BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051J23

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIC34705.1|  omega-6 fatty acid desaturase                           404   2e-137   Rhus chinensis
ref|XP_006349589.1|  PREDICTED: omega-6 fatty acid desaturase, en...    400   5e-136   Solanum tuberosum [potatoes]
gb|ADK47520.1|  microsomal oleic acid desaturase                        399   2e-135   Wrightia tinctoria
ref|XP_009800247.1|  PREDICTED: omega-6 fatty acid desaturase, en...    398   3e-135   Nicotiana sylvestris
ref|XP_009592981.1|  PREDICTED: omega-6 fatty acid desaturase, en...    398   4e-135   Nicotiana tomentosiformis
gb|AGO32050.1|  microsomal oleate desaturase                            397   1e-134   Xanthoceras sorbifolium [yellow-horn]
ref|XP_004234773.1|  PREDICTED: omega-6 fatty acid desaturase, en...    396   2e-134   Solanum lycopersicum
gb|AIZ94608.1|  fatty acid desaturase 4                                 393   2e-134   Perilla frutescens [beefsteak-mint]
emb|CDP10136.1|  unnamed protein product                                399   2e-134   Coffea canephora [robusta coffee]
gb|AHG95978.1|  endoplasmic reticulum 18:1 desaturase                   393   3e-133   Malus baccata [shan jing zi]
gb|AGJ01133.1|  fatty acid desaturase 2-1                               391   2e-132   Linum usitatissimum
gb|AAO37754.1|  delta-12 oleate desaturase                              391   2e-132   Punica granatum [granado]
gb|ACF49507.1|  omega-6 desaturase                                      390   4e-132   Linum usitatissimum
ref|XP_008380133.1|  PREDICTED: omega-6 fatty acid desaturase, en...    390   5e-132   
ref|XP_010520035.1|  PREDICTED: omega-6 fatty acid desaturase, en...    390   5e-132   Tarenaya hassleriana [spider flower]
ref|XP_010557947.1|  PREDICTED: omega-6 fatty acid desaturase, en...    390   7e-132   Tarenaya hassleriana [spider flower]
ref|XP_002285640.1|  PREDICTED: omega-6 fatty acid desaturase, en...    389   9e-132   Vitis vinifera
ref|XP_007028985.1|  Microsomal oleic acid desaturase                   389   9e-132   
ref|XP_009369579.1|  PREDICTED: omega-6 fatty acid desaturase, en...    389   1e-131   Pyrus x bretschneideri [bai li]
ref|XP_010520034.1|  PREDICTED: omega-6 fatty acid desaturase, en...    391   1e-131   Tarenaya hassleriana [spider flower]
ref|XP_011075145.1|  PREDICTED: omega-6 fatty acid desaturase, en...    388   3e-131   Sesamum indicum [beniseed]
gb|ADX60451.1|  omega-6 fatty acid desaturase                           382   3e-131   Phaseolus vulgaris [French bean]
ref|XP_006604385.1|  PREDICTED: omega-6 fatty acid desaturase, en...    388   3e-131   
emb|CDP17521.1|  unnamed protein product                                388   3e-131   Coffea canephora [robusta coffee]
gb|ACU23285.1|  unknown                                                 387   5e-131   Glycine max [soybeans]
emb|CAD24671.1|  delta 12-acyl-lipid-desaturase                         387   6e-131   Punica granatum [granado]
gb|ABZ05022.1|  delta-12 fatty acid desaturase                          387   1e-130   Davidia involucrata
ref|XP_011080227.1|  PREDICTED: omega-6 fatty acid desaturase, en...    387   1e-130   Sesamum indicum [beniseed]
gb|AAS19533.1|  omega-6 fatty acid desaturase                           386   1e-130   Cucurbita pepo
ref|XP_010257471.1|  PREDICTED: omega-6 fatty acid desaturase, en...    386   2e-130   Nelumbo nucifera [Indian lotus]
gb|EYU46325.1|  hypothetical protein MIMGU_mgv1a008048mg                386   2e-130   Erythranthe guttata [common monkey flower]
ref|XP_006492862.1|  PREDICTED: omega-6 fatty acid desaturase, en...    386   2e-130   Citrus sinensis [apfelsine]
gb|AAQ16653.1|  delta-12 fatty acid desaturase 2                        386   3e-130   Gossypium hirsutum [American cotton]
ref|XP_011080226.1|  PREDICTED: omega-6 fatty acid desaturase, en...    389   3e-130   Sesamum indicum [beniseed]
ref|XP_008392076.1|  PREDICTED: omega-6 fatty acid desaturase, en...    385   3e-130   
ref|XP_009376128.1|  PREDICTED: omega-6 fatty acid desaturase, en...    385   4e-130   Pyrus x bretschneideri [bai li]
ref|NP_001238358.1|  omega-6 fatty acid desaturase, endoplasmic r...    385   4e-130   
gb|KHG25037.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    385   4e-130   Gossypium arboreum [tree cotton]
gb|KJB46318.1|  hypothetical protein B456_007G362300                    385   7e-130   Gossypium raimondii
gb|KHN07428.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    384   1e-129   Glycine soja [wild soybean]
ref|XP_002530704.1|  omega-6 desaturase, endoplasmic reticulum          384   1e-129   
ref|XP_004136572.1|  PREDICTED: omega-6 fatty acid desaturase, en...    384   2e-129   Cucumis sativus [cucumbers]
gb|AAL37484.1|AF331163_1  delta-12 fatty acid desaturase                384   2e-129   Gossypium hirsutum [American cotton]
ref|XP_009383220.1|  PREDICTED: omega-6 fatty acid desaturase, en...    383   2e-129   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF49508.1|  omega-6 desaturase                                      383   2e-129   Linum usitatissimum
gb|AAY87459.1|  omega-6 fatty acid desaturase                           383   3e-129   Hevea brasiliensis [jebe]
gb|AGZ02022.1|  microsomal omega-6-desaturase                           383   3e-129   Millettia pinnata [karumtree]
gb|ADB93805.1|  delta-12-fatty acid desaturase                          383   3e-129   Jatropha curcas
ref|XP_006429873.1|  hypothetical protein CICLE_v10011949mg             383   3e-129   Citrus clementina [clementine]
gb|AFJ53078.1|  fatty acid desaturase 2                                 382   4e-129   Linum usitatissimum
ref|XP_010044976.1|  PREDICTED: omega-6 fatty acid desaturase, en...    382   4e-129   Eucalyptus grandis [rose gum]
gb|ABB05230.1|  delta 12 desaturase                                     382   4e-129   Linum usitatissimum
ref|XP_007162321.1|  hypothetical protein PHAVU_001G142100g             382   7e-129   Phaseolus vulgaris [French bean]
gb|AEQ28964.1|  omega-6 desaturase                                      382   7e-129   Linum grandiflorum
ref|XP_009777156.1|  PREDICTED: omega-6 fatty acid desaturase, en...    382   1e-128   Nicotiana sylvestris
gb|AGZ02023.1|  microsomal omega-6-desaturase                           382   1e-128   Millettia pinnata [karumtree]
gb|ABA41034.1|  delta12-fatty acid desaturase                           382   1e-128   Jatropha curcas
gb|AAT72296.2|  microsomal omega-6-desaturase                           381   1e-128   Nicotiana tabacum [American tobacco]
ref|XP_007014826.1|  Microsomal oleic acid desaturase isoform 1         381   2e-128   
gb|AGH32914.1|  fatty acid desaturase                                   381   2e-128   Camellia chekiangoleosa
ref|XP_010058087.1|  PREDICTED: omega-6 fatty acid desaturase, en...    381   2e-128   Eucalyptus grandis [rose gum]
gb|AFN53642.1|  omega-6 desaturase                                      385   2e-128   Linum usitatissimum
ref|XP_010087393.1|  Omega-6 fatty acid desaturase, endoplasmic r...    381   3e-128   Morus notabilis
ref|XP_008443062.1|  PREDICTED: omega-6 fatty acid desaturase, en...    384   3e-128   
gb|KJB15034.1|  hypothetical protein B456_002G156600                    380   3e-128   Gossypium raimondii
gb|AEI60128.1|  microsomal delta-12 oleate desaturase                   380   5e-128   Vitis labrusca [Concord grape]
emb|CAA71199.1|  omega-6 desaturase                                     380   5e-128   Gossypium hirsutum [American cotton]
gb|AFK34956.1|  unknown                                                 380   5e-128   Lotus japonicus
gb|AEW43691.1|  fatty acid desaturase 2                                 380   5e-128   Jatropha curcas
dbj|BAD89862.1|  microsomal omega-6 fatty acid desaturase               380   5e-128   Glycine max [soybeans]
gb|AEW43690.1|  fatty acid desaturase 2                                 380   6e-128   Jatropha curcas
ref|XP_006354202.1|  PREDICTED: omega-6 fatty acid desaturase, en...    380   7e-128   Solanum tuberosum [potatoes]
ref|XP_010058070.1|  PREDICTED: omega-6 fatty acid desaturase, en...    380   7e-128   
ref|XP_002279239.1|  PREDICTED: omega-6 fatty acid desaturase, en...    379   7e-128   Vitis vinifera
ref|XP_009613562.1|  PREDICTED: omega-6 fatty acid desaturase, en...    379   7e-128   Nicotiana tomentosiformis
ref|XP_002297660.2|  microsomal omega-6 desaturase family protein       379   1e-127   
gb|AFK31315.1|  fatty acid desaturase                                   379   1e-127   Camellia oleifera [abura-tsubaki]
gb|KHN35589.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    377   2e-127   Glycine soja [wild soybean]
ref|XP_007204396.1|  hypothetical protein PRUPE_ppa007098mg             378   2e-127   Prunus persica
ref|XP_004304366.1|  PREDICTED: omega-6 fatty acid desaturase, en...    378   2e-127   Fragaria vesca subsp. vesca
emb|CAA63432.1|  D12 oleate desaturase                                  378   4e-127   Solanum commersonii
gb|AAW63041.1|  microsomal delta-12 oleate desaturase                   377   8e-127   Olea europaea
gb|ADZ39688.1|  microsomal delta-12 oleate desaturase                   377   8e-127   Olea europaea subsp. europaea
dbj|BAD89863.1|  microsomal omega-6 fatty acid desaturase               375   8e-127   Glycine max [soybeans]
ref|NP_001237865.1|  microsomal oleate desaturase FAD2-4                377   8e-127   Glycine max [soybeans]
gb|AAC24586.1|  omega-6 fatty acid desaturase                           375   1e-126   Prunus armeniaca
gb|AGN95842.1|  fatty acid delta12-desturase FAD2-2                     376   1e-126   Hiptage benghalensis
ref|XP_004228665.1|  PREDICTED: omega-6 fatty acid desaturase, en...    376   1e-126   Solanum lycopersicum
ref|XP_008240937.1|  PREDICTED: omega-6 fatty acid desaturase, en...    376   1e-126   Prunus mume [ume]
gb|KHN12315.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    376   2e-126   Glycine soja [wild soybean]
ref|XP_011004831.1|  PREDICTED: omega-6 fatty acid desaturase, en...    376   2e-126   Populus euphratica
