALQVISKVGDVTGIKYFPAEP  476

Query  220  KKQQLEENRL  191
             K + +  +L
Sbjct  477  SKPEKDTTKL  486



>gb|KDO47369.1| hypothetical protein CISIN_1g040324mg [Citrus sinensis]
Length=488

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+DVDIMMGTF+KS GS GGYIAGSKELIQYLKY CPAHLYATSISPPAA+QIISAI+
Sbjct  297  VDTSDVDIMMGTFSKSFGSYGGYIAGSKELIQYLKYNCPAHLYATSISPPAAEQIISAIQ  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V++GEDGS RGA+KLARIRENSNFFRS+LQKMGFEVLGDNDSPVMPIM+YNP+K+ +FSR
Sbjct  357  VVIGEDGSCRGAQKLARIRENSNFFRSKLQKMGFEVLGDNDSPVMPIMVYNPAKVSSFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTV FPATPLLLARARICISA+HT+EDLI+ALEVISR+GDLVGIKYFPAEP
Sbjct  417  ECLKQNVAIVTVGFPATPLLLARARICISASHTKEDLIEALEVISRIGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQ +   LKLE
Sbjct  477  KKQQ-QVGMLKLE  488



>ref|XP_006446965.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
 gb|ESR60205.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
Length=488

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+DVDIMMGTF+KS GS GGYIAGSKELIQYLKY CPAHLYATSISPPAA+QIISAI+
Sbjct  297  VDTSDVDIMMGTFSKSFGSYGGYIAGSKELIQYLKYNCPAHLYATSISPPAAEQIISAIQ  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V++GEDGS RGA+KLARIRENSNFFRS+LQKMGFEVLGDNDSPVMPIM+YNP+K+ +FSR
Sbjct  357  VVIGEDGSCRGAQKLARIRENSNFFRSKLQKMGFEVLGDNDSPVMPIMVYNPAKVSSFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTV FPATPLLLARARICISA+HT+EDLI+ALEVISR+GDLVGIKYFPAEP
Sbjct  417  ECLKQNVAIVTVGFPATPLLLARARICISASHTKEDLIEALEVISRIGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQ +   LKLE
Sbjct  477  KKQQ-QVGMLKLE  488



>ref|XP_006828786.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
 gb|ERM96202.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
Length=487

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD AD+D+MMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  296  VDPADIDVMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSMSPPAVQQVISAIK  355

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KL R+RENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  356  VILGEDGSNRGAQKLVRVRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  415

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
             CL ++VAVVTVAFPATPLLLARARICISA+HTREDLI+ LEVIS++GDL+GIKY P EP
Sbjct  416  GCLEEDVAVVTVAFPATPLLLARARICISASHTREDLIRGLEVISQIGDLIGIKYLPMEP  475

Query  220  KKQQLEENRLKLE  182
            +KQ L E+R KLE
Sbjct  476  EKQHL-EDREKLE  487



>ref|XP_011002110.1| PREDICTED: long chain base biosynthesis protein 2a-like [Populus 
euphratica]
Length=489

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIRENSNFFRSELQKMGF+V+GDNDSPV+ IMLYNP KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENSNFFRSELQKMGFDVIGDNDSPVIAIMLYNPGKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV  AFPATPLLLARARICIS+ H  EDL+KALEVI++VGDL+GIKY PA  
Sbjct  417  ECLKQNVAVVMTAFPATPLLLARARICISSCHAMEDLLKALEVINQVGDLIGIKYSPAGS  476

Query  220  KKQQLEENRLKLE  182
             KQ  E++ +KLE
Sbjct  477  DKQHQEQDAMKLE  489



>ref|XP_006468870.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Citrus sinensis]
 ref|XP_006468871.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Citrus sinensis]
 ref|XP_006468872.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Citrus sinensis]
Length=488

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+DVDIMMGTF+KS GS GGYIAGSKELIQYLKY CPAHLYATSISPPAA+QIISAI+
Sbjct  297  VDTSDVDIMMGTFSKSFGSYGGYIAGSKELIQYLKYNCPAHLYATSISPPAAEQIISAIQ  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V++GEDGS RGA+KLARIRENSNFFRS+LQKMGFEVLGDNDSPVMPIM+YNP+K+ +FSR
Sbjct  357  VVIGEDGSCRGAQKLARIRENSNFFRSKLQKMGFEVLGDNDSPVMPIMVYNPAKVSSFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVA+VTV FPATPLLLARARICISA+HT+EDLI+ALEVI+R+GDLVGIKYFPAEP
Sbjct  417  ECLKQNVAIVTVGFPATPLLLARARICISASHTKEDLIEALEVINRIGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
            KKQQ +   LKLE
Sbjct  477  KKQQ-QVGMLKLE  488



>gb|EEE52176.1| hypothetical protein OsJ_34042 [Oryza sativa Japonica Group]
Length=466

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK +CPAH+YATS+SPPA QQ+ISAIK
Sbjct  275  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKLSCPAHIYATSMSPPAVQQVISAIK  334

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  335  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  394

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  395  ECLRQKVAVVTVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEP  454

Query  220  KKQQLEENRLKLE  182
             K   E +  KLE
Sbjct  455  PKIA-EADHDKLE  466



>ref|XP_002321740.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEF05867.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KL RIRENSNFFRSELQKMGF+V+GDNDSPV+ IMLYNP KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLERIRENSNFFRSELQKMGFDVIGDNDSPVIAIMLYNPGKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV  AFPATPLLLARARICISA H  EDL+KALEVI++VGDL+GIKY PA  
Sbjct  417  ECLKQNVAVVMSAFPATPLLLARARICISACHAMEDLLKALEVINQVGDLIGIKYSPAGS  476

Query  220  KKQQLEENRLKLE  182
             KQ  E+  +KLE
Sbjct  477  DKQHQEQGAMKLE  489



>ref|XP_004979342.1| PREDICTED: long chain base biosynthesis protein 2a-like [Setaria 
italica]
Length=488

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK++CPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKHSCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQKVAVVTVAFPATPLLLARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEP  476

Query  220  KK  215
             K
Sbjct  477  PK  478



>ref|NP_001148953.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACG33631.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN26506.1| unknown [Zea mays]
 tpg|DAA42006.1| TPA: Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK++CPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKHSCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQKVAVVTVAFPATPLLLARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEP  476

Query  220  KK  215
             K
Sbjct  477  PK  478



>ref|XP_003577540.1| PREDICTED: long chain base biosynthesis protein 2a [Brachypodium 
distachyon]
Length=488

 Score =   314 bits (805),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SK+LIQ+LK++CPAHLYATS+SPPA QQ+IS+IK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKDLIQHLKHSCPAHLYATSMSPPAVQQVISSIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+Q VAVVTVAFPATPLLLARARICISA+HTREDLI AL VISRVGDLVGIKYFPAEP
Sbjct  417  ECLKQKVAVVTVAFPATPLLLARARICISASHTREDLINALNVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E N  KLE
Sbjct  477  PKIS-EANHDKLE  488



>ref|NP_001067972.1| Os11g0516000 [Oryza sativa Japonica Group]
 sp|Q2R3K3.1|LCB2A_ORYSJ RecName: Full=Long chain base biosynthesis protein 2a [Oryza 
sativa Japonica Group]
 gb|ABA93932.1| Serine palmitoyltransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28335.1| Os11g0516000 [Oryza sativa Japonica Group]
 gb|EEC68247.1| hypothetical protein OsI_36267 [Oryza sativa Indica Group]
Length=488

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK +CPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKLSCPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQKVAVVTVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E +  KLE
Sbjct  477  PKIA-EADHDKLE  488



>ref|NP_001151995.1| LOC100285632 [Zea mays]
 gb|ACG45307.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN25731.1| unknown [Zea mays]
 gb|AFW60856.1| Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I++LK++CPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIKHLKHSCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGSSRGA+KLARIREN NFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSSRGAQKLARIRENGNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQKVAVVTVAFPATPLLLARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEP  476

Query  220  KK  215
             K
Sbjct  477  PK  478



>ref|XP_006662956.1| PREDICTED: long chain base biosynthesis protein 2a-like [Oryza 
brachyantha]
Length=488

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK +CPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKLSCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+EL+KMGFEVLG+NDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRAELKKMGFEVLGNNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRQKVAVVTVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E +  KLE
Sbjct  477  PKIA-EADHDKLE  488



>ref|XP_002450805.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
 gb|EES09793.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
Length=488

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK +CPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKQSCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+ VAVVTVAFPATPLLLARARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAEP
Sbjct  417  ECLRRKVAVVTVAFPATPLLLARARICISASHTREDLMKALDVISRVGDLVGIKYFPAEP  476

Query  220  KKQQLEENRLKLE  182
             K   E +  KLE
Sbjct  477  PKIA-EADHDKLE  488



>ref|XP_009150174.1| PREDICTED: long chain base biosynthesis protein 2b-like isoform 
X2 [Brassica rapa]
Length=410

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+TADVDIMMGTF+KS  SCGGYIAGSKELIQYLK+ CP HLYATSIS P+AQQIISAI+
Sbjct  218  VNTADVDIMMGTFSKSFASCGGYIAGSKELIQYLKHHCPGHLYATSISTPSAQQIISAIR  277

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+KIPAFSR
Sbjct  278  VILGEDGSNRGAQKLARIRENSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPAKIPAFSR  337

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVA+  V FPATPL+L RARICISA+H+++DLIKALEVIS+VGDL GIKYFPA P
Sbjct  338  ECLRENVAIAVVGFPATPLMLGRARICISASHSKQDLIKALEVISKVGDLTGIKYFPAAP  397

Query  220  KKQQLEENRLKL  185
            KKQ+ E++ +KL
Sbjct  398  KKQEAEKDTIKL  409



>ref|XP_008656901.1| PREDICTED: long chain base biosynthesis protein 2d [Zea mays]
 gb|ACG26228.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACL52834.1| unknown [Zea mays]
 gb|AFW84058.1| putative serine palmitoyltransferase [Zea mays]
Length=489

 Score =   309 bits (791),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA S E+I +LK+TCPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASNEIIHHLKHTCPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG++RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGTNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VAVVTVAFPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E 
Sbjct  417  ECLRQAVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEQ  476

Query  220  KKQQLEENRLKLE  182
            +K    EN  K++
Sbjct  477  EKTTAVENLKKIQ  489



>ref|XP_004971156.1| PREDICTED: long chain base biosynthesis protein 2d-like [Setaria 
italica]
Length=489

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I +LK+TCPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIHHLKHTCPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG++RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGTNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+H+REDLIK L VIS+VGDLVGIKYFP E 
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHSREDLIKGLGVISKVGDLVGIKYFPVEQ  476

Query  220  KKQQLEENRLKLE  182
            +K    E   K++
Sbjct  477  EKTAAVEKLKKIQ  489



>ref|XP_002459025.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
 gb|EES04145.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
Length=489

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA S E+I +LK TCPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASNEIIHHLKLTCPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG++RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGTNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E 
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEQ  476

Query  220  KKQQLEENRLKLE  182
            +K    E   K++
Sbjct  477  EKTTAVEKLKKIQ  489



>emb|CDY69570.1| BnaAnng30850D, partial [Brassica napus]
Length=402

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+TADVDIMMGTF+KS  SCGGYIAGSKELIQYLK+ CP HLYATSIS P+AQQIISAI+
Sbjct  210  VNTADVDIMMGTFSKSFASCGGYIAGSKELIQYLKHHCPGHLYATSISTPSAQQIISAIR  269

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+KIPAFS+
Sbjct  270  VILGEDGSNRGAQKLARIRENSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPAKIPAFSK  329

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVA+  V FPATPL+L RARICISA+H+++DLIKALEVIS+VGDL GIKYFPA P
Sbjct  330  ECLRENVAIPVVGFPATPLMLGRARICISASHSKQDLIKALEVISKVGDLTGIKYFPAAP  389

Query  220  KKQQLEENRLKL  185
            KKQ+ E++ +KL
Sbjct  390  KKQEAEKDTIKL  401



>ref|NP_001045279.1| Os01g0928800 [Oryza sativa Japonica Group]
 sp|Q5JK39.1|LCB2D_ORYSJ RecName: Full=Long chain base biosynthesis protein 2d [Oryza 
sativa Japonica Group]
 dbj|BAD88168.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07193.1| Os01g0928800 [Oryza sativa Japonica Group]
 dbj|BAH00095.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72091.1| hypothetical protein OsI_05038 [Oryza sativa Indica Group]
 gb|EEE55940.1| hypothetical protein OsJ_04635 [Oryza sativa Japonica Group]
Length=489

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ+VAVVTVAFPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E 
Sbjct  417  ECLRQHVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEH  476

Query  220  KKQQLEENRLKLE  182
            +K    E   KL+
Sbjct  477  EKTASVEKLKKLQ  489



>ref|XP_006645277.1| PREDICTED: long chain base biosynthesis protein 2d-like [Oryza 
brachyantha]
Length=489