emb|CAN71892.1|  hypothetical protein VITISV_040865                     376   2e-126   Vitis vinifera
gb|AGN95841.1|  fatty acid delta12-desturase FAD2-1                     376   2e-126   Hiptage benghalensis
ref|XP_010277281.1|  PREDICTED: omega-6 fatty acid desaturase, en...    375   3e-126   Nelumbo nucifera [Indian lotus]
gb|ADP07951.1|  microsomal omega-6 desaturase                           374   3e-126   Phaseolus lunatus
ref|XP_011037927.1|  PREDICTED: omega-6 fatty acid desaturase, en...    375   3e-126   Populus euphratica
ref|XP_009395096.1|  PREDICTED: omega-6 fatty acid desaturase, en...    375   3e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006445919.1|  hypothetical protein CICLE_v10015614mg             375   3e-126   Citrus clementina [clementine]
gb|AEK67593.1|  omega-6 fatty acid desaturase                           375   4e-126   Citrus medica var. sarcodactylis
ref|XP_010943510.1|  PREDICTED: omega-6 fatty acid desaturase, en...    375   6e-126   Elaeis guineensis
ref|XP_009390650.1|  PREDICTED: omega-6 fatty acid desaturase, en...    375   6e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006492662.1|  PREDICTED: omega-6 fatty acid desaturase, en...    374   7e-126   Citrus sinensis [apfelsine]
gb|ABI96919.1|  delta-12 fatty acid desaturase                          374   1e-125   Triadica sebifera [candleberry-tree]
ref|XP_006492661.1|  PREDICTED: omega-6 fatty acid desaturase, en...    374   1e-125   
gb|AEE69020.1|  Fad2                                                    374   1e-125   Vernicia fordii [tung oil tree]
ref|XP_009420049.1|  PREDICTED: omega-6 fatty acid desaturase, en...    374   1e-125   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN87573.1|  delta 12 oleic acid desaturase FAD2                     374   2e-125   Vernicia fordii [tung oil tree]
gb|ABL86147.1|  delta-12 oleic acid desaturase                          374   2e-125   Vernicia montana
gb|AGG38092.1|  omega-6 fatty acid desaturase 2 endoplasmic retic...    374   3e-125   Musa AB Group
ref|XP_010105456.1|  Omega-6 fatty acid desaturase, endoplasmic r...    373   3e-125   Morus notabilis
gb|ACJ66779.1|  omega-6 desaturase                                      373   3e-125   Portulaca oleracea
gb|AFX61781.1|  omega-6 fatty acid desaturase endoplasmic reticul...    372   4e-125   Musa AB Group
gb|ADZ39687.1|  microsomal delta-12 oleate desaturase                   372   4e-125   Olea europaea subsp. europaea
gb|AEE69021.1|  Fad2                                                    372   4e-125   Vernicia fordii [tung oil tree]
ref|XP_004493583.1|  PREDICTED: omega-6 fatty acid desaturase, en...    372   5e-125   Cicer arietinum [garbanzo]
ref|XP_010265904.1|  PREDICTED: omega-6 fatty acid desaturase, en...    372   7e-125   Nelumbo nucifera [Indian lotus]
gb|AAW63040.1|  microsomal delta-12 oleate desaturase                   372   7e-125   Olea europaea
gb|ABP49577.1|  oleate desaturase                                       372   8e-125   Caragana korshinskii
gb|AFX61782.1|  omega-6 fatty acid desaturase endoplasmic reticul...    372   1e-124   Musa AB Group
gb|AAL23676.1|  delta-12 fatty acid desaturase                          371   1e-124   Persea americana
gb|AIN36675.1|  delta 12 desaturase                                     371   1e-124   Cannabis sativa
gb|ABC41578.1|  endoplasmic reticulum 18:1 desaturase                   371   2e-124   Populus tomentosa [Chinese white poplar]
ref|XP_011037928.1|  PREDICTED: omega-6 fatty acid desaturase, en...    370   2e-124   Populus euphratica
gb|EYU39931.1|  hypothetical protein MIMGU_mgv1a008167mg                370   2e-124   Erythranthe guttata [common monkey flower]
gb|ACR83861.1|  omega-6 fatty acid desaturase                           370   2e-124   Portulaca oleracea
gb|AAF82295.1|  microsomal oleate desaturase                            370   3e-124   Arachis ipaensis
gb|EYU39930.1|  hypothetical protein MIMGU_mgv1a008167mg                370   3e-124   Erythranthe guttata [common monkey flower]
gb|AIA21669.1|  oleate desaturase                                       370   3e-124   Crambe kralikii
gb|AEW67305.1|  delta-12 fatty acid desaturase                          370   3e-124   Arachis hypogaea [goober]
ref|XP_002323284.1|  Omega-6 fatty acid desaturase family protein       370   3e-124   
gb|AAF82293.1|  microsomal oleate desaturase                            370   4e-124   Arachis hypogaea [goober]
gb|AHV83758.1|  omega-6 fatty acid desaturase                           370   4e-124   Arachis hypogaea [goober]
gb|AFN53713.1|  omega-6 desaturase                                      382   5e-124   Linum usitatissimum
gb|AIN52150.1|  fatty acid desaturase-2                                 370   6e-124   Camellia oleifera [abura-tsubaki]
gb|AAS57577.1|  delta12-oleic acid desaturase                           369   7e-124   Euphorbia lagascae
gb|AGS12443.1|  omega-6 fatty acid desaturase                           369   7e-124   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AAC31698.1|  delta-12 fatty acid desaturase                          369   8e-124   Borago officinalis
ref|XP_010928433.1|  PREDICTED: omega-6 fatty acid desaturase, en...    369   8e-124   Elaeis guineensis
gb|AAX14399.1|  oleate desaturase                                       369   8e-124   Arachis monticola
gb|AER27513.1|  omega 6 fatty acid desaturase                           369   8e-124   Arachis hypogaea [goober]
gb|ACZ06072.1|  microsomal omega-6 fatty acid desaturase                369   1e-123   Arachis hypogaea [goober]
ref|XP_008799208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    369   1e-123   Phoenix dactylifera
ref|XP_010091397.1|  Omega-6 fatty acid desaturase, endoplasmic r...    369   1e-123   Morus notabilis
gb|AGZ15438.1|  FAD2                                                    369   1e-123   Eucalyptus camaldulensis
gb|ADI46403.1|  omega-6 fatty acid desaturase                           369   1e-123   Arachis hypogaea [goober]
gb|AIA21668.1|  oleate desaturase                                       369   1e-123   Crambe kralikii
gb|AER27514.1|  omega 6 fatty acid desaturase                           368   2e-123   Arachis hypogaea [goober]
gb|AIA21657.1|  oleate desaturase                                       369   2e-123   Crambe filiformis
gb|AAF82294.1|  microsomal oleate desaturase                            368   2e-123   Arachis duranensis
gb|AAB84262.1|  omega-6 desaturase                                      368   2e-123   Arachis hypogaea [goober]
gb|AGS12444.1|  omega-6 fatty acid desaturase                           369   2e-123   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
dbj|BAC22091.1|  delta-12 desaturase                                    368   2e-123   Spinacia oleracea
gb|ADM83594.1|  omega 6 fatty acid desaturase                           368   2e-123   Arachis hypogaea [goober]
ref|XP_003625259.1|  Omega-6 fatty acid desaturase, endoplasmic r...    370   2e-123   
gb|AAY53559.1|  oleate desaturase                                       368   2e-123   Arachis hypogaea [goober]
gb|AIA21646.1|  oleate desaturase                                       368   2e-123   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AIA21652.1|  oleate desaturase                                       368   2e-123   Crambe filiformis
gb|AIA21660.1|  oleate desaturase                                       368   2e-123   Crambe glabrata
gb|AIA21661.1|  oleate desaturase                                       368   2e-123   Crambe glabrata
ref|XP_006407366.1|  hypothetical protein EUTSA_v10020910mg             368   3e-123   Eutrema salsugineum [saltwater cress]
ref|XP_006368553.1|  hypothetical protein POPTR_0001s05000g             367   3e-123   
gb|AER27515.1|  omega 6 fatty acid desaturase                           367   3e-123   Arachis hypogaea [goober]
gb|AAK67829.1|  delta-12 fatty acid desaturase                          367   4e-123   Arachis hypogaea [goober]
ref|XP_009417293.1|  PREDICTED: omega-6 fatty acid desaturase, en...    367   4e-123   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84618.1|  unknown                                                 368   5e-123   Medicago truncatula
gb|AIA21649.1|  oleate desaturase                                       367   6e-123   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|ADX20841.1|  omega 6 fatty acid desaturase                           367   7e-123   Arachis hypogaea [goober]
gb|AAL93620.1|  fatty acid desaturase 2                                 367   7e-123   Olea europaea subsp. europaea
gb|AGS12442.1|  omega-6 fatty acid desaturase                           367   8e-123   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AER27516.1|  omega 6 fatty acid desaturase                           366   9e-123   Arachis hypogaea [goober]
gb|AAY67653.1|  oleate desaturase                                       366   2e-122   Arachis hypogaea [goober]
ref|XP_010672659.1|  PREDICTED: omega-6 fatty acid desaturase, en...    365   2e-122   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG24863.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    365   3e-122   Gossypium arboreum [tree cotton]
gb|ADM83591.1|  omega 6 fatty acid desaturase                           365   3e-122   Arachis hypogaea [goober]
ref|XP_002309307.2|  hypothetical protein POPTR_0006s20640g             368   4e-122   Populus trichocarpa [western balsam poplar]
gb|ADX20840.1|  omega 6 fatty acid desaturase                           365   4e-122   Arachis hypogaea [goober]
gb|ADP02395.1|  delta-12 oleate desaturase                              365   5e-122   Gossypium hirsutum [American cotton]
ref|XP_011033218.1|  PREDICTED: omega-6 fatty acid desaturase, en...    367   5e-122   Populus euphratica
gb|AHV83757.1|  omega-6 fatty acid desaturase                           364   6e-122   Arachis hypogaea [goober]
emb|CAA65744.1|  omega-6 desaturase                                     364   7e-122   Gossypium hirsutum [American cotton]
gb|AIE48273.1|  omega-6 fatty acid desaturase                           363   1e-121   Rhus chinensis
ref|XP_004497897.1|  PREDICTED: omega-6 fatty acid desaturase, en...    363   2e-121   Cicer arietinum [garbanzo]
gb|AIT96964.1|  FAD2 desaturase                                         363   2e-121   Corylus avellana [European hazelnut]
gb|AIA21647.1|  oleate desaturase                                       362   3e-121   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|AIT96965.1|  FAD2 desaturase                                         362   4e-121   Corylus avellana [European hazelnut]
gb|AFC41106.1|  FAD2-1                                                  362   9e-121   Brassica oleracea
ref|XP_008813208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    362   1e-120   Phoenix dactylifera
gb|AAV52834.1|  delta-12 fatty acid desaturase                          361   1e-120   Tropaeolum majus
gb|AAL68983.1|AF251844_1  delta-12 oleate desaturase                    361   1e-120   Helianthus annuus
ref|XP_010673536.1|  PREDICTED: omega-6 fatty acid desaturase, en...    360   2e-120   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB80696.1|  omega-6 fatty acid desaturase                           360   2e-120   Petroselinum crispum
gb|ACP39505.1|  delta-12 oleate desaturase                              360   2e-120   Brassica napus [oilseed rape]
gb|ACP39502.1|  delta-12 oleate desaturase                              360   3e-120   Brassica napus [oilseed rape]
gb|ACP39504.1|  delta-12 oleate desaturase                              360   3e-120   Brassica napus [oilseed rape]
gb|AAD19742.1|  delta-12 desaturase                                     360   3e-120   Brassica carinata [Abyssinian mustard]
gb|ACN53522.1|  fatty acid desaturase 2                                 360   4e-120   Brassica juncea [brown mustard]
emb|CAD30827.1|  fatty acid desaturase 2                                360   4e-120   Brassica rapa
gb|ADN10829.1|  fatty acid desaturase                                   360   5e-120   Camelina hispida
gb|AIA21650.1|  oleate desaturase                                       359   6e-120   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|ADN10825.1|  fatty acid desaturase                                   359   6e-120   Camelina sativa [gold-of-pleasure]
gb|AFQ60942.1|  microsomal oleate desaturase                            359   7e-120   Camelina sativa [gold-of-pleasure]
gb|ADN10832.1|  fatty acid desaturase                                   359   7e-120   Camelina microcarpa
gb|ADN10835.1|  fatty acid desaturase                                   359   7e-120   Camelina rumelica
gb|ADN10834.1|  fatty acid desaturase                                   359   8e-120   Camelina rumelica
ref|XP_007145683.1|  hypothetical protein PHAVU_007G259500g             359   8e-120   Phaseolus vulgaris [French bean]
emb|CDY01103.1|  BnaC05g40970D                                          362   8e-120   
gb|AIA21648.1|  oleate desaturase                                       359   9e-120   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
gb|ABS86964.2|  delta-12 fatty acid desaturase                          359   1e-119   Descurainia sophia
emb|CDY08454.1|  BnaA05g26900D                                          361   1e-119   Brassica napus [oilseed rape]
gb|AIA21667.1|  oleate desaturase                                       358   1e-119   Crambe kralikii
gb|KJB83458.1|  hypothetical protein B456_013G248800                    358   1e-119   Gossypium raimondii
gb|AIA21654.1|  oleate desaturase                                       358   1e-119   Crambe filiformis
gb|ACA14460.1|  oleate desaturase                                       358   2e-119   Caragana korshinskii
gb|AAF78778.1|  delta-12 oleate desaturase                              358   2e-119   Brassica napus [oilseed rape]
ref|XP_006297892.1|  hypothetical protein CARUB_v10013933mg             358   2e-119   Capsella rubella
gb|AFP21683.1|  FAD2                                                    358   2e-119   Physaria fendleri
gb|AAS92240.1|  delta-12 oleate desaturase                              358   2e-119   Brassica napus [oilseed rape]
gb|KEH41705.1|  microsomal omega-3 fatty acid desaturase                357   3e-119   Medicago truncatula
ref|XP_009146642.1|  PREDICTED: omega-6 fatty acid desaturase, en...    357   3e-119   Brassica rapa
gb|ADU18249.1|  microsomal oleate desaturase                            357   3e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010464962.1|  PREDICTED: omega-6 fatty acid desaturase, en...    357   4e-119   Camelina sativa [gold-of-pleasure]
gb|ABG76201.1|  delta 12 desaturase                                     357   4e-119   Brassica napus [oilseed rape]
gb|KHG30631.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    357   4e-119   Gossypium arboreum [tree cotton]
ref|XP_010486902.1|  PREDICTED: omega-6 fatty acid desaturase, en...    357   5e-119   
gb|ABR27357.1|  fatty acid desaturase 2                                 357   5e-119   Brassica juncea [brown mustard]
ref|NP_001291954.1|  omega-6 fatty acid desaturase, endoplasmic r...    357   6e-119   Camelina sativa [gold-of-pleasure]
gb|AAN87574.1|  delta 12 fatty acid conjugase FADX                      357   7e-119   Vernicia fordii [tung oil tree]
gb|AEK06377.1|  microsomal oleate desaturase FAD2-8                     356   7e-119   Carthamus tinctorius
ref|XP_006850001.1|  hypothetical protein AMTR_s00022p00172860          356   8e-119   Amborella trichopoda
gb|AGN95843.1|  fatty acid delta12-desturase FAD2-3                     357   8e-119   Hiptage benghalensis
gb|ACN53524.1|  fatty acid desaturase 2                                 356   1e-118   Brassica juncea [brown mustard]
gb|AHY24226.1|  delta-12 fatty acid desaturase                          356   1e-118   Paeonia lactiflora [common garden peony]
sp|Q39287.1|FAD6E_BRAJU  RecName: Full=Omega-6 fatty acid desatur...    356   1e-118   Brassica juncea [brown mustard]
gb|AFC41107.1|  FAD2-2                                                  356   1e-118   Brassica oleracea
gb|KJB15033.1|  hypothetical protein B456_002G156500                    356   1e-118   Gossypium raimondii
gb|AEQ28965.1|  omega-6 desaturase                                      356   1e-118   Linum grandiflorum
gb|ACR15954.1|  fatty acid desaturase 2                                 356   1e-118   Lepidium campestre [bastard cress]
gb|ACP39506.1|  delta-12 oleate desaturase                              356   2e-118   Brassica napus [oilseed rape]
gb|AIA21651.1|  oleate desaturase                                       355   2e-118   Crambe filiformis
gb|AFJ19032.1|  fatty acid desaturase BnaC.FAD2.b                       355   2e-118   Brassica napus [oilseed rape]
ref|NP_187819.1|  omega-6 fatty acid desaturase                         355   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884883.1|  hypothetical protein ARALYDRAFT_478568             355   3e-118   
gb|AIA21656.1|  oleate desaturase                                       355   4e-118   Crambe filiformis
gb|EPS73825.1|  delta-12 oleate desaturase                              354   8e-118   Genlisea aurea
emb|CDP11063.1|  unnamed protein product                                353   8e-118   Coffea canephora [robusta coffee]
gb|AAX29989.1|  microsomal omega-6-desaturase                           353   9e-118   Glycine max [soybeans]
gb|ADJ58018.1|  fatty acid desaturase 2                                 354   9e-118   Brassica nigra
ref|NP_001238342.1|  omega-6 fatty acid desaturase, endoplasmic r...    354   1e-117   Glycine max [soybeans]
gb|KHN37429.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    353   1e-117   Glycine soja [wild soybean]
ref|XP_002528127.1|  oleate 12-hydroxylase                              353   1e-117   Ricinus communis
ref|NP_001047927.1|  Os02g0716500                                       353   1e-117   
gb|AER10476.1|  oleate desaturase                                       352   1e-117   Brassica juncea [brown mustard]
gb|AER10477.1|  fatty acid desaturase 2                                 351   1e-117   Brassica juncea [brown mustard]
gb|ABC00770.1|  delta-12 fatty acid desaturase type 02                  353   1e-117   Crepis alpina
gb|ADK94440.1|  delta-12 fatty acid desaturase                          353   1e-117   Carthamus tinctorius
gb|AGN95844.1|  fatty acid delta12-desturase FAD2-4                     350   2e-117   Hiptage benghalensis
gb|AGC65498.1|  FAD2-1 protein                                          353   2e-117   Carthamus tinctorius
gb|AAT02411.1|  delta-12 oleate desaturase                              353   3e-117   Brassica napus [oilseed rape]
gb|AAM61113.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    352   4e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AAL68982.1|AF251843_1  delta-12 oleate desaturase                    352   4e-117   Helianthus annuus
gb|AIA21658.1|  oleate desaturase                                       352   5e-117   Crambe filiformis
gb|AGC65507.1|  FAD2-10 protein                                         352   5e-117   Carthamus tinctorius
gb|AIA21655.1|  oleate desaturase                                       352   6e-117   Crambe filiformis
gb|AAC49010.1|  oleate 12-hydroxylase                                   352   7e-117   Ricinus communis
gb|AIB55752.1|  delta-12 fatty acid desaturase                          351   8e-117   Fragaria x ananassa
gb|ACU23718.1|  unknown                                                 351   1e-116   Glycine max [soybeans]
ref|XP_003555879.1|  PREDICTED: omega-6 fatty acid desaturase, en...    351   1e-116   
gb|ABF84062.1|  microsomal oleate desaturase FAD2-1B                    351   1e-116   Glycine max [soybeans]
ref|XP_006605885.1|  PREDICTED: omega-6 fatty acid desaturase, en...    351   1e-116   
gb|AIA21659.1|  oleate desaturase                                       351   1e-116   Crambe filiformis
gb|AIA21666.1|  oleate desaturase                                       351   1e-116   Crambe kralikii
ref|XP_008344778.1|  PREDICTED: omega-6 fatty acid desaturase, en...    351   1e-116   