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD  DVDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPTDVDIMMGTFTKSFGSCGGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ+VAVVTVAFPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKYFP E 
Sbjct  417  ECLRQHVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYFPVEH  476

Query  220  KKQQLEENRLKLE  182
            +K    E   KL+
Sbjct  477  EKTTSVEKTKKLQ  489



>ref|XP_003564989.1| PREDICTED: long chain base biosynthesis protein 2d [Brachypodium 
distachyon]
Length=489

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK+ CPAH+YATS+SPPA QQ+ISAIK
Sbjct  298  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKHQCPAHIYATSMSPPAVQQVISAIK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  358  VVLGEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+ +REDLIK LEVIS+VGDLVGIKYFP E 
Sbjct  418  ECLRQNVAVVTVAFPATPLLLARARICISASQSREDLIKGLEVISKVGDLVGIKYFPVEQ  477

Query  220  KKQQLEE  200
            +K   ++
Sbjct  478  EKTSADK  484



>ref|XP_009150173.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Brassica rapa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+TADVDIMMGTF+KS  SCGGYIAGSKELIQYLK+ CP HLYATSIS P+AQQIISAI+
Sbjct  293  VNTADVDIMMGTFSKSFASCGGYIAGSKELIQYLKHHCPGHLYATSISTPSAQQIISAIR  352

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+KIPAFSR
Sbjct  353  VILGEDGSNRGAQKLARIRENSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPAKIPAFSR  412

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVA+  V FPATPL+L RARICISA+H+++DLIKALEVIS+VGDL GIKYFPA P
Sbjct  413  ECLRENVAIAVVGFPATPLMLGRARICISASHSKQDLIKALEVISKVGDLTGIKYFPAAP  472

Query  220  KKQQLEENRLKL  185
            KKQ+ E++ +KL
Sbjct  473  KKQEAEKDTIKL  484



>ref|XP_002450804.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
 gb|EES09792.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
Length=490

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SK++IQ+LK +CPAHLYATS+SPPA QQ+ISAIK
Sbjct  299  VDPADVDIMMGTFTKSFGSCGGYIAASKDIIQHLKQSCPAHLYATSMSPPAVQQVISAIK  358

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG++RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  359  VILGEDGTNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  418

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            EC RQ VAV++V+FP TPLLL RARICISA+HTREDL+KAL+VISRVGDLVGIKYFPAE 
Sbjct  419  ECFRQKVAVISVSFPVTPLLLGRARICISASHTREDLMKALDVISRVGDLVGIKYFPAES  478

Query  220  KK  215
             K
Sbjct  479  AK  480



>gb|EMT23338.1| Serine palmitoyltransferase 2 [Aegilops tauschii]
Length=489

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIHHLKHACPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VVLGEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+ +REDLIK LEVIS+VGDL+GIKYFP E 
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASQSREDLIKGLEVISKVGDLIGIKYFPVEQ  476

Query  220  KKQQLEENRLKLE  182
            +K    +   KLE
Sbjct  477  EKVASVDKLKKLE  489



>ref|XP_008678155.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Zea mays]
Length=464

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVD+MMGTFTKS GSCGGYIA S+E++Q+LK+TCP HLYATS+SPPA QQ+ISAI+
Sbjct  275  VDPADVDVMMGTFTKSFGSCGGYIAASEEIVQHLKHTCPGHLYATSMSPPAVQQVISAIR  334

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGSSRGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  335  VVLGEDGSSRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  394

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            EC RQ VAV+TVAFP TPLLLARAR CISA+HTREDL KAL+VISRVGDLVGIKYFPA+ 
Sbjct  395  ECFRQKVAVITVAFPVTPLLLARARFCISASHTREDLTKALDVISRVGDLVGIKYFPAQR  454

Query  220  KK  215
             K
Sbjct  455  PK  456



>ref|XP_008678154.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Zea mays]
Length=491

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVD+MMGTFTKS GSCGGYIA S+E++Q+LK+TCP HLYATS+SPPA QQ+ISAI+
Sbjct  302  VDPADVDVMMGTFTKSFGSCGGYIAASEEIVQHLKHTCPGHLYATSMSPPAVQQVISAIR  361

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGSSRGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  362  VVLGEDGSSRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  421

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            EC RQ VAV+TVAFP TPLLLARAR CISA+HTREDL KAL+VISRVGDLVGIKYFPA+ 
Sbjct  422  ECFRQKVAVITVAFPVTPLLLARARFCISASHTREDLTKALDVISRVGDLVGIKYFPAQR  481

Query  220  KK  215
             K
Sbjct  482  PK  483



>emb|CDM85908.1| unnamed protein product [Triticum aestivum]
Length=757

 Score =   308 bits (790),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIHHLKHACPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VVLGEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVVTVAFPATPLLLARARICISA+ +REDLIK LEVIS+VGDL+GIKYFP E 
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASQSREDLIKGLEVISKVGDLIGIKYFPVEQ  476

Query  220  KKQQLEEN  197
            +KQ  E++
Sbjct  477  EKQPQEQH  484



>ref|NP_001045278.1| Os01g0928700 [Oryza sativa Japonica Group]
 sp|Q8RYL0.1|LCB2C_ORYSJ RecName: Full=Long chain base biosynthesis protein 2c [Oryza 
sativa Japonica Group]
 dbj|BAB90752.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07192.1| Os01g0928700 [Oryza sativa Japonica Group]
 gb|EAY77077.1| hypothetical protein OsI_05037 [Oryza sativa Indica Group]
 gb|EAZ14710.1| hypothetical protein OsJ_04634 [Oryza sativa Japonica Group]
Length=497

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATS+SPPA QQ+ISAI+
Sbjct  305  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIDHLKHICPAHIYATSMSPPAVQQVISAIE  364

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS RGA+KLA+IRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+K+PAFSR
Sbjct  365  VILGEDGSDRGAKKLAQIRENSNFFRSELEKMGFEVLGDNDSPVMPIMLYNPAKMPAFSR  424

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ VA+VTV+FPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKY P E 
Sbjct  425  ECLRQKVAIVTVSFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYLPVEH  484

Query  220  KKQQLEENRLKLE  182
            +K    E   K++
Sbjct  485  EKTTSAEKLKKIQ  497



>gb|EMS46639.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=487

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATSISPPAAQQ+ISA+K
Sbjct  295  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIHHLKHACPAHIYATSISPPAAQQVISAMK  354

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIREN NFFR EL+KMGFEVLGDN SPVMPIMLYNP+K+PAFSR
Sbjct  355  VILGEDGSNRGAKKLARIRENGNFFRLELKKMGFEVLGDNGSPVMPIMLYNPAKMPAFSR  414

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+NVAV T+A+PATPLLLARARICISA+H+REDLIK LEVIS+VGDLVG+KY P E 
Sbjct  415  ECLRKNVAVCTIAYPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGVKYCPVEE  474

Query  220  KK  215
            KK
Sbjct  475  KK  476



>ref|XP_010093950.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB54913.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=530

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKEL++YLKYTCPAHLYATSISPPAAQQIIS+IK
Sbjct  313  VDTADVDIMMGTFTKSFGSCGGYIAGSKELVEYLKYTCPAHLYATSISPPAAQQIISSIK  372

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARI ENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  373  VILGEDGTSRGAQKLARIGENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  432

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFP  230
            ECL++NVAVVTVAFPATPLLLARARICISA+H++EDL++ALEVIS VGDL+ +   P
Sbjct  433  ECLKKNVAVVTVAFPATPLLLARARICISASHSKEDLLRALEVISEVGDLLHLTIPP  489



>ref|XP_010322021.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=452

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +DTA+VDIMMGTFTK+ GSCGGYIAGSKE+I+YLKYTCPAH+YA SISPPAAQQIISAIK
Sbjct  268  IDTANVDIMMGTFTKAFGSCGGYIAGSKEVIEYLKYTCPAHVYAISISPPAAQQIISAIK  327

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS RGA+K+AR+RENSNFFRSELQKMGF+VLGD DSPVMPIMLYN +K+PAFSR
Sbjct  328  VLLGEDGSKRGAQKIARLRENSNFFRSELQKMGFDVLGDYDSPVMPIMLYNIAKLPAFSR  387

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYF  233
            ECL+QNVAVV VAFPATPLLLARARICISAAH++EDLIKALEVI RVGDL+GIKY 
Sbjct  388  ECLKQNVAVVVVAFPATPLLLARARICISAAHSKEDLIKALEVIGRVGDLLGIKYL  443



>gb|EMS48138.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=508

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 177/212 (83%), Gaps = 19/212 (9%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQ+LK+ CPAH+YATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQHLKHACPAHIYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLA+IRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VVLGEDGSNRGAKKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALE------------------  275
            ECLRQNVAVVTVAFPATPLLLARARICISA+ +REDLIK LE                  
Sbjct  417  ECLRQNVAVVTVAFPATPLLLARARICISASQSREDLIKGLEIMRCVHNTSPDHNFMQIV  476

Query  274  -VISRVGDLVGIKYFPAEPKKQQLEENRLKLE  182
             VIS+VGDL+GIKYFP E +K    +   KLE
Sbjct  477  QVISKVGDLIGIKYFPVEQEKVASVDKLKKLE  508



>ref|XP_008239635.1| PREDICTED: long chain base biosynthesis protein 2a [Prunus mume]
Length=464

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDIMMGTFTKS GSCGGYIAGSKE+IQYLKYTCPAHLYATS+SPPAAQQIISAIK
Sbjct  297  VDTADVDIMMGTFTKSFGSCGGYIAGSKEVIQYLKYTCPAHLYATSVSPPAAQQIISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+SRGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGTSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEV  272
            ECL+QNVAVVTVAFPATPLLLARARICISA+HT+EDL++ALEV
Sbjct  417  ECLKQNVAVVTVAFPATPLLLARARICISASHTKEDLLRALEV  459



>gb|ABR18369.1| unknown [Picea sitchensis]
Length=493

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT+D+DIMMGTFTKS GSCGGYIAGSK+LI+YLK   P HLYAT++SPPA QQ+ISA+K
Sbjct  296  VDTSDIDIMMGTFTKSFGSCGGYIAGSKDLIKYLKAVSPGHLYATAMSPPAVQQVISALK  355

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMG EVLGD+DSPVMPIMLYNP+KIPAFSR
Sbjct  356  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGCEVLGDHDSPVMPIMLYNPAKIPAFSR  415

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+++VAVV VAFPATPLLLARAR+C+SA+HT+EDL+KALEVIS V D+V IKYFP +P
Sbjct  416  ECLKRHVAVVGVAFPATPLLLARARMCLSASHTKEDLLKALEVISEVSDMVQIKYFPKDP  475

Query  220  KKQQLEEN  197
            +KQ  EE 
Sbjct  476  EKQLKEEQ  483



>gb|ADN33867.1| serine palmitoyltransferase [Cucumis melo subsp. melo]
Length=170

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -3

Query  679  KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRS  500
            +ELI+YLKYTCPAHLYATSISPPAAQQIIS+IKVILGEDGSSRGA+KLARIRENSNFFRS
Sbjct  4    QELIKYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSSRGAQKLARIRENSNFFRS  63

Query  499  ELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARIC  320
            ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECL QNVAVVTVAFPATPLLLARARIC
Sbjct  64   ELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLNQNVAVVTVAFPATPLLLARARIC  123

Query  319  ISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEEN  197
            ISA+HT++DL+KALEVISRVGDLVGIKYFPAE +KQQ E +
Sbjct  124  ISASHTKDDLLKALEVISRVGDLVGIKYFPAEAQKQQSEND  164



>ref|NP_190448.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE78456.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
Length=350

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT +VDIMMGTFTKS GSCGGYIAGSK+L+QYLK   PAHLYATSIS PAAQQ+ISAIK
Sbjct  154  VDTTEVDIMMGTFTKSLGSCGGYIAGSKDLVQYLKQHYPAHLYATSISTPAAQQVISAIK  213

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI G DGS+RG  KLARIRENSNFFR+ELQKMGF+VLG  DSP+MPIMLYNP+KI AFSR
Sbjct  214  VIFGVDGSNRGELKLARIRENSNFFRAELQKMGFKVLGVYDSPIMPIMLYNPAKIAAFSR  273

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+A+V V+FP  PLLLARARIC SA+H REDLIKAL+VISR GDL GIKYF A P
Sbjct  274  ECLRENLAIVVVSFPPIPLLLARARICNSASHLREDLIKALQVISRAGDLTGIKYFTAAP  333

Query  220  KKQQLEEN  197
            KKQ+ E+N
Sbjct  334  KKQE-EKN  340



>gb|KCW48525.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=501

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGY+AGSKELIQYLK TCPAHLYATSISPPAAQQI+SAIK
Sbjct  297  VDTADVDVMMGTFTKSFGSCGGYVAGSKELIQYLKNTCPAHLYATSISPPAAQQILSAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNF RSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  VILGEDGSNRGAQKLARIRENSNFCRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDL  251
            ECL+ NVAVVTVAFPATPLLLARARICISA+HT+EDL+KALEVIS +  L
Sbjct  417  ECLKHNVAVVTVAFPATPLLLARARICISASHTKEDLVKALEVISCICTL  466