gb|KHN11459.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    350   1e-116   Glycine soja [wild soybean]
gb|ACH43025.1|  omega-6 fatty acid desaturase                           351   1e-116   Glycine max [soybeans]
gb|ACD39348.1|  oleate 12-hydroxylase                                   350   2e-116   Ricinus communis
gb|AAF04093.1|AF188263_1  delta-12 oleate desaturase                    350   2e-116   Vernonia galamensis
gb|AIA21653.1|  oleate desaturase                                       350   2e-116   Crambe filiformis
gb|AAF04094.1|AF188264_1  delta-12 oleate desaturase                    350   3e-116   Vernonia galamensis
ref|XP_009375092.1|  PREDICTED: omega-6 fatty acid desaturase, en...    349   7e-116   Pyrus x bretschneideri [bai li]
ref|XP_006647793.1|  PREDICTED: omega-6 fatty acid desaturase, en...    348   1e-115   
emb|CAN73788.1|  hypothetical protein VITISV_002517                     347   2e-115   
gb|ADL09404.1|  fatty acid desaturase                                   347   2e-115   
ref|XP_004497140.1|  PREDICTED: omega-6 fatty acid desaturase, en...    347   3e-115   
emb|CDP17522.1|  unnamed protein product                                347   3e-115   
dbj|BAJ86651.1|  predicted protein                                      346   1e-114   
gb|ADM48789.1|  microsomal oleate desaturase                            346   1e-114   
ref|XP_004953689.1|  PREDICTED: omega-6 fatty acid desaturase, en...    346   1e-114   
gb|AAT44123.1|  microsomal omega-6-desaturase                           344   2e-114   
ref|XP_011037924.1|  PREDICTED: omega-6 fatty acid desaturase, en...    345   3e-114   
ref|XP_011037925.1|  PREDICTED: omega-6 fatty acid desaturase, en...    345   3e-114   
ref|XP_010231291.1|  PREDICTED: LOW QUALITY PROTEIN: omega-6 fatt...    345   3e-114   
ref|XP_007142866.1|  hypothetical protein PHAVU_007G0234001g            343   3e-114   
ref|XP_006365824.1|  PREDICTED: omega-6 fatty acid desaturase, en...    339   5e-114   
ref|XP_003570235.1|  PREDICTED: omega-6 fatty acid desaturase, en...    343   1e-113   
ref|XP_004295164.1|  PREDICTED: omega-6 fatty acid desaturase, en...    343   1e-113   
gb|AGN95846.1|  fatty acid delta12-hydroxylase FAH12-2                  343   1e-113   
gb|AAK26633.1|AF343065_1  delta-12 fatty acid desaturase FAD2           343   2e-113   
gb|AGX28127.1|  omega-6 fatty acid desaturase                           343   2e-113   
ref|XP_006346615.1|  PREDICTED: omega-6 fatty acid desaturase, en...    342   2e-113   
ref|XP_009631509.1|  PREDICTED: omega-6 fatty acid desaturase, en...    342   3e-113   
ref|XP_002299149.1|  microsomal omega-6 desaturase family protein       342   3e-113   
emb|CAA76157.1|  delta 12 fatty acid desaturase                         342   4e-113   
ref|XP_006365798.1|  PREDICTED: omega-6 fatty acid desaturase, en...    342   4e-113   
gb|AIA21665.1|  oleate desaturase                                       342   4e-113   
gb|AFJ53120.1|  fatty acid desaturase 2-2                               340   6e-113   
gb|AAO37752.1|  delta-12 oleate desaturase                              340   8e-113   
gb|AAC99622.1|  delta-12 desaturase                                     338   1e-112   
ref|NP_001130234.1|  delta-12 fatty acid desaturaseFAD2                 340   3e-112   
gb|AFK12607.1|  fad2-3                                                  338   4e-112   
gb|AFK12600.1|  fad2-3                                                  338   4e-112   
gb|AFK12604.1|  fad2-3                                                  338   5e-112   
gb|AFK12603.1|  fad2-3                                                  338   5e-112   
gb|AFK12602.1|  fad2-3                                                  337   7e-112   
gb|AFK12596.1|  fad2-3                                                  337   8e-112   
gb|AFK12595.1|  fad2-3                                                  337   1e-111   
ref|XP_006366157.1|  PREDICTED: omega-6 fatty acid desaturase, en...    338   2e-111   
ref|XP_006365804.1|  PREDICTED: omega-6 fatty acid desaturase, en...    338   2e-111   
ref|XP_006346614.1|  PREDICTED: omega-6 fatty acid desaturase, en...    337   3e-111   
ref|XP_006365801.1|  PREDICTED: omega-6 fatty acid desaturase, en...    337   4e-111   
gb|ACA28704.1|  fatty acid desaturase                                   337   5e-111   
ref|NP_001149122.1|  omega-6 fatty acid desaturase, endoplasmic r...    337   5e-111   
gb|AEJ87847.1|  omega-6-desaturase                                      336   5e-111   
dbj|BAE93382.1|  delta-12 fatty acid desaturase                         337   6e-111   
ref|XP_003637225.1|  Omega-6 fatty acid desaturase                      335   8e-111   
gb|AFJ53127.1|  fatty acid desaturase 2-2                               333   9e-111   
gb|ACL53784.1|  unknown                                                 336   1e-110   
gb|AFJ53118.1|  fatty acid desaturase 2-2                               334   1e-110   
gb|ABV44669.1|  fatty acid desaturase-2                                 335   3e-110   
ref|XP_006346654.1|  PREDICTED: omega-6 fatty acid desaturase, en...    335   4e-110   
gb|AAL68981.1|AF251842_1  delta-12 oleate desaturase                    334   4e-110   
ref|XP_008677266.1|  PREDICTED: omega-6 fatty acid desaturase, en...    338   5e-110   
ref|XP_008351545.1|  PREDICTED: LOW QUALITY PROTEIN: omega-6 fatt...    329   7e-110   
gb|ACQ42234.1|  bifunctional oleate 12-hydroxylase:desaturase           333   1e-109   
gb|AAC32755.1|  bifunctional oleate 12-hydroxylase:desaturase           333   1e-109   
gb|AGN95845.1|  fatty acid delta12-hydroxylase FAH12-1                  333   1e-109   
ref|XP_006365825.1|  PREDICTED: omega-6 fatty acid desaturase, en...    333   1e-109   
gb|AFW63614.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    338   1e-109   
gb|AGT36606.1|  oleate 12-hydroxylase/desaturase                        332   4e-109   
gb|ADK70952.1|  fatty acid desaturase 2-1                               331   4e-109   
gb|AHI85708.1|  stress-induced protein 3                                327   6e-109   
gb|ABK24364.1|  unknown                                                 331   7e-109   
gb|AGX28133.1|  omega-6 fatty acid desaturase FAD2-2B                   331   8e-109   
gb|AAL37475.1|AF329635_1  delta-12 fatty acid desaturase                323   1e-108   
ref|XP_010314673.1|  PREDICTED: omega-6 fatty acid desaturase, en...    330   1e-108   
ref|XP_002452649.1|  hypothetical protein SORBIDRAFT_04g029900          330   1e-108   
gb|ACG37433.1|  omega-6 fatty acid desaturase, endoplasmic reticu...    331   1e-108   
gb|AGT36605.1|  oleate 12-hydroxylase/desaturase                        330   2e-108   
gb|AFK12575.1|  fad2-2                                                  327   3e-108   
gb|AFJ53121.1|  fatty acid desaturase 2-2                               327   3e-108   
gb|AGX28132.1|  omega-6 fatty acid desaturase FAD2-2A                   330   4e-108   
gb|AFK12573.1|  fad2-2                                                  327   5e-108   
gb|AFK12574.1|  fad2-2                                                  327   6e-108   
gb|AFK12577.1|  fad2-2                                                  327   6e-108   
gb|ABP65296.1|  omega-6 fatty desaturase                                327   9e-108   
gb|AFK12589.1|  fad2-2                                                  326   9e-108   
ref|XP_004252384.1|  PREDICTED: omega-6 fatty acid desaturase, en...    328   1e-107   
gb|AFK12578.1|  fad2-2                                                  325   2e-107   
gb|AFJ53126.1|  fatty acid desaturase 2-2                               325   2e-107   
gb|AAS72902.1|  trans-delta12 oleic acid desaturase                     327   4e-107   
ref|NP_001167925.1|  hypothetical protein                               326   4e-107   
gb|AFK12581.1|  fad2-2                                                  324   5e-107   
ref|XP_006365823.1|  PREDICTED: omega-6 fatty acid desaturase, en...    325   1e-106   
gb|AFN53643.1|  omega-6 desaturase                                      324   2e-106   
gb|AFK12587.1|  fad2-2                                                  323   3e-106   
gb|ABV21586.1|  fatty acid desaturase                                   324   3e-106   
gb|EMT22277.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    324   4e-106   
gb|AFK12549.1|  fad2-1                                                  322   6e-106   
gb|AFK12580.1|  fad2-2                                                  322   7e-106   
gb|AFK12545.1|  fad2-1                                                  322   8e-106   
gb|AFK12546.1|  fad2-1                                                  322   1e-105   
ref|XP_006365800.1|  PREDICTED: omega-6 fatty acid desaturase, en...    323   1e-105   
gb|EMT22276.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    324   1e-105   
gb|AFK12551.1|  fad2-1                                                  321   2e-105   
gb|AFK12547.1|  fad2-1                                                  321   2e-105   
gb|AFK12550.1|  fad2-1                                                  321   3e-105   
gb|AFK12548.1|  fad2-1                                                  320   5e-105   
gb|AFK12542.1|  fad2-1                                                  320   5e-105   
gb|AFJ53125.1|  fatty acid desaturase 2-2                               318   9e-105   
gb|AFJ53119.1|  fatty acid desaturase 2-2                               318   1e-104   
gb|AFN53645.1|  omega-6 desaturase                                      320   1e-104   
ref|XP_004252861.2|  PREDICTED: omega-6 fatty acid desaturase, en...    327   1e-104   
gb|ABQ01458.1|  oleate 12-hydroxylase                                   320   1e-104   
gb|EMT19391.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    320   2e-104   
ref|XP_006365802.1|  PREDICTED: omega-6 fatty acid desaturase, en...    319   3e-104   
gb|AFK12544.1|  fad2-1                                                  318   4e-104   