>ref|XP_006645276.1| PREDICTED: long chain base biosynthesis protein 2c-like [Oryza 
brachyantha]
Length=492

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 171/187 (91%), Gaps = 1/187 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+ A+VDIMMGTFTKS GSCGGYIA SKE+I +LK+ CPAH+YATS+SPPA Q +ISAIK
Sbjct  302  VEPANVDIMMGTFTKSFGSCGGYIAASKEIIDHLKHICPAHIYATSMSPPAVQLVISAIK  361

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KL +IRENSNFFRS+LQKMGF+VLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  362  VILGEDGSNRGAKKLFQIRENSNFFRSQLQKMGFQVLGDNDSPVMPIMLYNPAKIPAFSR  421

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQ+VAVVTVAFPATPLLLARARICISA+H+REDLIK LEVIS+VGDLVGIKY   E 
Sbjct  422  ECLRQHVAVVTVAFPATPLLLARARICISASHSREDLIKGLEVISKVGDLVGIKYLKHE-  480

Query  220  KKQQLEE  200
            K   +EE
Sbjct  481  KTTSVEE  487



>pir||T49275 serine C-palmitoyltransferase (EC 2.3.1.50) [similarity] - Arabidopsis 
thaliana (fragment)
 emb|CAB87907.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
Length=386

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT +VDIMMGTFTKS GSCGGYIAGSK+L+QYLK   PAHLYATSIS PAAQQ+ISAIK
Sbjct  190  VDTTEVDIMMGTFTKSLGSCGGYIAGSKDLVQYLKQHYPAHLYATSISTPAAQQVISAIK  249

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI G DGS+RG  KLARIRENSNFFR+ELQKMGF+VLG  DSP+MPIMLYNP+KI AFSR
Sbjct  250  VIFGVDGSNRGELKLARIRENSNFFRAELQKMGFKVLGVYDSPIMPIMLYNPAKIAAFSR  309

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLR+N+A+V V+FP  PLLLARARIC SA+H REDLIKAL+VISR GDL GIKYF A P
Sbjct  310  ECLRENLAIVVVSFPPIPLLLARARICNSASHLREDLIKALQVISRAGDLTGIKYFTAAP  369

Query  220  KKQQLEEN  197
            KKQ+ E+N
Sbjct  370  KKQE-EKN  376



>ref|XP_006645275.1| PREDICTED: long chain base biosynthesis protein 2b-like [Oryza 
brachyantha]
Length=498

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGT +KS GS GGYIA SKE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+K
Sbjct  306  VDPADVDIMMGTLSKSFGSSGGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMK  365

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDG+ RG +K+A+IR+NSNFFRSELQ+MGFEVLGDNDSPVMP M+YNP+K+PAFSR
Sbjct  366  VVLGEDGTDRGIKKIAQIRDNSNFFRSELQRMGFEVLGDNDSPVMPFMVYNPAKMPAFSR  425

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECLRQNVAVV V FPATPLLL R RICISA+HTREDLIK LEVIS+VGDLVGIKYFP E 
Sbjct  426  ECLRQNVAVVPVGFPATPLLLGRIRICISASHTREDLIKGLEVISKVGDLVGIKYFPVEQ  485

Query  220  KKQQLEENRLKL  185
            ++    E + KL
Sbjct  486  EETTSIEKQKKL  497



>ref|XP_008678152.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
 ref|XP_008678153.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
Length=526

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 170/217 (78%), Gaps = 35/217 (16%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGS---------------------------------  680
            VD ADVD+MMGTFTKS GSCGGYIA S                                 
Sbjct  302  VDPADVDVMMGTFTKSFGSCGGYIAASEVCILHTTTTTEKAKHACRNPCTVVALPFRLTA  361

Query  679  --KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFF  506
              +E++Q+LK+TCP HLYATS+SPPA QQ+ISAI+V+LGEDGSSRGA+KLARIRENSNFF
Sbjct  362  IFQEIVQHLKHTCPGHLYATSMSPPAVQQVISAIRVVLGEDGSSRGAQKLARIRENSNFF  421

Query  505  RSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARAR  326
            RSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSREC RQ VAV+TVAFP TPLLLARAR
Sbjct  422  RSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECFRQKVAVITVAFPVTPLLLARAR  481

Query  325  ICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  215
             CISA+HTREDL KAL+VISRVGDLVGIKYFPA+  K
Sbjct  482  FCISASHTREDLTKALDVISRVGDLVGIKYFPAQRPK  518



>gb|EAY77076.1| hypothetical protein OsI_05036 [Oryza sativa Indica Group]
Length=499

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGT +KS GS GGYIA SKE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+K
Sbjct  308  VDPADVDIMMGTLSKSFGSSGGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMK  367

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+ RGA+K+A+IR+NSNFFRSELQKMGFEVLGDNDSPVMP M+YNP+K+PAFSR
Sbjct  368  VILGEDGTDRGAKKIAQIRDNSNFFRSELQKMGFEVLGDNDSPVMPFMVYNPAKMPAFSR  427

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV V FPATPLLL R RICISA+H+REDLIK LEVIS VGDLVGIKY P E 
Sbjct  428  ECLKQNVAVVPVGFPATPLLLGRIRICISASHSREDLIKGLEVISNVGDLVGIKYLPVEQ  487

Query  220  KKQQLEENRLKL  185
            ++    E   KL
Sbjct  488  EETTSVEKPKKL  499



>sp|Q8RYL1.1|LCB2B_ORYSJ RecName: Full=Long chain base biosynthesis protein 2b [Oryza 
sativa Japonica Group]
 dbj|BAB90751.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 gb|EAZ14709.1| hypothetical protein OsJ_04633 [Oryza sativa Japonica Group]
 dbj|BAH00934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=499

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 166/192 (86%), Gaps = 0/192 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGT +KS GS GGYIA SKE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+K
Sbjct  308  VDPADVDIMMGTLSKSFGSSGGYIAASKEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMK  367

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+ RGA+K+A+IR+NSNFFRSELQKMGFEVLGDNDSPVMP M+YNP+K+PAFSR
Sbjct  368  VILGEDGTDRGAKKIAQIRDNSNFFRSELQKMGFEVLGDNDSPVMPFMVYNPAKMPAFSR  427

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL+QNVAVV V FPATPLLL R RICISA+H+REDLIK LEVIS VGDLVGIKY P E 
Sbjct  428  ECLKQNVAVVPVGFPATPLLLGRIRICISASHSREDLIKGLEVISNVGDLVGIKYLPVEQ  487

Query  220  KKQQLEENRLKL  185
            ++    E   KL
Sbjct  488  EETTSVEKPKKL  499



>ref|XP_006394629.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31915.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=406

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVD+MMGTFTKS GSCGGYIAGSKELIQYLK+ CPAHLYATSI  P+AQQIISAIK
Sbjct  242  VDTADVDVMMGTFTKSFGSCGGYIAGSKELIQYLKHQCPAHLYATSIPTPSAQQIISAIK  301

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIP+FSR
Sbjct  302  VILGEDGSNRGAQKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPSFSR  361

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALE  275
            ECLRQ VAVV V FPATPLLLARARICISA+H+REDLI+AL+
Sbjct  362  ECLRQKVAVVVVGFPATPLLLARARICISASHSREDLIRALK  403



>ref|XP_009411041.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=483

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA S+E+IQ+LK+ CPAHLYATS+SPPA QQ ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASEEIIQHLKHGCPAHLYATSMSPPAVQQAISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLARIRE+SN+FRSEL+KMGF VLGDNDSPVM IMLYN +K+PAFSR
Sbjct  357  VVLGEDGSNRGAKKLARIRESSNYFRSELKKMGFVVLGDNDSPVMAIMLYNLAKLPAFSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
             CLRQNVAVV V +PATP+LLARARICISA+HTREDLIK L+VI  VG LVG K  PAEP
Sbjct  417  ACLRQNVAVVIVGYPATPVLLARARICISASHTREDLIKGLKVIGEVGGLVGAKCLPAEP  476

Query  220  KKQQ  209
            +K +
Sbjct  477  EKAK  480



>ref|XP_002978032.1| hypothetical protein SELMODRAFT_108076 [Selaginella moellendorffii]
 gb|EFJ20689.1| hypothetical protein SELMODRAFT_108076 [Selaginella moellendorffii]
Length=477

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD AD+D+MMGTFTKS GS GGYIAGSK+LI YLK   P H+YAT++SPP AQQ+ISA+K
Sbjct  300  VDPADIDVMMGTFTKSFGSSGGYIAGSKDLIAYLKSISPGHMYATAMSPPVAQQVISAMK  359

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI+GEDG+ RGA KLA++RENSN+FR EL+KMGFEVLGD DSPVMPIMLYNP+KIPAFSR
Sbjct  360  VIIGEDGTDRGARKLAQVRENSNYFRQELRKMGFEVLGDRDSPVMPIMLYNPAKIPAFSR  419

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYF  233
            ECLR+NVAVVTVAFPATPLLLARARICISA+HT+EDL +ALEVIS VGDLV IKYF
Sbjct  420  ECLRRNVAVVTVAFPATPLLLARARICISASHTKEDLEQALEVISEVGDLVHIKYF  475



>ref|XP_009394362.1| PREDICTED: long chain base biosynthesis protein 2d-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD AD+DIMMGTFTKS GSCGGYIA S+E+I+YLK+ CPAHLYATS+SP A QQ+ISAIK
Sbjct  298  VDPADIDIMMGTFTKSFGSCGGYIAASEEIIRYLKHACPAHLYATSMSPAAVQQVISAIK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+LGEDGS+RGA+KLA+IRE SN+FRSEL+KMGF VLGDNDSPVM IMLYN +K+PAFSR
Sbjct  358  VVLGEDGSNRGAKKLAQIREGSNYFRSELKKMGFVVLGDNDSPVMAIMLYNLAKLPAFSR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
             CLRQNVAVVTV +PATP+LLARARICISA+HTREDL K L+VIS VG LVG K  PAEP
Sbjct  418  ACLRQNVAVVTVGYPATPVLLARARICISASHTREDLNKGLKVISEVGGLVGAKCLPAEP  477

Query  220  KK  215
            +K
Sbjct  478  EK  479



>ref|XP_002966707.1| hypothetical protein SELMODRAFT_86377 [Selaginella moellendorffii]
 gb|EFJ32734.1| hypothetical protein SELMODRAFT_86377 [Selaginella moellendorffii]
Length=477

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD AD+D+MMGTFTKS GS GGYIAGSK+LI YLK   P H+YAT++SPP AQQ+ISA+K
Sbjct  300  VDPADIDVMMGTFTKSFGSSGGYIAGSKDLIAYLKSISPGHMYATAMSPPVAQQVISAMK  359

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI+GED + RGA KLA++RENSN+FR EL+KMGFEVLGD DSPVMPIMLYNP+KIPAFSR
Sbjct  360  VIIGEDDTDRGARKLAQVRENSNYFRQELRKMGFEVLGDRDSPVMPIMLYNPAKIPAFSR  419

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYF  233
            ECLR+NVAVVTVAFPATPLLLARARICISA+HT+EDL +ALEVIS VGDLV IKYF
Sbjct  420  ECLRRNVAVVTVAFPATPLLLARARICISASHTKEDLEQALEVISEVGDLVHIKYF  475



>ref|XP_001783810.1| predicted protein [Physcomitrella patens]
 gb|EDQ51402.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD A++D+MMGTFTKS GSCGGYIAGSKELIQY+K   PAH+YATS+S PA QQ+ISA++
Sbjct  298  VDPANIDVMMGTFTKSFGSCGGYIAGSKELIQYMKSASPAHMYATSMSTPAVQQVISALE  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILG DGS RGA+KLA++RENSN+ R EL+  GFEVLGD DSPVMP+MLYNP KIPAFSR
Sbjct  358  VILGLDGSDRGAKKLAQVRENSNYVRIELRNRGFEVLGDMDSPVMPVMLYNPGKIPAFSR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++NVAVV VAFPATPLLLAR R+C+SA+HTREDL +A++V+S VG++  IKYFP + 
Sbjct  418  ECLKRNVAVVVVAFPATPLLLARTRVCMSASHTREDLDQAVKVLSEVGEMCNIKYFPRKA  477

Query  220  KKQQ  209
             + +
Sbjct  478  SENE  481



>ref|XP_008778939.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=554

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIA SKE+IQYLKYTCPAHLYATS+SPPA QQ+ISAIK
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAASKEIIQYLKYTCPAHLYATSMSPPAVQQVISAIK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +ILGEDGS+RGA+KLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  357  IILGEDGSNRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  416

Query  400  ECLRQN  383
            ECLRQN
Sbjct  417  ECLRQN  422



>gb|EEC72089.1| hypothetical protein OsI_05034 [Oryza sativa Indica Group]
Length=337