gb|EMS60696.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    318   4e-104   
ref|XP_008358026.1|  PREDICTED: omega-6 fatty acid desaturase, en...    311   4e-104   
gb|AFK12543.1|  fad2-1                                                  318   4e-104   
gb|AFJ53123.1|  fatty acid desaturase 2-2                               316   8e-104   
ref|XP_004252862.1|  PREDICTED: omega-6 fatty acid desaturase, en...    317   2e-103   
ref|XP_008350272.1|  PREDICTED: omega-6 fatty acid desaturase, en...    315   3e-103   
emb|CDP11066.1|  unnamed protein product                                316   4e-103   
gb|AFK12582.1|  fad2-2                                                  315   4e-103   
ref|XP_008387264.1|  PREDICTED: omega-6 fatty acid desaturase, en...    314   7e-103   
gb|AFJ53122.1|  fatty acid desaturase 2-2                               313   1e-102   
gb|AFK12541.1|  fad2-1                                                  314   1e-102   
gb|AFK12579.1|  fad2-2                                                  313   2e-102   
ref|XP_010314672.1|  PREDICTED: omega-6 fatty acid desaturase, en...    321   5e-102   
gb|AFJ53124.1|  fatty acid desaturase 2-2                               310   2e-101   
emb|CBI16458.3|  unnamed protein product                                313   2e-101   
gb|AAO37751.1|  fatty acid conjugase                                    311   4e-101   
ref|XP_008243688.1|  PREDICTED: omega-6 fatty acid desaturase, en...    307   4e-101   
gb|AAB80697.1|  fungal elicitor-induced protein                         311   4e-101   
gb|ABC00771.1|  delta-12 fatty acid desaturase type 03                  311   5e-101   
gb|AFK12576.1|  fad2-2                                                  308   1e-100   
gb|AGX28130.1|  omega-6 fatty acid desaturase FAD2-1A                   310   2e-100   
gb|AAO38031.1|  delta12-fatty acid acetylenase                          306   3e-99    
gb|AGX28131.1|  omega-6 fatty acid desaturase FAD2-1B                   307   3e-99    
gb|ACH88346.1|  omega-6 fatty acid desaturase                           297   1e-98    
gb|AGC65505.1|  FAD2-8 protein                                          304   2e-98    
ref|NP_001141122.1|  uncharacterized protein LOC100273207               304   3e-98    
gb|AAK30206.1|AF349965_1  fatty acid desaturase/hydroxylase             303   6e-98    
ref|XP_006340104.1|  PREDICTED: omega-6 fatty acid desaturase, en...    303   8e-98    
gb|AGX28136.1|  delta13 fatty acid desaturase FADX-2                    303   8e-98    
gb|AAG23924.1|AF239828_1  ELI7.2                                        303   9e-98    
gb|AFN53644.1|  omega-6 desaturase                                      302   1e-97    
gb|AAG23930.1|AF239834_1  ELI7.9                                        302   1e-97    
gb|AAG23926.1|AF239830_1  ELI7.5                                        302   1e-97    
ref|XP_004237336.1|  PREDICTED: omega-6 fatty acid desaturase, en...    301   2e-97    
gb|EMT15024.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    301   2e-97    
gb|AAG23929.1|AF239833_1  ELI7.8                                        301   2e-97    
gb|AGC65506.1|  FAD2-9 protein                                          301   2e-97    
gb|AAF05915.1|  delta-12 oleic acid desaturase-like protein             301   3e-97    
gb|AFN53648.1|  omega-6 desaturase                                      301   3e-97    
gb|AAG23928.1|AF239832_1  ELI7.7                                        301   4e-97    
ref|XP_009594208.1|  PREDICTED: omega-6 fatty acid desaturase, en...    300   4e-97    
gb|AAG24521.1|AF239835_1  fatty acid desaturase/hydroxylase-like ...    300   7e-97    
gb|AAG23923.1|AF239827_1  ELI7.1                                        300   7e-97    
gb|AGX28128.1|  delta13 fatty acid desaturase SaFADX                    300   7e-97    
gb|EMS45906.1|  Omega-6 fatty acid desaturase, endoplasmic reticu...    303   9e-97    
emb|CAB64256.1|  (8,11)-linoleoyl desaturase                            300   1e-96    
dbj|BAK04289.1|  predicted protein                                      300   2e-96    
gb|AAG23925.1|AF239829_1  ELI7.4                                        299   2e-96    
gb|AGC65508.1|  FAD2-11 protein                                         298   5e-96    
gb|AEK06375.1|  microsomal oleate desaturase FAD2-6                     298   6e-96    
gb|ABC59684.1|  delta-12 fatty acid acetylenase                         298   8e-96    
gb|AAG23927.1|AF239831_1  ELI7.6                                        297   2e-95    
gb|AAF05916.1|AF182521_1  delta-12 oleic acid desaturase-like pro...    297   2e-95    
gb|AAO38032.1|  delta12-fatty acid acetylenase                          296   2e-95    
emb|CDP22071.1|  unnamed protein product                                290   4e-95    
ref|XP_001757907.1|  predicted protein                                  295   5e-95    
emb|CDP22108.1|  unnamed protein product                                289   8e-95    
ref|XP_008449949.1|  PREDICTED: omega-6 fatty acid desaturase, en...    295   9e-95    
gb|AGX28129.1|  delta12-FADS-like FADY                                  295   9e-95    
gb|ACS34773.1|  omega-6 fatty acid desaturase                           294   2e-94    
gb|EEE67046.1|  hypothetical protein OsJ_23988                          293   2e-94    
ref|NP_001059466.1|  Os07g0416900                                       293   7e-94    
gb|ACF17571.1|  mutant bifunctional oleate 12-hydroxylase:desaturase    291   1e-93    
gb|AFN53646.1|  omega-6 desaturase                                      291   2e-93    
dbj|BAC45173.1|  putative delta 12 oleic acid desaturase                291   2e-93    
ref|NP_001059467.2|  Os07g0417200                                       291   2e-93    
ref|XP_004162092.1|  PREDICTED: omega-6 fatty acid desaturase, en...    291   5e-93    
gb|KDO70931.1|  hypothetical protein CISIN_1g0167812mg                  289   5e-93    
ref|XP_004142244.1|  PREDICTED: omega-6 fatty acid desaturase, en...    291   8e-93    
gb|EAZ03630.1|  hypothetical protein OsI_25766                          290   1e-92    
gb|EAZ03615.1|  hypothetical protein OsI_25754                          288   2e-92    
ref|XP_001756226.1|  predicted protein                                  288   4e-92    
gb|AGX28134.1|  delta13 fatty acid desaturase FADX-1A                   284   1e-90    
gb|AAO37753.1|  fatty acid conjugase                                    285   2e-90    
gb|AAF14564.1|AF181726_1  delta-12 fatty acid desaturase                278   2e-90    
ref|XP_008662593.1|  PREDICTED: omega-6 fatty acid desaturase, en...    284   2e-90    
gb|AFN53647.1|  omega-6 desaturase                                      282   7e-90    
gb|AGX28138.1|  delta12-FADS-like FADY-B                                281   3e-89    
gb|AGX28135.1|  delta13 fatty acid desaturase FADX-1B                   280   4e-89    
ref|XP_002983981.1|  hypothetical protein SELMODRAFT_268800             280   6e-89    
gb|ACE97863.1|  fatty acid desaturase                                   273   1e-88    
gb|ACE97864.1|  fatty acid desaturase                                   273   1e-88    
gb|ACE97845.1|  fatty acid desaturase                                   273   1e-88    
ref|XP_002960155.1|  hypothetical protein SELMODRAFT_163663             279   1e-88    
gb|ACE97855.1|  fatty acid desaturase                                   273   1e-88    
gb|ACE97841.1|  fatty acid desaturase                                   273   2e-88    
gb|KGN54110.1|  hypothetical protein Csa_4G286350                       273   2e-88    
gb|ACE97860.1|  fatty acid desaturase                                   272   3e-88    
gb|ACE97856.1|  fatty acid desaturase                                   271   3e-88    
gb|ACE97842.1|  fatty acid desaturase                                   271   4e-88    
gb|ACE97859.1|  fatty acid desaturase                                   271   4e-88    
gb|ACE97848.1|  fatty acid desaturase                                   271   5e-88    
gb|ACE97854.1|  fatty acid desaturase                                   271   5e-88    
gb|ACE97853.1|  fatty acid desaturase                                   271   5e-88    
gb|ACE97847.1|  fatty acid desaturase                                   271   5e-88    
gb|ACE97839.1|  fatty acid desaturase                                   270   1e-87    
gb|AAO38036.1|  delta12-fatty acid acetylenase                          275   1e-87    
gb|ACE97868.1|  fatty acid desaturase                                   270   1e-87    
gb|ACE97843.1|  fatty acid desaturase                                   270   2e-87    
gb|AAR23815.1|  delta 12 fatty acid epoxygenase                         275   7e-87    
gb|ABC00769.1|  delta-12 fatty acid acetylenase                         274   1e-86    
sp|O81931.2|FAD12_CREAL  RecName: Full=Delta(12) fatty acid dehyd...    273   3e-86    
gb|AGX28137.1|  delta12-FADS-like FADY-A                                273   7e-86    
gb|AAO38033.1|  delta12-fatty acid acetylenase                          270   1e-85    
emb|CAA76156.1|  delta 12 fatty acid epoxygenase                        271   2e-85    
ref|XP_004966975.1|  PREDICTED: omega-6 fatty acid desaturase, en...    271   4e-85    
gb|AAO38037.1|  delta12-fatty acid acetylenase                          268   5e-85    
gb|AAO38034.1|  delta12-fatty acid acetylenase                          266   2e-84    
emb|CDP17525.1|  unnamed protein product                                264   3e-84    
gb|AEK06374.1|  microsomal oleate desaturase FAD2-5                     263   2e-82    
gb|AAO38035.1|  delta12-fatty acid acetylenase                          261   3e-82    
emb|CDH92856.1|  omega-6 fatty acid desaturase                          259   1e-81    
gb|AEZ00841.1|  putative ER-oleate desaturase protein                   254   5e-81    
gb|KDP44411.1|  hypothetical protein JCGZ_19426                         251   7e-81    
gb|AEK06376.1|  microsomal oleate desaturase FAD2-7                     259   8e-81    



>gb|AIC34705.1| omega-6 fatty acid desaturase [Rhus chinensis]
 gb|AIC34706.1| omega-6 fatty acid desaturase [Rhus chinensis]
Length=383

 Score =   404 bits (1038),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKY NNPPGRA TLL+QLTLGWPLYL FNVSGRPY RFACHFDP+GPIYSDRERIQI+
Sbjct  167  WFAKYFNNPPGRALTLLVQLTLGWPLYLTFNVSGRPYDRFACHFDPHGPIYSDRERIQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GIF A YVLY++A AKGLAW+VC+YGVPLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDAGIFTAIYVLYRVAMAKGLAWLVCIYGVPLLIVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  287  WDWLRGALATADRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDEG   KGVFWY+NK+
Sbjct  347  DGTPFYKAMWREAKECLYVEPDEGSPTKGVFWYRNKI  383



>ref|XP_006349589.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Solanum tuberosum]
Length=384

 Score =   400 bits (1028),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNNPPGR   L++QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF
Sbjct  167  WFSTYLNNPPGRILILVVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIFA  YVLY L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP+LPHY++SE
Sbjct  227  VSDAGIFAVLYVLYTLVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDTSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT I+ AM+RE KEC+YVEPDEGD+NKGVFWYKNKL
Sbjct  347  DGTSIWKAMYREAKECVYVEPDEGDQNKGVFWYKNKL  383



>gb|ADK47520.1| microsomal oleic acid desaturase [Wrightia tinctoria]
Length=383

 Score =   399 bits (1024),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W  KYLNNPPGR  TL+ QLTLGWPLYLMFNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WFGKYLNNPPGRVLTLVFQLTLGWPLYLMFNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+FA  Y LY L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVFAVAYGLYLLVAAKGLAWVFCVYGGPLLVVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFH+ITDTHVAHHLFSTMPHYHAMEATKAIKP+L EYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATKAIKPILEEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KEC+YVEPDEGD++KGVFWYKNKL
Sbjct  347  DGTPIFQAMWREAKECVYVEPDEGDRSKGVFWYKNKL  383



>ref|XP_009800247.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana sylvestris]
Length=384

 Score =   398 bits (1023),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNNPPGR   LL+QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF
Sbjct  167  WFSTYLNNPPGRILILLVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIFA  + LY LAAAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  VSDAGIFAVLFGLYHLAAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT I+ AM+RE +EC+YVEPDEGD+NKGVFWYKNKL
Sbjct  347  DGTSIWKAMYREARECVYVEPDEGDQNKGVFWYKNKL  383



>ref|XP_009592981.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
 ref|XP_009592982.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
Length=384

 Score =   398 bits (1022),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNNPPGR   LL+QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF
Sbjct  167  WFSTYLNNPPGRILILLVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIFA  + LY L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  VSDAGIFAVLFGLYHLVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT I+ AM+RE KEC+YVEPDEGD+NKGVFWYKNKL
Sbjct  347  DGTSIWKAMYREAKECVYVEPDEGDQNKGVFWYKNKL  383



>gb|AGO32050.1| microsomal oleate desaturase [Xanthoceras sorbifolium]
Length=383

 Score =   397 bits (1019),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGRA TL+I LTLGWPLYL FNVSGRPY RFACHFDPYGPIYSDRER+QIF
Sbjct  167  WFSKYLNNPPGRAVTLVITLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIFA TYVLY +A AKGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  227  VSDVGIFATTYVLYNIAIAKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLKGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPDE    KGVFWY+NK 
Sbjct  347  DGTPFYKAIWREAKECLYVEPDENSPTKGVFWYRNKF  383



>ref|XP_004234773.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
 ref|XP_010317872.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
Length=384

 Score =   396 bits (1018),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNN PGR   L++QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QIF
Sbjct  167  WFSTYLNNSPGRILVLVVQLTLGWPLYLMFNVSGRPYDRFACHFDPNSPIYTDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIFA  YVLY L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP+LPHY++SE
Sbjct  227  VSDAGIFAVLYVLYTLVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDTSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT I+ AM+RE KEC+YVEPDEGD+NKGVFWYKNK 
Sbjct  347  DGTSIWKAMYREAKECVYVEPDEGDQNKGVFWYKNKF  383



>gb|AIZ94608.1| fatty acid desaturase 4, partial [Perilla frutescens]
Length=294

 Score =   393 bits (1009),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR  TL++Q TLGWPLYLMFNVSGRPY RFACHFDP  PIYSDRER QIF+S
Sbjct  80   AKYLNNPPGRILTLIVQFTLGWPLYLMFNVSGRPYDRFACHFDPKSPIYSDRERAQIFLS  139

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D GI A  Y LY+L  AKGLAWV+CVYGVPLL+VNGFLVLITYLQHTH +LPHY+SSEWD
Sbjct  140  DVGILAMLYGLYRLTVAKGLAWVLCVYGVPLLVVNGFLVLITYLQHTHASLPHYDSSEWD  199

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGALSTVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQFDG
Sbjct  200  WLRGALSTVDRDYGVLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQFDG  259

Query  202  TPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            TP+  A++RE KEC+YVEPDEGDKNKGVFWY NKL
Sbjct  260  TPVAKAVWREAKECVYVEPDEGDKNKGVFWYNNKL  294



>emb|CDP10136.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AK+LNNPPGR  TL +QLTLGWPLYLMFNVSGRPY RFACH+DPYGPIY+DRER+QI+
Sbjct  242  WSAKFLNNPPGRVLTLAVQLTLGWPLYLMFNVSGRPYDRFACHYDPYGPIYNDRERLQIY  301

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ +  Y LY+L AAKGLAWVVCVYG PLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  302  LSDVGVLSVFYGLYRLVAAKGLAWVVCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDSSE  361

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  362  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  421

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KEC+YVE D+ D+NKGVFWY NKL
Sbjct  422  DGTPIFKAMWREAKECVYVEQDDADQNKGVFWYNNKL  458



>gb|AHG95978.1| endoplasmic reticulum 18:1 desaturase [Malus baccata]
Length=382

 Score =   393 bits (1010),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/217 (85%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            WHAKYLNNPPGR  TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF
Sbjct  167  WHAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWV+C YG PL++VNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  VSDAGVLAVVYGLYRLAVAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AMFRE KECIYVEPDEG K KGVFWY  KL
Sbjct  347  DGTPVYKAMFREAKECIYVEPDEGAK-KGVFWYNKKL  382



>gb|AGJ01133.1| fatty acid desaturase 2-1 [Linum usitatissimum]
Length=382

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            WH+KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF
Sbjct  166  WHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIF  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A ++ LYKLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  226  LSDAGILAVSFALYKLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPSLPHYKSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  286  WDWLRGALATMDRDYGFLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KEC+YVEPDEGD+NKGVFWY NKL
Sbjct  346  DGTPFIKAMWREAKECVYVEPDEGDQNKGVFWYNNKL  382



>gb|AAO37754.1| delta-12 oleate desaturase [Punica granatum]
Length=387

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL++ LTLGWPLYL  NVSGRPY RFACHFDPYGPIY+DRER+QI+
Sbjct  171  WFSKYLNNPPGRVMTLIVTLTLGWPLYLALNVSGRPYDRFACHFDPYGPIYTDRERLQIY  230

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AATY LYK+AAA+GLAW+VCVYGVPLLIVN FLV ITYLQHTHPALPHY+SSE
Sbjct  231  ISDVGIMAATYTLYKIAAARGLAWLVCVYGVPLLIVNAFLVTITYLQHTHPALPHYDSSE  290

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  291  WDWLRGALATADRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  350

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AM+RE +EC+YVEPD+G  +KGVFWYK  L
Sbjct  351  DGTPVYKAMWREARECLYVEPDDGANSKGVFWYKKNL  387



>gb|ACF49507.1| omega-6 desaturase [Linum usitatissimum]
Length=382

 Score =   390 bits (1003),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            WH+KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF
Sbjct  166  WHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIF  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
             SD GI A ++ LYKLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  226  FSDAGILAVSFALYKLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPSLPHYKSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  286  WDWLRGALATMDRDYGFLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KEC+YVEPDEGD+NKGVFWY NKL
Sbjct  346  DGTPFIKAMWREAKECVYVEPDEGDQNKGVFWYNNKL  382



>ref|XP_008380133.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Malus domestica]
 ref|XP_008380134.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Malus domestica]
Length=382

 Score =   390 bits (1002),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            WHAKYLNNPPGR  TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF
Sbjct  167  WHAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWV+C YG PL++VNGFLVLITYLQHTHPALPHY+ SE
Sbjct  227  VSDAGVLAVFYGLYRLAVAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHPALPHYDXSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AMFRE KECIYVEPDEG K KGVFWY  KL
Sbjct  347  DGTPVYKAMFREAKECIYVEPDEGAK-KGVFWYNKKL  382



>ref|XP_010520035.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010520036.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X2 [Tarenaya hassleriana]
Length=383

 Score =   390 bits (1002),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL +QL LGWPLYLMFNVSGRPY RFACHFDPYGPIY+DRER+QI+
Sbjct  167  WYSKYLNNPLGRVMTLTVQLVLGWPLYLMFNVSGRPYDRFACHFDPYGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  Y LY+LAAAKG+AW++CVYGVPLL+VNGFLVLIT+LQHTHPALPHY+SSE
Sbjct  227  VSDAGILAVCYGLYRLAAAKGMAWLMCVYGVPLLVVNGFLVLITFLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+T+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT+AIKP+LG+YYQF
Sbjct  287  WDWFRGALATIDRDYGLLNKVFHNITDTHVAHHLFSTMPHYHAMEATRAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPI+ AM+REVKECIYVEPDE  + KGVFWY NKL
Sbjct  347  DGTPIYRAMWREVKECIYVEPDEHGEKKGVFWYNNKL  383



>ref|XP_010557947.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Tarenaya hassleriana]
Length=383

 Score =   390 bits (1001),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL IQL LGWPLYLMFNVSGRPY RFACHFDP GPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRVMTLTIQLVLGWPLYLMFNVSGRPYERFACHFDPNGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  Y LY+++AAKGLAW++C YGVPLL+VNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  VSDAGILAVCYALYRISAAKGLAWMLCYYGVPLLVVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DG P++ AM+RE KECIYVEPDE  + KGVFWY NKL
Sbjct  347  DGMPVYKAMWREAKECIYVEPDESGEKKGVFWYNNKL  383



>ref|XP_002285640.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Vitis vinifera]
 emb|CAN79670.1| hypothetical protein VITISV_018075 [Vitis vinifera]
 gb|AEI60129.1| microsomal delta-12 oleate desaturase [Vitis labrusca]
Length=376

 Score =   389 bits (1000),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GRA TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  160  WFSKYLNNPLGRALTLVITLTLGWPLYLAFNVSGRPYNRFACHYDPYGPIYSDRERLQIY  219

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GIF A+YVLY+L  AKGLAWVVC+YG+PLLIVN FLVLITYLQHTHP LPHY+S E
Sbjct  220  ISDAGIFTASYVLYRLILAKGLAWVVCMYGIPLLIVNAFLVLITYLQHTHPTLPHYDSLE  279

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT+AIKP+LGEYYQF
Sbjct  280  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATRAIKPILGEYYQF  339

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE +EC+YVEPDEG  +KGVFWY+NK 
Sbjct  340  DGTPFYKAMWREARECLYVEPDEGGSDKGVFWYRNKF  376



>ref|XP_007028985.1| Microsomal oleic acid desaturase [Theobroma cacao]
 gb|EOY09487.1| Microsomal oleic acid desaturase [Theobroma cacao]
Length=383