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  679  KELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRS  500
            KE+IQ+LK TCP+H+Y TS+SPPA QQ+ISA+KVILGEDG+ RGA+K+A+IR+NSNFFRS
Sbjct  173  KEIIQHLKLTCPSHIYGTSMSPPAVQQVISAMKVILGEDGTDRGAKKIAQIRDNSNFFRS  232

Query  499  ELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtvafpatPLLLARARIC  320
            ELQKMGFEVLGDNDSPVMP M+YNP+K+PAFSRECL+QNVAVV V FPATPLLL R RIC
Sbjct  233  ELQKMGFEVLGDNDSPVMPFMVYNPAKMPAFSRECLKQNVAVVPVGFPATPLLLGRIRIC  292

Query  319  ISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  185
            ISA+H+REDLIK LEVIS VGDLVGIKY P E ++    E   KL
Sbjct  293  ISASHSREDLIKGLEVISNVGDLVGIKYLPVEQEETTSVEKPKKL  337



>ref|XP_008671350.1| PREDICTED: long chain base biosynthesis protein 2a-like [Zea 
mays]
Length=371

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYI  S E+IQ+LK++CP HLYATS+SPP  Q +ISAIK
Sbjct  226  VDRADVDIMMGTFTKSFGSCGGYIVASNEIIQHLKHSCPPHLYATSMSPPGVQHVISAIK  285

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDGS+RGA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSR
Sbjct  286  VILGEDGSNRGAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSR  345

Query  400  ECLRQ  386
            ECLRQ
Sbjct  346  ECLRQ  350



>ref|XP_002875926.1| hypothetical protein ARALYDRAFT_485233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52185.1| hypothetical protein ARALYDRAFT_485233 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 143/195 (73%), Gaps = 18/195 (9%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT DVDIMMGTFTKS GSCGGYIAGSK+LIQYLKY CPAHLYATSIS PAAQQ+IS IK
Sbjct  148  VDTCDVDIMMGTFTKSFGSCGGYIAGSKDLIQYLKYHCPAHLYATSISTPAAQQVISVIK  207

Query  580  VILGEDGSSRG-------AEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPS  422
            VILGED S+RG         K+ + +     F +ELQKMG      N++          S
Sbjct  208  VILGEDASNRGNSIKLDRGTKVGKNKREQQLFWAELQKMGHA----NNA-------LQSS  256

Query  421  KIPAFSRECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGI  242
            KI AFSR  L++N+AVV V+FPA PLLLARAR CIS +H REDLIKAL+VISRVGDL GI
Sbjct  257  KIAAFSRAWLQENLAVVVVSFPAIPLLLARARFCISVSHLREDLIKALKVISRVGDLTGI  316

Query  241  KYFPAEPKKQQLEEN  197
             YF A PKKQ+ E+N
Sbjct  317  IYFTAAPKKQEDEKN  331



>ref|XP_005647033.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE22489.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
Length=489

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GSCGGYIAG ++LI YL+   P H YATS++PPAAQQII+A++
Sbjct  297  VDPADVDIMMGTFTKSFGSCGGYIAGDRDLIAYLRSVAPGHYYATSMAPPAAQQIIAALQ  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            V+ G+DG+ RG+ K+A + ENSN+FR  L  MG  VLGD DSPVMP+ML+NP KI A SR
Sbjct  357  VVSGQDGTDRGSRKIAALHENSNYFRRRLLDMGCNVLGDWDSPVMPLMLFNPGKIAATSR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
             C  + VA+V V FPATPLL ARARICISA+HTR+DL  ALEV+S   DLV  KY
Sbjct  417  LCWERGVALVVVGFPATPLLTARARICISASHTRKDLDYALEVLSEACDLVMTKY  471



>ref|XP_005848468.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
 gb|EFN56366.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
Length=510

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTAD+D+MMGTFTKS GSCGGYIAGS EL+Q+L+  CPAHLYAT++SPPA + +ISA  
Sbjct  314  VDTADIDVMMGTFTKSFGSCGGYIAGSAELVQFLRCQCPAHLYATAMSPPAVEMVISAFH  373

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI G DGS RGA K+ ++R N+N+FR  L ++G+ VLGD DSPVMPIML+NP+K+PA SR
Sbjct  374  VISGRDGSGRGAAKIGQLRANANYFRRRLLELGYNVLGDWDSPVMPIMLFNPAKLPAISR  433

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
              LR+ +A+V V FPATPLL AR R+CISA+HT+ DL  ALEV   V     ++Y
Sbjct  434  YMLRRGLAIVVVGFPATPLLTARMRVCISASHTKADLDYALEVFEEVAGRCHLRY  488



>emb|CDX87006.1| BnaC03g52760D [Brassica napus]
Length=406

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  601  QIISAIKVILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPS  422
            QIISAI+VILGEDGS+RGA+KLARIRENSN+FRSEL+ MGF+VLGD DSPVMPIMLY+P+
Sbjct  267  QIISAIRVILGEDGSNRGAQKLARIRENSNYFRSELRNMGFKVLGDVDSPVMPIMLYHPA  326

Query  421  KIPAFSRECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGI  242
            KIPAFSRECLR+NVA+  V FPATPL+L RARICISA+H+++DLIKALEVIS+VGDL G+
Sbjct  327  KIPAFSRECLRENVAIAVVGFPATPLMLGRARICISASHSKQDLIKALEVISKVGDLTGV  386

Query  241  KYFPAEPKKQQLEENRLKL  185
            KYFPA PKKQ+ E++ +KL
Sbjct  387  KYFPAAPKKQEEEKDTIKL  405



>ref|XP_005917126.1| PREDICTED: serine palmitoyltransferase 2-like [Haplochromis burtoni]
Length=241

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D+ DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP AQQII+++K
Sbjct  46   LDSKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMK  105

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ +N+ FFR  L +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  106  IIMGEDGTTLGADRLRQLSQNTTFFRRRLHEMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  165

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  166  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  220



>emb|CAG00103.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=491

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL++   + LYATS+SPP AQQII+++K
Sbjct  315  LDPKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRWHSHSALYATSMSPPVAQQIITSMK  374

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ EN+ +FR +L +MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  375  IIMGEDGTTLGADRLRQLSENTTYFRRKLHEMGFILYGNNDSPVVPLMLYMPAKIGAFGR  434

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR CISAAHTRE L  AL+ IS VGDL+ +KY
Sbjct  435  EMLKRNIGTVVVGFPATPIIESRARFCISAAHTREMLDTALQAISEVGDLLQLKY  489



>ref|XP_003971560.1| PREDICTED: serine palmitoyltransferase 2-like [Takifugu rubripes]
Length=565

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL++   + LYATS+SPP AQQII+++K
Sbjct  370  LDPKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRWHSHSALYATSMSPPVAQQIITSMK  429

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L+++ EN+ +FR +L +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  430  IIMGEDGTTLGADRLSQLSENTTYFRRKLHEMGFILYGNDDSPVVPLMLYMPAKIGAFGR  489

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  AL+ IS VGDL+ +KY
Sbjct  490  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALQAISEVGDLLQLKY  544



>ref|XP_011401811.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28766.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=490

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V +AD+D++MGTF+KS G+CGGY+A +K++I Y K  CPAHLYAT+++PPA Q ++SA++
Sbjct  298  VSSADIDVLMGTFSKSFGACGGYVAANKDVIDYFKAQCPAHLYATAMTPPAVQMVLSALR  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I G DGS RGA KL+++R N+N+FRS L ++GF VLGD DSPVMP+M++ P+K+ A SR
Sbjct  358  LITGADGSDRGAHKLSQLRTNANYFRSGLLRLGFNVLGDWDSPVMPVMIFQPAKLSATSR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E LR  VAVV V FPATPLL +R R+CISA+HTR+DL  AL++   V +   I+Y
Sbjct  418  EMLRLGVAVVEVGFPATPLLTSRMRVCISASHTRQDLDYALQLFDYVAERCDIRY  472



>ref|XP_008280215.1| PREDICTED: serine palmitoyltransferase 2-like [Stegastes partitus]
Length=564

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + LYATS+SPP AQQII+++K
Sbjct  369  LDPKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRRHSHSALYATSMSPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ EN+ +FR +L++MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGTTLGADRLRQLSENTTYFRRKLREMGFIIYGNDDSPVVPMMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTRETLNTALEAISEVGDLLQLKY  543



>ref|XP_005724923.1| PREDICTED: serine palmitoyltransferase 2-like [Pundamilia nyererei]
Length=564

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D+ DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP AQQII+++K
Sbjct  369  LDSKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ +N+ FFR  L +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGTTLGADRLRQLSQNTTFFRRRLHEMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_010789508.1| PREDICTED: serine palmitoyltransferase 2-like, partial [Notothenia 
coriiceps]
Length=243

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYIAG +ELI+YL+    + +YA+S+SPP  +QII+++K
Sbjct  46   LDPCDVDVMMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYASSMSPPVVEQIITSMK  105

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G +++ ++ +N+ +FR +LQKMGF + G+ DSPV+P+MLY P+KI AFSR
Sbjct  106  CIMGEDGTTIGCDRVHQLAKNAVYFRRKLQKMGFIIYGNEDSPVVPMMLYMPAKIAAFSR  165

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR CISAAHT++ L +AL VIS VGDLV +KY
Sbjct  166  EMLKRNIGVVGVGFPATPIIESRARFCISAAHTKDVLDRALSVISEVGDLVNLKY  220



>ref|XP_003440868.1| PREDICTED: serine palmitoyltransferase 2-like [Oreochromis niloticus]
Length=564

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D+ DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP AQQII+++K
Sbjct  369  LDSKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ +N+ +FR  L +MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGTTLGADRLRQLSQNTTYFRRSLHEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_007566208.1| PREDICTED: serine palmitoyltransferase 2 [Poecilia formosa]
Length=564

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS++PP AQQII+++K
Sbjct  369  LDPRDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMAPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG+S G ++L ++ EN+N+FR  L++MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  TIMGEDGTSLGTDRLRQLSENTNYFRRRLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_010880781.1| PREDICTED: serine palmitoyltransferase 2-like [Esox lucius]
Length=584

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G +ELI YL+    + +YATS+SPP AQQII+++K
Sbjct  376  LDPKDVDIMMGTFTKSFGAAGGYIGGKRELIDYLRSHSHSAIYATSMSPPVAQQIITSMK  435

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ EN+ +FR +L++MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  436  IIMGEDGTTLGADRLRQLSENTTYFRRKLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGR  495

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTR+ L  ALE IS VGD++ +KY
Sbjct  496  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTRDMLDTALEAISEVGDVLQLKY  550



>ref|XP_004083402.1| PREDICTED: serine palmitoyltransferase 2-like [Oryzias latipes]
Length=564

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + LYATS+SPP AQQIIS++K
Sbjct  369  LDPKDVDIMMGTFTKSFGAAGGYIGGRKELIDYLRCHSHSALYATSMSPPVAQQIISSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDGS+ G ++L ++ EN+ +FR +L++MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGSTLGKDRLRQLSENTTYFRRKLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  AL  IS VGDL+ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALRAISEVGDLLQLKY  543



>ref|XP_008310964.1| PREDICTED: serine palmitoyltransferase 2 isoform X1 [Cynoglossus 
semilaevis]
 ref|XP_008310965.1| PREDICTED: serine palmitoyltransferase 2 isoform X2 [Cynoglossus 
semilaevis]
Length=564

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + LYATS+SPP AQQII+++K
Sbjct  369  LDPNDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSALYATSMSPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDGS+ GA++L ++ +N+ +FR +L  MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGSTLGADRLRQLSQNTTYFRKKLWDMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGD++ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDIALEAISEVGDVLQLKY  543



>ref|XP_008396458.1| PREDICTED: serine palmitoyltransferase 2-like [Poecilia reticulata]
Length=564

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+ PP AQQII+++ 
Sbjct  369  LDPKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMPPPVAQQIITSMT  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ GA++L ++ EN+N+FR  L++MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  TIMGEDGTTLGADRLKQLSENTNYFRRRLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>ref|XP_004349889.1| serine palmitoyltransferase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89979.1| serine palmitoyltransferase [Capsaspora owczarzaki ATCC 30864]
Length=508

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDIMMGTFTKS GS GGY AGSKE+I +++    +  +ATS+S P AQQIIS++ 
Sbjct  321  VDPADVDIMMGTFTKSFGSAGGYCAGSKEIINHMRTHAHSSFHATSMSAPVAQQIISSMT  380

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI+G DG+  G  ++A++ +N+ FFR+EL+KMGF V G++ SP++P+M++  SKI AFSR
Sbjct  381  VIMGRDGTDDGQRRIAQLADNARFFRTELKKMGFIVYGNDASPIVPLMIFQASKIAAFSR  440

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            ECL++ V +V V FPATP++ +RAR C+SA+HTREDL KAL VIS VG+L+G+K     P
Sbjct  441  ECLKRGVGIVVVGFPATPIITSRARFCLSASHTREDLEKALAVISEVGNLLGMKVSQKTP  500