 Score =   389 bits (1000),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  TL IQLT+GWPLYL FNVSGRPY RFACH+DPYGPIY+ RER+QI+
Sbjct  167  WWAKYLNNPPGRFLTLTIQLTIGWPLYLAFNVSGRPYERFACHYDPYGPIYNYRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKGLAWVVCVYGVPLL+VN FLV+ITYLQHTHP+LPHY+S E
Sbjct  227  ISDAGVLAITYCLYRLALAKGLAWVVCVYGVPLLVVNAFLVMITYLQHTHPSLPHYDSLE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW +GAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  287  WDWFKGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KECIYVEPDEG+  KGVFWY+NKL
Sbjct  347  DGTPVYKALWREAKECIYVEPDEGEHGKGVFWYRNKL  383



>ref|XP_009369579.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Pyrus x bretschneideri]
 ref|XP_009369586.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Pyrus x bretschneideri]
Length=382

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 197/217 (91%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+AKYLNNPPGR  TLLIQLTLGWPLYL FNVSGRPY  FACHF PYGPIYSDRER+QIF
Sbjct  167  WYAKYLNNPPGRFLTLLIQLTLGWPLYLAFNVSGRPYKGFACHFHPYGPIYSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A    LY+LAAAKGLAWV+C YG PL++VNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  VSDAGVLAVFCGLYRLAAAKGLAWVICFYGGPLMVVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AMFRE KECIYVEPDEG K KGVFWY+ KL
Sbjct  347  DGTPVYKAMFREAKECIYVEPDEGAK-KGVFWYRKKL  382



>ref|XP_010520034.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isoform X1 [Tarenaya hassleriana]
Length=437

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL +QL LGWPLYLMFNVSGRPY RFACHFDPYGPIY+DRER+QI+
Sbjct  221  WYSKYLNNPLGRVMTLTVQLVLGWPLYLMFNVSGRPYDRFACHFDPYGPIYNDRERLQIY  280

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  Y LY+LAAAKG+AW++CVYGVPLL+VNGFLVLIT+LQHTHPALPHY+SSE
Sbjct  281  VSDAGILAVCYGLYRLAAAKGMAWLMCVYGVPLLVVNGFLVLITFLQHTHPALPHYDSSE  340

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+T+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT+AIKP+LG+YYQF
Sbjct  341  WDWFRGALATIDRDYGLLNKVFHNITDTHVAHHLFSTMPHYHAMEATRAIKPILGDYYQF  400

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPI+ AM+REVKECIYVEPDE  + KGVFWY NKL
Sbjct  401  DGTPIYRAMWREVKECIYVEPDEHGEKKGVFWYNNKL  437



>ref|XP_011075145.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Sesamum indicum]
Length=383

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKY+NNPPGR   L++Q TLGWPLYL+FNVSGR Y RFACH+DP  PIYSDRER+QI 
Sbjct  167  WFAKYMNNPPGRVLMLIVQFTLGWPLYLLFNVSGRHYDRFACHYDPKSPIYSDRERLQIL  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKGLAW+VCVYG PLL+VN FLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYRLAIAKGLAWLVCVYGGPLLVVNAFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG YYQF
Sbjct  287  WDWLRGALATVDRDYGILNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGNYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF A++RE KECIYVEPDEGDKNKGVFWY NKL
Sbjct  347  DGTPIFKAVWREAKECIYVEPDEGDKNKGVFWYNNKL  383



>gb|ADX60451.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
Length=227

 Score =   382 bits (982),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QI+
Sbjct  11   WYSKYLNNPLGRVLTLVITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYTDRERMQIY  70

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L+ LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHYNSSE
Sbjct  71   ISDAGVLAVCYGLFHLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYNSSE  130

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LGEYY+ 
Sbjct  131  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLISTMPHYHAMEATKAIKPILGEYYRL  190

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD G ++KGVFWYKNKL
Sbjct  191  DETPFVKAMWREARECIYVEPDHGTEHKGVFWYKNKL  227



>ref|XP_006604385.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Glycine max]
 gb|KHN26385.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=383

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L+ LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY SSE
Sbjct  227  ISDAGVLAVCYGLFCLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  347  DGTPFVKAMWREARECIYVEPDQSTQSKGVFWYNNKL  383



>emb|CDP17521.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   388 bits (996),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 199/217 (92%), Gaps = 2/217 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL I LTLGWPLYL FN SGRPY RFACH+DPYGPIY+DRER+QI+
Sbjct  167  WYSKYLNNPPGRVITLTITLTLGWPLYLAFNASGRPYDRFACHYDPYGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A +Y+LY++A AKGLAW++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDVGVIATSYLLYRVAMAKGLAWLICIYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ 
Sbjct  287  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPLLGEYYQL  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPDEG   KGVFWYKNKL
Sbjct  347  DGTPFYKAMWREAKECIYVEPDEG--GKGVFWYKNKL  381



>gb|ACU23285.1| unknown [Glycine max]
Length=383

 Score =   387 bits (995),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L+ LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY SSE
Sbjct  227  ISDAGVLAVCYGLFCLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  347  DGTPFVKAMWREARECIYVEPDQSTQSKGVFWYNNKL  383



>emb|CAD24671.1| delta 12-acyl-lipid-desaturase [Punica granatum]
Length=387

 Score =   387 bits (995),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL++ LTLGWPLYL  NVSG PY RFACHFDPYGPIY+DRER+QI+
Sbjct  171  WFSKYLNNPPGRVMTLIVTLTLGWPLYLALNVSGWPYDRFACHFDPYGPIYTDRERLQIY  230

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AATY LYK+AAA+GLAW+VCVYGVPLLIVN FLV ITYLQHTHPALPHY+SSE
Sbjct  231  ISDVGIMAATYTLYKIAAARGLAWLVCVYGVPLLIVNAFLVTITYLQHTHPALPHYDSSE  290

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  291  WDWLRGALATADRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  350

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AM+RE +EC+YVEPD+G  +KGVFWYK  L
Sbjct  351  DGTPVYKAMWREARECLYVEPDDGANSKGVFWYKKNL  387



>gb|ABZ05022.1| delta-12 fatty acid desaturase [Davidia involucrata]
Length=382

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+++YLNNP GR  TL+I LTLGWPLYL FNVSGRPY RFACH++PYGPIY+DRER+QI+
Sbjct  166  WYSQYLNNPIGRILTLVITLTLGWPLYLAFNVSGRPYDRFACHYNPYGPIYNDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ AATY+LY++A AKGLAW++C YGVPLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  226  LSDAGVIAATYLLYRVAMAKGLAWLICTYGVPLLIVNGFLVLITYLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG+LNKVFHNITDTHV HHLFSTMPHYHAMEATKAIKP+LGEYYQ 
Sbjct  286  WDWLRGALATMDRDYGVLNKVFHNITDTHVTHHLFSTMPHYHAMEATKAIKPILGEYYQL  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE +EC+YVEPDEG  NKGVFWYKNK 
Sbjct  346  DGTPFYKAMWREARECLYVEPDEGTPNKGVFWYKNKF  382



>ref|XP_011080227.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Sesamum indicum]
 gb|AAF80560.1|AF192486_1 omega-6 fatty acid desaturase [Sesamum indicum]
 gb|AAX11454.1| microsomal oleic acid desaturase [Sesamum indicum]
Length=383

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL++ LTLGWPLYL+FNVSGRPY RFACHFDPYGPIY+DRER+QIF
Sbjct  167  WYSKYLNNPLGRVITLVVTLTLGWPLYLLFNVSGRPYNRFACHFDPYGPIYNDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AA  VLY++A  KGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  227  ISDAGIIAAVCVLYRVALVKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHV HHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGVLNKVFHNITDTHVTHHLFSTMPHYHAMEATKAIKPILGQYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDE   +KGVFWYKNK 
Sbjct  347  DGTPFYKAMWREAKECLYVEPDESTPDKGVFWYKNKF  383



>gb|AAS19533.1| omega-6 fatty acid desaturase [Cucurbita pepo]
Length=383

 Score =   386 bits (992),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++ YLNNP GR  TL I L LGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QIF
Sbjct  167  WYSPYLNNPLGRVLTLTITLVLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A +Y LY+L  AKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDAGLLAVSYGLYRLVLAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LGEYY F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLVSTMPHYHAMEATKAIKPILGEYYHF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KECIYVEPDEG+K KGVFWY NK 
Sbjct  347  DGTPFVKAMWREAKECIYVEPDEGEKTKGVFWYNNKF  383



>ref|XP_010257471.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Nelumbo nucifera]
Length=382

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYS+RERIQI+
Sbjct  166  WFSKYLNNPPGRVLTLAITLTLGWPLYLTFNVSGRHYDRFACHYDPYGPIYSNRERIQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A TY L++L AAKGLAWVVCVYGVPLLIVN FLVLITYLQHTH +LPHY+SSE
Sbjct  226  ISDAGILAVTYGLFRLVAAKGLAWVVCVYGVPLLIVNAFLVLITYLQHTHSSLPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  286  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATIAIKPILGEYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDE  K+KGV+WYKNK 
Sbjct  346  DGTPFYKAMWREAKECVYVEPDENSKDKGVYWYKNKF  382



>gb|EYU46325.1| hypothetical protein MIMGU_mgv1a008048mg [Erythranthe guttata]
Length=386

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACHFDPYGPIY++RER+QIF
Sbjct  170  WYSKYLNNPPGRFMTLFVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYNNRERLQIF  229

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A   +LYK+A AKGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  230  VSDVGVLAVLCLLYKVAMAKGLAWIVCVYGVPLLIVNGFLVLITFLQHTHPSLPHYDSSE  289

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  290  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYQF  349

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YV+PDE  + KGV+WYKNK 
Sbjct  350  DGTPFYKAMWREAKECLYVDPDESSQEKGVYWYKNKF  386



>ref|XP_006492862.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Citrus sinensis]
 ref|XP_006492863.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Citrus sinensis]
 gb|KDO70932.1| hypothetical protein CISIN_1g0167812mg [Citrus sinensis]
Length=383

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+AKYLNNP GR  TL + LTLGWPLYL FNVSGRPY RFACHFDPYGPIYSDRER+QIF
Sbjct  167  WYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY L AAKGL +V C+YG PLL+VNGFLVLIT LQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAMIYSLYCLVAAKGLVYVFCIYGGPLLVVNGFLVLITLLQHTHPSLPHYHSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDEGD+NKGVFWY+NK+
Sbjct  347  DGTPFYKAMWREAKECLYVEPDEGDQNKGVFWYRNKI  383