Query  220  KK  215
             +
Sbjct  501  SR  502



>gb|ADY39561.1| putative serine palmitoyltransferase [Hottentotta judaicus]
Length=228

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = -3

Query  757  DTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKV  578
            D  DVDI+MGTFTKS G+ GGYIAGSK+LI YL+  C +  YATS+S P   QI SA+KV
Sbjct  44   DPKDVDILMGTFTKSFGAAGGYIAGSKDLINYLRSNCYSFSYATSMSSPVVCQITSAMKV  103

Query  577  ILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRE  398
            I+GEDG++ G +++ ++ +N+ +FR +L++ GF + G+ DSPV+P++LY P+KIPAF RE
Sbjct  104  IMGEDGTNEGQQRITQLAQNTRYFRQKLKEKGFIIYGNKDSPVVPLLLYMPAKIPAFVRE  163

Query  397  CLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
             L++ +A V VAFPATPL+ +RAR CISAAHTRE L KAL  I  VGDL+ +KY
Sbjct  164  LLKRGIATVGVAFPATPLVESRARFCISAAHTREMLDKALSAIDEVGDLLRLKY  217



>ref|XP_005809327.1| PREDICTED: serine palmitoyltransferase 2-like [Xiphophorus maculatus]
Length=564

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+ PP AQQII+++K
Sbjct  369  LDPKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMPPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ EN+N+FR  L +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGTTLGADRLRQLSENTNYFRRRLCEMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E +++N+  V V FPATP++ +RAR C+SAAHTRE L  ALE IS VGDL+ +KY
Sbjct  489  EMVKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALEAISEVGDLLQLKY  543



>gb|AAM82589.1|AF525281_1 serine palmitoyltransferase [Brassica oleracea]
Length=121

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  544  EKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavvtv  365
            +KLARIRENSNFFR+ELQKMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLR+NVAVV V
Sbjct  1    QKLARIRENSNFFRAELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRENVAVVVV  60

Query  364  afpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKKQQLEENRLKL  185
             FPATPLLLARARICISA+H+REDLIKAL+VIS+ GDL GIKYFPA  KKQ+  ++ +KL
Sbjct  61   GFPATPLLLARARICISASHSREDLIKALQVISKAGDLTGIKYFPAARKKQEEVKDTIKL  120

Query  184  E  182
            +
Sbjct  121  D  121



>ref|XP_002186044.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65514.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=486

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDTADVDI+MGTFTKS G+ GGY+A  +  IQ+L+ TC A     ++SP   QQ+++A K
Sbjct  306  VDTADVDILMGTFTKSFGAMGGYVAADRATIQHLRNTCAASSCHNALSPVVCQQVLTAFK  365

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI+GEDG++ G +KL  +R+NSN+FR  L++MG +VLG  DSPVMPIMLYNP KI AFSR
Sbjct  366  VIMGEDGTNIGKQKLQSLRDNSNYFRMRLEEMGLQVLGQYDSPVMPIMLYNPCKIAAFSR  425

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            EC ++ +AVV V FPA PLLL+RAR CISA H REDL +AL  I  + +++ ++Y
Sbjct  426  ECYKRGLAVVVVGFPAVPLLLSRARFCISAGHAREDLDRALAEIDEIAEVLKLRY  480



>emb|CDQ72138.1| unnamed protein product [Oncorhynchus mykiss]
Length=584

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G +ELI YL+    + +YAT++SPP +QQII+++K
Sbjct  376  LDPKDVDIMMGTFTKSFGAAGGYIGGKRELIDYLRSHSHSSIYATAMSPPVSQQIITSMK  435

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GED ++ GAE+L ++ EN+ +FR +L++MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  436  IIMGEDNTTLGAERLKQLSENTTYFRRKLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGR  495

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTR+ L  ALE IS VGD++ +KY
Sbjct  496  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTRDMLDTALEAISEVGDVLQLKY  550



>ref|NP_001108213.1| serine palmitoyltransferase, long chain base subunit 2b [Danio 
rerio]
 gb|AAI59261.1| Zgc:175221 protein [Danio rerio]
Length=558

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D +DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  QQII+++K
Sbjct  364  LDPSDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRLHSHSAVYATSMSPPITQQIITSMK  423

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E+L ++ EN+ +FR  L +MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  424  CIMGKDGTTLGQERLRQLSENTTYFRRRLHEMGFIIYGNNDSPVVPLMLYMPAKIGAFGR  483

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+  V V FPATP++ +RAR C+SAAHTRE L  AL  IS VGDL+ +KY
Sbjct  484  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALNAISEVGDLLQLKY  538



>ref|XP_010739223.1| PREDICTED: serine palmitoyltransferase 2 [Larimichthys crocea]
Length=564

 Score =   196 bits (499),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS    GGYI G KELI YL+    + LYATS+SPP AQQII+A++
Sbjct  369  LDPKDVDIMMGTFTKSFNGAGGYIGGKKELIDYLRCHSHSALYATSMSPPVAQQIITAMR  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG+++GA +L ++ EN+ +FR +L  MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGTTQGAHRLRQLSENTAYFRRKLNDMGFIIYGNKDSPVVPMMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ +V V FPATP+  +RAR CISAAHTRE L + L+VI  VGDL+ +KY
Sbjct  489  EMLKRNIGIVAVGFPATPITESRARFCISAAHTREVLDQVLDVIDEVGDLLSLKY  543



>ref|XP_005820282.1| hypothetical protein GUITHDRAFT_98377 [Guillardia theta CCMP2712]
 gb|EKX33302.1| hypothetical protein GUITHDRAFT_98377 [Guillardia theta CCMP2712]
Length=694

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+  DVD+MMGTFTKS GS GGYIA +KE+I Y++   P  +YA S+SP    Q   A++
Sbjct  359  VEPVDVDVMMGTFTKSFGSVGGYIASTKEVIDYIRRMSPGSIYACSMSPGCVTQASLALR  418

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I GEDG+ +G +KL ++R NSN FR+ LQ+MG EVLG  DSPV+P+MLYNP+KIPAFSR
Sbjct  419  MIAGEDGTDKGKKKLDQLRRNSNLFRAGLQRMGCEVLGHTDSPVIPVMLYNPAKIPAFSR  478

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            ECL + +AVV V FPATPL+ +R R C+SAAHT EDLI AL+VI  V + V IKY
Sbjct  479  ECLARKLAVVVVGFPATPLIKSRVRFCLSAAHTEEDLISALKVIDEVAERVMIKY  533



>emb|CAF94268.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=511

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++ +DVD+MMGTFTKS G+ GGYIAG KELI+YL+    + +YATS+SPP  +QII+++K
Sbjct  314  LEPSDVDVMMGTFTKSFGAAGGYIAGKKELIEYLRSHSHSAVYATSMSPPVVEQIITSMK  373

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             ++GEDG++ G E++ R+ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  374  CVMGEDGTTIGRERIRRLAENTVYFRKRLREMGFTIYGNQDSPVIPMMLYMPAKIGAFGR  433

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +R R CISAAHT++ L +AL VIS VGDL+ +KY
Sbjct  434  EMLKRNMGVVVVGFPATPIIESRVRFCISAAHTKQILDQALSVISEVGDLLQLKY  488



>tpg|DAA46316.1| TPA: hypothetical protein ZEAMMB73_317015 [Zea mays]
Length=500

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -3

Query  550  GAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavv  371
            GA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ V VV
Sbjct  379  GAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVVVV  438

Query  370  tvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  215
            TVAFPATPLLLARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP K
Sbjct  439  TVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPK  490



>ref|XP_004344667.1| serine palmitoyltransferase, long chain base subunit 2, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR20924.1| serine palmitoyltransferase, long chain base subunit 2, putative 
[Acanthamoeba castellanii str. Neff]
Length=516

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD  +VDI+MGTFTKS GS GGYIAG K+ ++YL+ T    +Y  ++S P AQ IISA+ 
Sbjct  339  VDPKEVDILMGTFTKSFGSVGGYIAGDKDFVRYLRQTSFCSMYEETMSIPCAQMIISALN  398

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI G DGS+ G +++  +R+NSNFFR++L+++GF V GD DSPV+P+MLY+P+KI  FSR
Sbjct  399  VITGADGSNEGQKRIKALRDNSNFFRNKLKELGFRVAGDEDSPVIPLMLYHPAKIAGFSR  458

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
             CL +NVAVV V FPAT LL +RAR CISA HTRE L +AL+ IS +GD + +KY
Sbjct  459  LCLLENVAVVVVGFPATSLLASRARFCISAGHTREQLERALDSISDIGDRLMLKY  513



>ref|XP_003962837.1| PREDICTED: serine palmitoyltransferase 2-like [Takifugu rubripes]
Length=564

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K
Sbjct  367  LDPCDVDVMMGTFTKSFGAAGGYIAGKRELIEYLRTHSHSVVYATSMSPPVVEQIIASMK  426

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G E++ ++ EN+ +FR  L++MGF V G+ DSPV+P+MLY PSKI AF R
Sbjct  427  CIMGEDGTTVGQERIRQLAENTVYFRKRLREMGFTVYGNQDSPVIPMMLYMPSKIGAFGR  486

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +R R CISAAHT+  L KAL VIS VGDL+ +KY
Sbjct  487  EMLKRNIGVVVVGFPATPIIESRVRFCISAAHTKHLLDKALSVISEVGDLLQLKY  541



>ref|XP_006632191.1| PREDICTED: serine palmitoyltransferase 2-like [Lepisosteus oculatus]
Length=568

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  371  LDPTDVDIMMGTFTKSFGAAGGYIGGRKELIDYLRTHSHSAVYATSMSPPVVEQIITSMK  430

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G E++ ++ EN+ +FR +L++MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  431  CIMGEDGTTIGLERVQQLAENTRYFRRKLREMGFIIYGNDDSPVVPMMLYMPAKIGAFGR  490

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL VIS VGDL+ +KY    P
Sbjct  491  EMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDTALNVISEVGDLLQLKYSRHRP  550



>dbj|BAE21805.1| unnamed protein product [Mus musculus]
Length=266

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  69   LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMK  128

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG+S G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  129  CIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  188

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  189  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  243



>tpg|DAA63385.1| TPA: hypothetical protein ZEAMMB73_716052 [Zea mays]
Length=580

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -3

Query  550  GAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavv  371
            GA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ V VV
Sbjct  459  GAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVVVV  518

Query  370  tvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  215
            TVAFPATPLLLARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP K
Sbjct  519  TVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPK  570



>ref|XP_004542426.1| PREDICTED: serine palmitoyltransferase 2-like [Maylandia zebra]
Length=571

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D+ DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP AQQII+++K
Sbjct  369  LDSKDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRRHSHSAMYATSMSPPVAQQIITSMK  428

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++ GA++L ++ +N+ FFR  L +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  429  IIMGEDGTTLGADRLRQLSQNTTFFRRRLHEMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  488

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTRE--DLIKAL-----EVISRVGDLVGI  242
            E L++N+  V V FPATP++ +RAR C+SAAHTRE  D +  +     + IS VGDL+ +
Sbjct  489  EMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTVSPISNMKHKTISEVGDLLQL  548

Query  241  KY  236
            KY
Sbjct  549  KY  550



>ref|XP_003445532.1| PREDICTED: serine palmitoyltransferase 2-like isoform X1 [Oreochromis 
niloticus]
Length=571

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K
Sbjct  374  LDPCDVDVMMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMK  433

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G+E++ ++ EN+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF+R
Sbjct  434  CIMGEDGTTIGSERVQQLAENTVYFRKRLREMGFIIYGNNDSPVVPMMLYMPAKIAAFAR  493

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR CISA H++  L +AL VIS VGDL+ +KY
Sbjct  494  EMLKRNIGVVVVGFPATPIIESRARFCISAGHSKNMLDQALNVISEVGDLLQLKY  548



>dbj|BAC37842.1| unnamed protein product [Mus musculus]
Length=278

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  81   LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMK  140

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG+S G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  141  CIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  200

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  201  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  255



>tpg|DAA63387.1| TPA: hypothetical protein ZEAMMB73_716052 [Zea mays]
Length=638

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/112 (93%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -3

Query  550  GAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQNvavv  371
            GA+KLARIRENSNFFRSEL+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ V VV
Sbjct  517  GAQKLARIRENSNFFRSELKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQKVVVV  576

Query  370  tvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEPKK  215
            TVAFPATPLLLARARICISA+HTREDLIKAL+VISRVGDLVGIKYFPAEP K
Sbjct  577  TVAFPATPLLLARARICISASHTREDLIKALDVISRVGDLVGIKYFPAEPPK  628



>ref|XP_005750502.1| PREDICTED: serine palmitoyltransferase 2-like [Pundamilia nyererei]
Length=571

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K
Sbjct  374  LDPCDVDVMMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMK  433

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G+E++ ++ EN+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  434  CIMGEDGTTIGSERVQQLAENTVYFRKRLREMGFIIYGNNDSPVVPLMLYMPAKIGAFGR  493

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR CISA H++  L +AL VIS VGDL+ +KY
Sbjct  494  EMLKRNIGVVVVGFPATPIIESRARFCISAGHSKNMLDQALNVISEVGDLLQLKY  548



>gb|EFA83279.1| serine C-palmitoyltransferase subunit [Polysphondylium pallidum 
PN500]
Length=508

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD  DVDI+MGTFTKS GS GGYIA  K LI +L+ +  A+LYA S++PP A Q   A++
Sbjct  328  VDPKDVDILMGTFTKSFGSIGGYIAADKSLIDHLRQSSFAYLYANSMAPPCAMQAYQALR  387

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I G+DG+  GA K+ +++ENSNFFR  L++MGF++LG  DSPV+P+M YNPSKI  FSR
Sbjct  388  AIAGDDGTDIGARKIKQLKENSNFFRERLRQMGFQILGGKDSPVVPLMFYNPSKIATFSR  447

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
             CL +++AVV V +PATPL   RAR C+SA+HTREDL  ALE +  +GD + +K+
Sbjct  448  MCLERHIAVVVVGYPATPLTSPRARFCLSASHTREDLEWALEHLDTIGDQMNLKF  502



>ref|XP_008275494.1| PREDICTED: serine palmitoyltransferase 2-like [Stegastes partitus]
Length=567

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K
Sbjct  370  LDPCDVDVMMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMK  429

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G +++ ++ EN+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  430  CIMGEDGTTIGCDRVRQLAENTVYFRKRLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGR  489

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR CISAAH+++ L +AL VIS VGDL+ +KY
Sbjct  490  EMLKRNIGVVVVGFPATPIIESRARFCISAAHSKDMLDRALSVISEVGDLLQLKY  544



>ref|XP_010118582.1| PREDICTED: serine palmitoyltransferase 2, partial [Chlamydotis 
macqueenii]
Length=327

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  134  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMKCIMG  193

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  194  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  253

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  254  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  304



>dbj|GAM19483.1| hypothetical protein SAMD00019534_026580 [Acytostelium subglobosum 
LB1]
Length=489

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDI+MGTFTKS GS GGYIAG    I YL+ +  ++LYA S++P  A Q   A++
Sbjct  312  VDPADVDILMGTFTKSFGSIGGYIAGDAPFINYLRQSSYSYLYANSMAPACAMQAYQALR  371

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I GEDG+  GA K+ ++++NSNFFR  L++MGF++LG  DSPV+P+M YNPSKI AFSR
Sbjct  372  TIAGEDGTDIGARKIKQLKDNSNFFRERLRQMGFQILGGRDSPVVPMMFYNPSKISAFSR  431

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
             CL +++AVV V +PATPL   RAR C+SA+HTREDL  ALE +  +G+ + +KY
Sbjct  432  MCLERHIAVVVVGYPATPLTAPRARFCLSASHTREDLEWALEHLEDIGEQLQLKY  486



>ref|XP_002287833.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95276.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=622

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ++VD++MGTFTKS G  GGYIA  K ++  L+  C    Y  S+SP   QQIIS+ K
Sbjct  442  VDPSEVDVLMGTFTKSFGGMGGYIAADKRVVDMLRKECAGSAYHNSLSPVVCQQIISSFK  501

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI+GEDG++ G +KL  +R+NSN+FR  L  MG  VLG+ DSP+MP+MLYNP+KI AFSR
Sbjct  502  VIMGEDGTNIGKQKLNALRDNSNYFRMRLTDMGLHVLGNYDSPIMPVMLYNPTKIAAFSR  561

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            ECL++ +AVV V FPA P+L++RAR CISA HTRE+L +AL+ +  + DL+ ++Y
Sbjct  562  ECLKRGLAVVVVGFPAVPILMSRARFCISAGHTREELDRALKELDEITDLLKLRY  616



>ref|XP_006036023.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2, 
partial [Alligator sinensis]
Length=459

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  262  LNPEDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMK  321

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G E + ++ EN+ +FR +L+KMGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  322  CIMGEDGTTSGKECVQQLAENTRYFRRQLKKMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  381

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  382  EMLKRNIGVVVVGFPATPIVESRARFCVSAAHTKEMLDTALKEINEVGDLLQLKY  436



>gb|EPZ34220.1| Pyridoxal phosphate-dependent transferase domain-containing protein 
1 [Rozella allomycis CSF55]
Length=486

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V T  +DIMMGTFTKS G+ GGYIA SK++I +LK +C AHLYA  I  P  QQII+++K
Sbjct  303  VPTDKIDIMMGTFTKSFGAAGGYIASSKKIIDHLKTSCHAHLYAEPIPTPVVQQIITSMK  362

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+G DG+  GA+ L+ I  NS +F  +L+  GF V GD  SPV+P++L+NP+KIPAFSR
Sbjct  363  IIMGLDGTDTGAKLLSSIYRNSKYFMGKLKDKGFIVYGDEGSPVVPLLLFNPAKIPAFSR  422

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIK  239
            ECL++ +AVV V +PATP++ +R R CISAAHT+EDL  AL VI  VGDL+ +K
Sbjct  423  ECLKRGIAVVVVGYPATPIITSRVRFCISAAHTKEDLDFALSVIDEVGDLLQLK  476



>ref|XP_002734813.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=553

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYIAG+KELI +LK+   + +YATS+SPP AQQIIS++K
Sbjct  354  MDPRDVDIMMGTFTKSFGAAGGYIAGTKELIAHLKFRSHSSVYATSMSPPVAQQIISSMK  413

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G DG++ G+++L R+  N+ +FR  L +MGF V G++DSPV+P+++Y PSK+ AF R
Sbjct  414  SIMGLDGTNTGSQRLQRLAWNTRYFRRRLHEMGFIVYGNDDSPVVPLLIYLPSKVVAFCR  473

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY--FPA  227
            ECL++ + VV V FPAT ++  RAR C+SA+HT+E L  AL+VI  V  ++ +KY   P 
Sbjct  474  ECLKRKLGVVVVGFPATSIIGGRARFCMSASHTKEMLDTALDVIKEVETILQLKYSKLPI  533

Query  226  EPKKQQLEEN  197
            E K +  E++
Sbjct  534  EKKTELTEQD  543



>ref|XP_009948862.1| PREDICTED: serine palmitoyltransferase 2, partial [Leptosomus 
discolor]
Length=350

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+ +  + +YATS+SPP  +QII+++K I+G
Sbjct  157  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTSSHSAVYATSLSPPVVEQIITSMKCIMG  216

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  217  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  276

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  277  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDMALKEINEVGDLLQLKY  327



>ref|XP_002951879.1| hypothetical protein VOLCADRAFT_92508 [Volvox carteri f. nagariensis]
 gb|EFJ46984.1| hypothetical protein VOLCADRAFT_92508 [Volvox carteri f. nagariensis]
Length=938

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VDT DVDIMMGTFTKS GSCGGYIAG +E+I YL+   PAHLYA S++P   +Q+ +A++
Sbjct  617  VDTRDVDIMMGTFTKSFGSCGGYIAGRREIIDYLRRHSPAHLYACSMAPGCVKQVTTALQ  676

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VI+G DG+ RG  K+ ++ +N+N+ RS L  MG +VLG  DSPVMPIM Y+ +K+ A SR
Sbjct  677  VIMGLDGTDRGKRKIEQLHDNANYVRSRLLTMGMDVLGSWDSPVMPIMTYSAAKMVALSR  736

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
              L +N+A+V V FPATP+LL R RICISAAHTREDL  ALE +  V DL  ++Y
Sbjct  737  MTLARNIAMVIVGFPATPVLLTRTRICISAAHTREDLDWALEQLEEVADLCMLRY  791



>ref|XP_007248546.1| PREDICTED: serine palmitoyltransferase 2 [Astyanax mexicanus]
Length=633

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  436  LDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMK  495

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G E++ ++ EN+ +FR  L+++GF + G+NDSPV+P+MLY P+KI AF R
Sbjct  496  CIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSPVVPVMLYMPAKIGAFGR  555

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SA+HT+E L +AL  IS VGDL+ +KY
Sbjct  556  EMLKRNIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAISEVGDLLQVKY  610



>ref|NP_001085763.1| serine palmitoyltransferase, long chain base subunit 2 [Xenopus 
laevis]
 gb|AAH73312.1| MGC80715 protein [Xenopus laevis]
Length=555

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS GS GGYI GSK LI YL+    +  YATS+SPP AQQIIS++K
Sbjct  358  LDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIDYLRAHSHSSAYATSMSPPVAQQIISSMK  417

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDGS+ G + + ++ EN+ +FR  L +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  418  CIMGEDGSTVGRKHVEQLAENTKYFRHRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGR  477

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL  I+ VGDL+ +KY
Sbjct  478  EMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKY  532



>ref|XP_002734812.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=551

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 140/193 (73%), Gaps = 6/193 (3%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYIAG+KELI +LK+   + +YA S+SPP AQQIIS+++
Sbjct  354  MDPRDVDIMMGTFTKSFGAAGGYIAGTKELIAHLKFHSHSSVYAISMSPPVAQQIISSMQ  413

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G DG++ G  +L ++  N+ +FR  L +MGF + G +DSPV+P+MLY P+KI AF R
Sbjct  414  CIMGLDGTNTGRHRLRQLAWNTRYFRRRLHEMGFLIYGSDDSPVVPLMLYMPAKIGAFGR  473

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY--FPA  227
            ECL++N+ VV V FPAT ++ +RAR C+SAAHT+E L +ALE+I   G ++ ++Y   P 
Sbjct  474  ECLKRNLGVVVVGFPATTIIESRARFCLSAAHTKEMLDQALEMIEEAGTVLHLRYSRLPL  533

Query  226  EPK----KQQLEE  200
            E K      +LEE
Sbjct  534  EKKTAITSHELEE  546



>ref|XP_002613183.1| hypothetical protein BRAFLDRAFT_210501 [Branchiostoma floridae]
 gb|EEN69192.1| hypothetical protein BRAFLDRAFT_210501, partial [Branchiostoma 
floridae]
Length=483

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD  DVDIMMGTFTKS G+ GGYIAGSK LI +L+    +  YA S+S P AQQ+IS++K
Sbjct  308  VDPRDVDIMMGTFTKSFGAAGGYIAGSKRLINHLRAYSHSTTYACSMSAPVAQQVISSMK  367

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+GEDG++RG  ++ ++  NS +FR  L +MGF V G++DSP++P++LY P+KI AFSR
Sbjct  368  IIMGEDGTNRGQLRIKQLAANSKYFRQRLVEMGFIVYGNDDSPIVPVLLYMPAKIAAFSR  427

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E  +QNV VV V FPATPL+ +RAR C+SAAHTRE L K L+ IS VGD + +KY
Sbjct  428  ELYQQNVGVVVVGFPATPLVESRARFCLSAAHTREMLDKVLDAISDVGDRLQLKY  482



>ref|XP_011401812.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28767.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=760

 Score =   191 bits (485),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 98/177 (55%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V  AD+D++MGTF+KS G+CGGY+A +K++I Y    CPAHL+AT+++PPA Q ++SA++
Sbjct  298  VSPADIDVLMGTFSKSFGACGGYVAANKDVIDYFMAQCPAHLHATAMTPPAVQMVLSALR  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I G DGS RGA KL+++R N+N+FRS L  MGF VLGD DSPVMPIM++  +K+ A S 
Sbjct  358  LITGADGSDRGAHKLSQLRTNANYFRSRLLHMGFNVLGDWDSPVMPIMIFQLAKLSATSH  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFP  230
            E LR  VAVV V FPATPLL +R R+CISA+HTR+DL  AL++   V     I+  P
Sbjct  418  EMLRLGVAVVVVGFPATPLLTSRMRVCISASHTRQDLDYALQLFDYVATKCDIRDPP  474



>ref|XP_010214677.1| PREDICTED: serine palmitoyltransferase 2 [Tinamus guttatus]
Length=435

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  QQII+++K
Sbjct  238  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRIHSHSAVYATSLSPPVVQQIITSMK  297

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDGS+ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  298  CIMGEDGSTLGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  357

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  358  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDIALKEINEVGDLLQLKY  412



>ref|XP_005710134.1| serine palmitoyltransferase, LCB2 subunit [Chondrus crispus]
 emb|CDF39840.1| serine palmitoyltransferase, LCB2 subunit [Chondrus crispus]
Length=537

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++ +D+DIMMGTFTKS G+ GGYIA S  L++ ++    A LYA++++PP AQ I+ A  
Sbjct  339  INPSDIDIMMGTFTKSFGAVGGYIATSAALVERIRALSAASLYASAMAPPCAQHILWAFN  398

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             + G+DG+  GA K+  +R N+ +FR +L+KMG + LGD DSPV+PIMLYNP+KI AFSR
Sbjct  399  QMAGKDGTGIGAGKIRALRVNAIYFREQLRKMGVQTLGDWDSPVIPIMLYNPAKIAAFSR  458

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            EC ++ +AVV V FPATPLLL+RARIC+SAAHTREDL  AL VI +V +++ IKY
Sbjct  459  ECYKRGLAVVVVGFPATPLLLSRARICLSAAHTREDLDWALGVIDQVAEIIQIKY  513



>tpg|DAA38120.1| TPA: hypothetical protein ZEAMMB73_853430 [Zea mays]
Length=380

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -3

Query  676  ELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILGEDGSSRGAEKLARIRENSNFFRSE  497
            E+IQ+LK++CP HLYATS+SPP  Q +ISAIKVILGEDGS+RGA+KLARIRENSNFFRSE
Sbjct  231  EIIQHLKHSCPPHLYATSMSPPGVQHVISAIKVILGEDGSNRGAQKLARIRENSNFFRSE  290

Query  496  LQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLRQ  386
            L+KMGFEVLGDNDSPVMPIMLYNP+KIPAFSRECLRQ
Sbjct  291  LKKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQ  327



>ref|NP_001018455.1| serine palmitoyltransferase 2 [Danio rerio]
 gb|AAH95355.1| Serine palmitoyltransferase, long chain base subunit 2 [Danio 
rerio]
 gb|AAI65370.1| Sptlc2 protein [Danio rerio]
Length=534

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G K+LI YL+    + +YA+S+S P  +QII+++K
Sbjct  337  LDPRDVDIMMGTFTKSFGAAGGYIGGRKDLIDYLRTHSHSAVYASSMSAPVVEQIITSMK  396

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ R+ EN+ +FR  L++MGF + G+NDSPV+P+MLY P+KI AF R
Sbjct  397  CIMGEDGTTIGRSRIQRLAENTVYFRRRLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGR  456

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR CISAAH++E L +AL+VIS VGDL+ +KY
Sbjct  457  EMLKRNIGVVVVGFPATPIIESRARFCISAAHSKEMLDRALDVISEVGDLLQLKY  511



>ref|XP_009565075.1| PREDICTED: serine palmitoyltransferase 2 [Cuculus canorus]
Length=495

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  298  LDPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGEDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_010742461.1| PREDICTED: serine palmitoyltransferase 2-like [Larimichthys crocea]
Length=622

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYIAG +ELI+YL+    + +YATS+SPP  +QII+++K
Sbjct  425  LDPRDVDVMMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYATSMSPPVVEQIITSMK  484

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G +++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  485  CIMGEDGTTIGCDRVRQLAENTVYFRKRLREMGFIIYGNEDSPVVPMMLYMPAKIGAFGR  544

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++++ VV V FPATP++ +RAR CISAAHT+E L +AL VIS VGDL+ +KY
Sbjct  545  EMLKRDIGVVVVGFPATPIIESRARFCISAAHTKEMLDRALSVISEVGDLLQLKY  599



>ref|XP_010010806.1| PREDICTED: serine palmitoyltransferase 2 [Nestor notabilis]
Length=494

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  297  LNPEDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVK  356

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  357  CIMGEDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  416

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L +AL+ I  VGDL+ +KY
Sbjct  417  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDRALKEIDEVGDLLQLKY  471



>gb|EPY81318.1| serine palmitoyltransferase 2 [Camelus ferus]
Length=484

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  287  LDPEDVDIMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  346

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  347  CIMGQDGTTLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  406

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++NV VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  407  EMLKRNVGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  461



>emb|CCI48496.1| unnamed protein product [Albugo candida]
Length=482

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD  ++DI+MGTFTKS G  GGYIA S+E+I Y++      +YA S+SP  AQQ+++++K
Sbjct  302  VDPNEIDILMGTFTKSFGGMGGYIAASEEIISYIRTASAGSVYAASLSPVVAQQVLTSLK  361

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I+G DGS  G +KL  +RENSN+FR +L  MG   LG+ DSPV+P+ML+  SKIP FSR
Sbjct  362  IIMGTDGSDYGRKKLDALRENSNYFRQQLMNMGVVTLGNFDSPVIPVMLFCLSKIPEFSR  421

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPA  227
            +CL +N+AVVTV FPATPLLL+R R CISAAHT+EDL KAL+ I  V     I+Y  +
Sbjct  422  QCLERNLAVVTVGFPATPLLLSRVRFCISAAHTKEDLDKALKQIEEVSSNCNIRYLKS  479



>ref|XP_003441227.1| PREDICTED: serine palmitoyltransferase 3 isoform X1 [Oreochromis 
niloticus]
Length=549

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+TADVD+MMGTFTKS G+ GGYIAG KEL+ YL+    + +YAT++SPPA +QII A+K
Sbjct  354  VNTADVDVMMGTFTKSFGASGGYIAGKKELVDYLRTHSHSAVYATAMSPPATEQIIRAMK  413

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DGS+ G  ++ ++ EN+ +FRS L++MGF + G++DSPV+P++LY P+K+ AF+R
Sbjct  414  CIMGKDGSTEGMRRIRQLAENAKYFRSRLKEMGFIIYGNDDSPVVPVLLYMPAKVVAFAR  473

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L + + VV V FPATP+  ARAR C+SAAHTR+ L + L+ ++ VGDL+ +K+
Sbjct  474  EMLARKIGVVVVGFPATPITEARARFCVSAAHTRDMLNRVLDCMNEVGDLLCLKF  528



>ref|XP_005990149.1| PREDICTED: serine palmitoyltransferase 2 [Latimeria chalumnae]
Length=560

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KEL+ YL+    + +YATS+SPP  +QII+++K
Sbjct  363  LDPMDVDIMMGTFTKSFGAAGGYIGGRKELLAYLRSHSHSAVYATSMSPPIVEQIITSMK  422

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G +++ ++ EN+ +FR  L+KMGF + G++DSPV+P+MLY P+KI AF R
Sbjct  423  CIMGKDGTTIGQDRVQQLAENTRYFRGRLKKMGFIIYGNDDSPVVPLMLYMPAKIGAFGR  482

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYFPAEP  221
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY   +P
Sbjct  483  EMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDVALKEISEVGDLLQLKYSRHKP  542



>ref|XP_010876930.1| PREDICTED: serine palmitoyltransferase 2 [Esox lucius]
Length=569

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G +ELI YL+    + +YATS+SPP  +QII+++K
Sbjct  372  LDPRDVDVMMGTFTKSFGAAGGYIGGRRELIDYLRVHSHSAVYATSMSPPVVEQIITSMK  431

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G E++ R+ EN+ +FR ++ +MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  432  CIMGEDGTTLGRERVKRLAENTVYFRRKMTEMGFIIYGNSDSPVVPMMLYLPAKIGAFGR  491

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR CISAAHT++ L  AL VIS VGDL+ +KY
Sbjct  492  EMLKRNIGVVVVGFPATPIIESRARFCISAAHTKDMLDTALCVISEVGDLLQVKY  546



>ref|XP_006746809.1| PREDICTED: serine palmitoyltransferase 2 [Leptonychotes weddellii]
Length=423

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QI++++K
Sbjct  226  LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIVTSMK  285

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  286  CIMGQDGTTLGTECIQQLAENTKYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  345

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  346  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  400



>ref|XP_009317686.1| PREDICTED: serine palmitoyltransferase 2 [Pygoscelis adeliae]
Length=496

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  303  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  362

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  363  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  422

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  423  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  473



>ref|XP_005605438.1| PREDICTED: serine palmitoyltransferase 2 [Equus caballus]
Length=495

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QI++++K
Sbjct  298  LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIVTSMK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGQDGTTLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHTRE L  AL+ I  VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTREILDTALKEIDEVGDLLQLKY  472



>ref|XP_005936388.1| PREDICTED: serine palmitoyltransferase 3-like isoform X3 [Haplochromis 
burtoni]
Length=521

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+ ADVD+MMGTFTKS G+ GGYIAG KEL+ YL+    + +YAT++SPPA +QII A+K
Sbjct  326  VNPADVDVMMGTFTKSFGASGGYIAGKKELVDYLRTHSHSAVYATAMSPPATEQIIRAMK  385

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DGS+ G  ++ ++ EN+ +FRS L++MGF + G+NDSPV+P++LY P+K+ AF+R
Sbjct  386  CIMGKDGSTEGLRRIRQLAENTKYFRSRLKEMGFIIYGNNDSPVVPVLLYMPAKVVAFAR  445

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L + + VV V FPATP+  ARAR C+SAAHTR+ L + L+ ++ VGDL+ +K+
Sbjct  446  EMLARKIGVVVVGFPATPITEARARFCVSAAHTRDMLNQVLDCMNEVGDLLCLKF  500



>ref|XP_009512509.1| PREDICTED: serine palmitoyltransferase 2 [Phalacrocorax carbo]
Length=495

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  302  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  361

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  362  EDGTAVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  421

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHTRE L  AL+ I+ VGDL+ +KY
Sbjct  422  RNIGVVVVGFPATPIIESRARFCLSAAHTREMLDTALKEINEVGDLLQLKY  472



>ref|XP_005749399.1| PREDICTED: serine palmitoyltransferase 3-like isoform X2 [Pundamilia 
nyererei]
Length=522

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+ ADVD+MMGTFTKS G+ GGYIAG KEL+ YL+    + +YAT++SPPA +QII A+K
Sbjct  327  VNPADVDVMMGTFTKSFGASGGYIAGKKELVDYLRTHSHSAVYATAMSPPATEQIIRAMK  386

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DGS+ G  ++ ++ EN+ +FRS L++MGF + G+NDSPV+P++LY P+K+ AF+R
Sbjct  387  CIMGKDGSTEGLRRIRQLAENTKYFRSRLKEMGFIIYGNNDSPVVPVLLYMPAKVVAFAR  446

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L + + VV V FPATP+  ARAR C+SAAHTR+ L + L+ ++ VGDL+ +K+
Sbjct  447  EMLARKIGVVVVGFPATPITEARARFCVSAAHTRDMLNQVLDCMNEVGDLLCLKF  501



>ref|XP_009279012.1| PREDICTED: serine palmitoyltransferase 2 [Aptenodytes forsteri]
Length=495

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  302  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  361

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  362  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  421

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  422  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  472



>ref|XP_005502422.1| PREDICTED: serine palmitoyltransferase 2 [Columba livia]
Length=495

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  302  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTHSHSAVYATSMSPPVVEQIITSMKCIMG  361

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG+S G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  362  EDGTSVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  421

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  422  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009644944.1| PREDICTED: serine palmitoyltransferase 2 [Egretta garzetta]
Length=495

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  298  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG+S G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGEDGTSVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_006157148.1| PREDICTED: serine palmitoyltransferase 2 [Tupaia chinensis]
Length=536

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  339  LDPKDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  398

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G DG+S G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  399  CIMGHDGTSIGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  458

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ IS VGDL+ +KY
Sbjct  459  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEISEVGDLLQLKY  513



>ref|XP_010333697.1| PREDICTED: serine palmitoyltransferase 2 [Saimiri boliviensis 
boliviensis]
Length=488

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  291  LDPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  350

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG+S G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  351  CIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  410

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  411  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  465



>ref|XP_006778946.1| PREDICTED: serine palmitoyltransferase 2 [Myotis davidii]
Length=528

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  QQII+++K
Sbjct  331  LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVQQIITSMK  390

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  391  CIMGKDGTTLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  450

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  451  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  505



>gb|EHH62679.1| hypothetical protein EGM_21088, partial [Macaca fascicularis]
Length=517

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  320  LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  379

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG+S G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  380  CIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  439

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  440  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  494



>gb|EHH28079.1| hypothetical protein EGK_18422, partial [Macaca mulatta]
Length=518

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  321  LDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  380

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG+S G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  381  CIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  440

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  441  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  495



>ref|XP_004559826.1| PREDICTED: serine palmitoyltransferase 3-like [Maylandia zebra]
Length=549

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+ ADVD+MMGTFTKS G+ GGYIAG KEL+ YL+    + +YAT++SPPA +QII A+K
Sbjct  354  VNPADVDVMMGTFTKSFGASGGYIAGKKELVDYLRTHSHSAVYATAMSPPATEQIIRAMK  413

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DGS+ G  ++ ++ EN+ +FRS L++MGF + G+NDSPV+P++LY P+K+ AF+R
Sbjct  414  CIMGKDGSTEGLRRIRQLAENTKYFRSRLKEMGFIIYGNNDSPVVPVLLYMPAKVVAFAR  473

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L + + VV V FPATP+  ARAR C+SAAHTR+ L + L+ ++ VGDL+ +K+
Sbjct  474  EMLARKIGVVVVGFPATPITEARARFCVSAAHTRDMLNQVLDCMNEVGDLLCLKF  528



>ref|XP_005749398.1| PREDICTED: serine palmitoyltransferase 3-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005936387.1| PREDICTED: serine palmitoyltransferase 3-like isoform X2 [Haplochromis 
burtoni]
Length=549

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+ ADVD+MMGTFTKS G+ GGYIAG KEL+ YL+    + +YAT++SPPA +QII A+K
Sbjct  354  VNPADVDVMMGTFTKSFGASGGYIAGKKELVDYLRTHSHSAVYATAMSPPATEQIIRAMK  413

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DGS+ G  ++ ++ EN+ +FRS L++MGF + G+NDSPV+P++LY P+K+ AF+R
Sbjct  414  CIMGKDGSTEGLRRIRQLAENTKYFRSRLKEMGFIIYGNNDSPVVPVLLYMPAKVVAFAR  473

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L + + VV V FPATP+  ARAR C+SAAHTR+ L + L+ ++ VGDL+ +K+
Sbjct  474  EMLARKIGVVVVGFPATPITEARARFCVSAAHTRDMLNQVLDCMNEVGDLLCLKF  528



>ref|XP_009988351.1| PREDICTED: serine palmitoyltransferase 2 [Tauraco erythrolophus]
Length=490

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+ +  + +YATS+SPP  +QI++++K I+G
Sbjct  297  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTSSHSAVYATSMSPPVVEQIVTSMKCIMG  356

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  357  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  416

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  417  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  467



>ref|XP_005417509.1| PREDICTED: serine palmitoyltransferase 2 [Geospiza fortis]
Length=495

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYIAG KELI YL+    +  YATS+SPP  +QII+++K
Sbjct  298  LNPEDVDVMMGTFTKSFGAAGGYIAGKKELIDYLRTYSHSAAYATSMSPPVVEQIITSVK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGEDGTTIGRARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_011488917.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2-like 
[Oryzias latipes]
Length=574

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD++MGTFTKS G+ GGYIAG +ELI+YL+    + +YA S+SPP  +QII+++K
Sbjct  376  LDPRDVDVLMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYAASMSPPVVEQIITSMK  435

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG+S G ++L ++ EN+ +FR  L++MGF + G++DSPV+P+MLY P+KI AF R
Sbjct  436  CIMGDDGTSIGCKRLQQLAENTTYFRRRLREMGFIIYGNDDSPVIPMMLYMPAKIGAFGR  495

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPAT L+ +RAR CISAAH++E L  AL  IS VGD++ +KY
Sbjct  496  EMLKKNIGVVVVGFPATSLVESRARFCISAAHSKEILDTALSAISEVGDVLQLKY  550



>ref|XP_009580257.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2-like 
[Fulmarus glacialis]
Length=490

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  293  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMK  352

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  353  CIMGEDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  412

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  413  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  467



>ref|XP_005534958.1| serine palmitoyltransferase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80351.1| serine palmitoyltransferase [Cyanidioschyzon merolae strain 10D]
Length=724

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD  DVDI+MGTFTKS G+ GGY+A S+EL+ +L+ T P  LYA+++SP  A+ I+ A++
Sbjct  547  VDPRDVDILMGTFTKSFGAVGGYVAASRELVAHLRRTAPGALYASTMSPACAKHILFAMR  606

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I GEDG+  G  KL ++RENS +FR  L +MG + +G   SPV+PIMLY PS I  FSR
Sbjct  607  QISGEDGTDIGRRKLTQLRENSLYFRRRLLEMGLQTIGSTGSPVIPIMLYVPSVIAEFSR  666

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKYF  233
            ECL++ +AVV V FPATPL+L+R+RICISAAH+REDL  AL VI +V DL+ I+Y 
Sbjct  667  ECLKRGLAVVVVGFPATPLILSRSRICISAAHSREDLDFALNVIEQVADLLKIRYL  722



>ref|XP_009080576.1| PREDICTED: serine palmitoyltransferase 2 [Acanthisitta chloris]
Length=497

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  300  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVK  359

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  360  CIMGEDGTTVGRARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  419

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  420  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  474



>gb|EMC83907.1| Serine palmitoyltransferase 2, partial [Columba livia]
Length=518

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  325  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTHSHSAVYATSMSPPVVEQIITSMKCIMG  384

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG+S G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  385  EDGTSVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  444

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  445  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  495



>emb|CEG69772.1| Putative Aminotransferase class I/classII [Rhizopus microsporus]
Length=547

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D A+VDI+MGTFTKS G+ GGYIAG K +I YL+    A+ YA  +S P  QQ+I+++K
Sbjct  366  IDPAEVDILMGTFTKSFGAAGGYIAGDKAIIDYLRLRNHAYNYAEPMSVPVTQQVITSMK  425

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I GEDG+  G +K+ ++ ENS +F   L++MGF V GD  SPV+P++L+NP+KIPAFSR
Sbjct  426  IICGEDGTDIGRKKIKQLAENSLYFIERLREMGFIVYGDQGSPVIPLLLFNPAKIPAFSR  485

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIK  239
            E L++ +AVV V +PATP++ +RAR CIS+AHTREDL KALEVIS VGD + +K
Sbjct  486  ELLKRGIAVVVVGYPATPIITSRARFCISSAHTREDLDKALEVISEVGDTLLLK  539



>ref|XP_009885296.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Charadrius vociferus]
Length=495

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  302  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  361

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  362  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  421

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  422  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_002200055.2| PREDICTED: serine palmitoyltransferase 2 [Taeniopygia guttata]
Length=525

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVD+MMGTFTKS G+ GGYI G KELI YL+    +  YATS+SPP  +QII+++K
Sbjct  328  LDPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAAYATSMSPPVVEQIITSVK  387

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  388  CIMGEDGTTIGRARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  447

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  448  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  502



>ref|XP_005936386.1| PREDICTED: serine palmitoyltransferase 3-like isoform X1 [Haplochromis 
burtoni]
Length=562

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            V+ ADVD+MMGTFTKS G+ GGYIAG KEL+ YL+    + +YAT++SPPA +QII A+K
Sbjct  367  VNPADVDVMMGTFTKSFGASGGYIAGKKELVDYLRTHSHSAVYATAMSPPATEQIIRAMK  426

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DGS+ G  ++ ++ EN+ +FRS L++MGF + G+NDSPV+P++LY P+K+ AF+R
Sbjct  427  CIMGKDGSTEGLRRIRQLAENTKYFRSRLKEMGFIIYGNNDSPVVPVLLYMPAKVVAFAR  486

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L + + VV V FPATP+  ARAR C+SAAHTR+ L + L+ ++ VGDL+ +K+
Sbjct  487  EMLARKIGVVVVGFPATPITEARARFCVSAAHTRDMLNQVLDCMNEVGDLLCLKF  541



>ref|XP_008923197.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Manacus vitellinus]
Length=495

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  298  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGEDGTTIGRARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_005148932.1| PREDICTED: serine palmitoyltransferase 2 [Melopsittacus undulatus]
Length=495

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  298  LNPEDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSVK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG+  G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGEDGTIVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L +AL+ I  VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDRALKEIDEVGDLLQLKY  472



>ref|XP_009705333.1| PREDICTED: serine palmitoyltransferase 2 [Cariama cristata]
Length=491

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  298  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSMSPPVVEQIITSMKCIMG  357

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  358  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  417

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  418  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  468



>ref|XP_006263848.1| PREDICTED: serine palmitoyltransferase 2 [Alligator mississippiensis]
Length=614

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  417  LNPEDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMK  476

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG+  G E + ++ EN+ +FR +L+KMGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  477  CIMGEDGTISGKECVQQLAENTRYFRRQLKKMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  536

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  537  EMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDTALKEINEVGDLLQLKY  591



>ref|XP_006184643.1| PREDICTED: serine palmitoyltransferase 2 [Camelus ferus]
Length=579

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  382  LDPEDVDIMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  441

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  442  CIMGQDGTTLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  501

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++NV VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  502  EMLKRNVGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  556



>emb|CEI88574.1| Putative Serine palmitoyltransferase [Rhizopus microsporus]
Length=547

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D A+VDI+MGTFTKS G+ GGYIAG K +I YL+    A+ YA  +S P  QQ+I+++K
Sbjct  366  IDPAEVDILMGTFTKSFGAAGGYIAGDKAIIDYLRLRNHAYNYAEPMSVPVTQQVITSMK  425

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            +I GEDG+  G +K+ ++ ENS +F   L++MGF V GD  SPV+P++L+NP+KIPAFSR
Sbjct  426  IICGEDGTDIGRKKIKQLAENSLYFIERLREMGFIVYGDQGSPVIPLLLFNPAKIPAFSR  485

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIK  239
            E L++ +AVV V +PATP++ +RAR CIS+AHTREDL KALEVIS VGD + +K
Sbjct  486  ELLKRGIAVVVVGYPATPIITSRARFCISSAHTREDLDKALEVISEVGDTLLLK  539



>gb|EOB05513.1| Serine palmitoyltransferase 2, partial [Anas platyrhynchos]
Length=519

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  322  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMK  381

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  382  CIMGEDGTTFGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  441

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  442  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  496



>ref|XP_010842693.1| PREDICTED: serine palmitoyltransferase 2 [Bison bison bison]
Length=495

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G K LI YL+    + +YA S+SPP A+QII+A+K
Sbjct  298  LDPEDVDIMMGTFTKSFGASGGYIGGKKALIDYLRTHSHSAVYAASLSPPVAEQIITAMK  357

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN  +FR  L+ MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  358  CIMGQDGTTLGKECIQQLAENVRYFRRRLKSMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  417

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHTRE L  AL+ I  VGDL+ +KY
Sbjct  418  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTRETLDTALKEIDEVGDLLHLKY  472



>ref|XP_009937612.1| PREDICTED: serine palmitoyltransferase 2 [Opisthocomus hoazin]
Length=495

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  302  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  361

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  362  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  421

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL  I+ VGDL+ +KY
Sbjct  422  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALREINEVGDLLQVKY  472



>ref|XP_009973956.1| PREDICTED: LOW QUALITY PROTEIN: serine palmitoyltransferase 2 
[Tyto alba]
Length=492

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  299  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  358

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  359  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  418

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  419  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  469



>ref|XP_004359950.1| serine C-palmitoyltransferase subunit [Dictyostelium fasciculatum]
 gb|EGG22099.1| serine C-palmitoyltransferase subunit [Dictyostelium fasciculatum]
Length=497

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            VD ADVDI+MGTFTKS GS GGYIA  K LI +L+ +  A++YA+S+S P A Q  +A++
Sbjct  315  VDPADVDILMGTFTKSFGSIGGYIAADKSLIDHLRQSTFAYVYASSMSAPCAMQACAALR  374

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
            VILGEDG+  G  K+ ++++NSNFFR  L++MGF +L + DSPV+P+MLYNPSKI  FSR
Sbjct  375  VILGEDGTDLGQRKIKQLKDNSNFFREALREMGFTILSNKDSPVIPLMLYNPSKIARFSR  434

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
                +++AVV V +PATPL   R R CISA+H+REDL  ALE IS +GD + +K+
Sbjct  435  LAFERHIAVVVVGYPATPLTSPRTRFCISASHSREDLEWALEQISYIGDKLNLKH  489



>ref|XP_010946223.1| PREDICTED: serine palmitoyltransferase 2 [Camelus bactrianus]
Length=572

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  375  LDPEDVDIMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  434

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  435  CIMGQDGTTLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  494

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++NV VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  495  EMLKRNVGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  549



>ref|XP_009472775.1| PREDICTED: serine palmitoyltransferase 2 [Nipponia nippon]
Length=495

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  302  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  361

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  362  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  421

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  422  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  472



>ref|XP_009475844.1| PREDICTED: serine palmitoyltransferase 2 [Pelecanus crispus]
Length=500

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  DVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIKVILG  569
            DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K I+G
Sbjct  307  DVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMKCIMG  366

Query  568  EDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSRECLR  389
            EDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF RE L+
Sbjct  367  EDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLK  426

Query  388  QNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            +N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  427  RNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  477



>ref|XP_006206208.1| PREDICTED: serine palmitoyltransferase 2 [Vicugna pacos]
Length=579

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            +D  DVDIMMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  382  LDPEDVDIMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMK  441

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+G+DG++ G E + ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  442  CIMGQDGTTLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  501

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++NV VV V FPATP++ +RAR C+SAAHT+E L  AL+ I  VGDL+ +KY
Sbjct  502  EMLKRNVGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKY  556



>ref|XP_009907650.1| PREDICTED: serine palmitoyltransferase 2 [Picoides pubescens]
Length=517

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  VDTADVDIMMGTFTKSXGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISAIK  581
            ++  DVD+MMGTFTKS G+ GGYI G KELI YL+    + +YATS+SPP  +QII+++K
Sbjct  320  LNPEDVDVMMGTFTKSFGAAGGYIGGKKELIDYLRTYSHSAVYATSLSPPVVEQIITSMK  379

Query  580  VILGEDGSSRGAEKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPSKIPAFSR  401
             I+GEDG++ G  ++ ++ EN+ +FR  L++MGF + G+ DSPV+P+MLY P+KI AF R
Sbjct  380  CIMGEDGTTVGKARVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGR  439

Query  400  ECLRQNvavvtvafpatPLLLARARICISAAHTREDLIKALEVISRVGDLVGIKY  236
            E L++N+ VV V FPATP++ +RAR C+SAAHT+E L  AL+ I+ VGDL+ +KY
Sbjct  440  EMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEMLDTALKEINEVGDLLQLKY  494



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680