>gb|AAQ16653.1| delta-12 fatty acid desaturase 2 [Gossypium hirsutum]
 gb|AAQ16654.1| delta-12 fatty acid desaturase 2 [Gossypium hirsutum]
Length=384

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 200/218 (92%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  T+ IQLTLGWPLYL FNV+GRPY  FACH++PYGPIY+DRER+QI+
Sbjct  167  WWAKYLNNPPGRFVTITIQLTLGWPLYLAFNVAGRPYEGFACHYNPYGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHPALPHY+SSE
Sbjct  227  ISDVGVLAVTYGLYRLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTH+AHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHIAHHLFSTMPHYHAMEATKAIKPILGEYYSF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDK-NKGVFWYKNKL  98
            DGTP++ A+FRE KECIYVEPDEG++ +KGVFW++NK+
Sbjct  347  DGTPVYKAIFREAKECIYVEPDEGEQSSKGVFWFRNKI  384



>ref|XP_011080226.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Sesamum indicum]
Length=465

 Score =   389 bits (998),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL++ LTLGWPLYL+FNVSGRPY RFACHFDPYGPIY+DRER+QIF
Sbjct  249  WYSKYLNNPLGRVITLVVTLTLGWPLYLLFNVSGRPYNRFACHFDPYGPIYNDRERLQIF  308

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AA  VLY++A  KGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  309  ISDAGIIAAVCVLYRVALVKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHPSLPHYDSSE  368

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHV HHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  369  WDWLRGALATVDRDYGVLNKVFHNITDTHVTHHLFSTMPHYHAMEATKAIKPILGQYYQF  428

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDE   +KGVFWYKNK 
Sbjct  429  DGTPFYKAMWREAKECLYVEPDESTPDKGVFWYKNKF  465



>ref|XP_008392076.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Malus domestica]
Length=382

 Score =   385 bits (990),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  TL +QLTLGWPLYL FNVSGRPY  FACH+ PYGPI+SDRER+QIF
Sbjct  167  WWAKYLNNPPGRFLTLAVQLTLGWPLYLAFNVSGRPYKGFACHYHPYGPIFSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWV+C YG PL++VNG+LVLITYLQHTHPALPHY+SSE
Sbjct  227  VSDAGVLAVFYGLYRLAVAKGLAWVICFYGGPLMVVNGYLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATK IKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKVIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AMFREVKECIYVEPDEGD+ KGVFWY NKL
Sbjct  347  DGTPVYKAMFREVKECIYVEPDEGDE-KGVFWYNNKL  382



>ref|XP_009376128.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Pyrus x bretschneideri]
Length=382

 Score =   385 bits (989),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  TL +QLTLGWPLYL FNVSGRPY  FACH+ PYGPI+SDRER+QIF
Sbjct  167  WWAKYLNNPPGRFLTLAVQLTLGWPLYLAFNVSGRPYKGFACHYHPYGPIFSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWV+C YG PL++VNG+LVLITYLQHTHPALPHY+SSE
Sbjct  227  VSDIGVLAVFYGLYRLAVAKGLAWVICFYGGPLMVVNGYLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AMFREVKECIYVEPDEGD+ KGVFWY NKL
Sbjct  347  DGTPVHKAMFREVKECIYVEPDEGDE-KGVFWYNNKL  382



>ref|NP_001238358.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine max]
 sp|P48631.1|FD6E2_SOYBN RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Glycine max]
 gb|AAB00860.1| microsomal omega-6 desaturase [Glycine max]
Length=383

 Score =   385 bits (989),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL  NVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L++LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY SSE
Sbjct  227  ISDAGVLAVVYGLFRLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  347  DETPFVKAMWREARECIYVEPDQSTESKGVFWYNNKL  383



>gb|KHG25037.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Gossypium arboreum]
Length=392

 Score =   385 bits (990),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 200/218 (92%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  T+ IQLTLGWPLYL FNV+GRPY  FACH++PYGPIY+DRER+QI+
Sbjct  175  WWAKYLNNPPGRFVTVTIQLTLGWPLYLAFNVAGRPYEGFACHYNPYGPIYNDRERLQIY  234

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHPALPHY+SSE
Sbjct  235  ISDVGVLAVTYGLYRLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPALPHYDSSE  294

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  295  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYSF  354

Query  208  DGTPIFAAMFREVKECIYVEPDEGDK-NKGVFWYKNKL  98
            DGTP++ A+FRE KECIYVEPDEG++ +KGVFW++NK+
Sbjct  355  DGTPVYKAIFREAKECIYVEPDEGEQSSKGVFWFRNKI  392



>gb|KJB46318.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46319.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46320.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
 gb|KJB46321.1| hypothetical protein B456_007G362300 [Gossypium raimondii]
Length=384

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 200/218 (92%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  T+ IQLTLGWPLYL FNV+GRPY  FACH++PYGPIY+DRER+QI+
Sbjct  167  WWAKYLNNPPGRFVTITIQLTLGWPLYLAFNVAGRPYEGFACHYNPYGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHPALPHY+SSE
Sbjct  227  ISDVGVLAVTYGLYRLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTH+AHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHIAHHLFSTMPHYHAMEATKAIKPILGEYYSF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDK-NKGVFWYKNKL  98
            DGTP++ A+FRE KECIYVEPDEG++ ++GVFW++NK+
Sbjct  347  DGTPVYKAIFREAKECIYVEPDEGEQSSRGVFWFRNKI  384



>gb|KHN07428.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=383

 Score =   384 bits (986),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL  NVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L++LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY SSE
Sbjct  227  ISDAGVLAVCYGLFRLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  347  DETPFVKAMWREARECIYVEPDQSTESKGVFWYNNKL  383



>ref|XP_002530704.1| omega-6 desaturase, endoplasmic reticulum [Ricinus communis]
 gb|ABK59093.1| oleate desaturase [Ricinus communis]
 gb|EEF31658.1| omega-6 desaturase, endoplasmic reticulum [Ricinus communis]
Length=383

 Score =   384 bits (986),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  T+ + LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRERI+IF
Sbjct  167  WYSKYLNNPPGRIMTIAVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERIEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T+ LY+LA AKGLAWVVCVYGVPLL+VN FLVLIT+LQHTHPALPHY+SSE
Sbjct  227  ISDAGVLAVTFGLYQLAIAKGLAWVVCVYGVPLLVVNSFLVLITFLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT  + AM+RE KECIYVE D+ ++N GVFWY NK 
Sbjct  347  DGTSFYKAMWREAKECIYVEKDDAEQNGGVFWYNNKF  383



>ref|XP_004136572.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cucumis sativus]
 gb|KGN59307.1| hypothetical protein Csa_3G808360 [Cucumis sativus]
Length=382

 Score =   384 bits (985),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++ Y+NNP GR  TL IQL LGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QIF
Sbjct  167  WYSTYINNPVGRVLTLTIQLVLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+   TY LY+L  AKGLAWVVCVYGVPLLIVNGFLVLITYLQHTH ALPHY+SSE
Sbjct  227  ISDAGLLTVTYGLYRLVLAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHTALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LG+YY F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLVSTMPHYHAMEATKAIKPILGQYYHF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE KECIYVEPDEG+K KGV+WYKNKL
Sbjct  347  DGTPVVKAMWREAKECIYVEPDEGEK-KGVYWYKNKL  382



>gb|AAL37484.1|AF331163_1 delta-12 fatty acid desaturase [Gossypium hirsutum]
Length=384

 Score =   384 bits (985),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 199/218 (91%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AKYLNNPPGR  T+ IQLTLGWPLYL FNV+GRPY   ACH++PYGPIY+DRER+QI+
Sbjct  167  WWAKYLNNPPGRFVTVTIQLTLGWPLYLAFNVAGRPYEGLACHYNPYGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+L  AKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHPALPHY+SSE
Sbjct  227  ISDVGVLAVTYGLYRLVLAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYSF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDK-NKGVFWYKNKL  98
            DGTP++ A+FRE KECIYVEPDEG++ +KGVFW++NK+
Sbjct  347  DGTPVYKAIFREAKECIYVEPDEGEQSSKGVFWFRNKI  384



>ref|XP_009383220.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=375

 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W  KYLNNPPGR  TL I LTLGWPLYL FNVSGRPYPRFACHFDPYGPI+SDRER Q+ 
Sbjct  159  WFTKYLNNPPGRVLTLAITLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIFSDRERSQVV  218

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A +YVLY++AA  G  W+V VYGVPLLIVNG+LVLITYLQHTHP+LPHY+S E
Sbjct  219  ISDAGLMAVSYVLYRIAAGYGFWWLVRVYGVPLLIVNGWLVLITYLQHTHPSLPHYDSGE  278

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT+AIKPVLGEYYQF
Sbjct  279  WDWLRGALATVDRDYGLLNKVFHNITDTHVAHHLFSTMPHYHAMEATQAIKPVLGEYYQF  338

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE +ECIYVEPDEG + KGVFWY+NKL
Sbjct  339  DGTPLLKAMWREAQECIYVEPDEGSRKKGVFWYRNKL  375



>gb|ACF49508.1| omega-6 desaturase [Linum usitatissimum]
Length=378

 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I+
Sbjct  162  WYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIY  221

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIF   Y+LY+L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  222  LSDAGIFTVCYILYRLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHPSLPHYKSSE  281

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALSTVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  282  WDWLRGALSTVDRDYGLLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  341

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KECIYVEPDEGD ++GVFWY NKL
Sbjct  342  DGTPFVKAMWREAKECIYVEPDEGDPSQGVFWYNNKL  378



>gb|AAY87459.1| omega-6 fatty acid desaturase [Hevea brasiliensis]
Length=383

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GR  TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I 
Sbjct  167  WLSKYLNNPLGRVLTLIITLTLGWPLYLAFNVSGRPYNRFACHYDPYGPIYTDRERTEIC  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY LA AKGLAWVVCVYGVPLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYSLAVAKGLAWVVCVYGVPLLVVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPD+ D++KGV+WYKNK 
Sbjct  347  DGTPFYKAMWREAKECVYVEPDDRDQSKGVYWYKNKF  383



>gb|AGZ02022.1| microsomal omega-6-desaturase [Millettia pinnata]
Length=385

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 198/219 (90%), Gaps = 2/219 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GR  +L++ LTLGWPLYL FNVSGRPY RFA HFDPYGPIYSDRER+QI+
Sbjct  167  WFSKYLNNPLGRVVSLVVTLTLGWPLYLAFNVSGRPYDRFASHFDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+FA TY+LYK+A AKG AW++CVYGVPLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDVGLFAVTYLLYKIALAKGFAWLLCVYGVPLLIVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATMDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGD--KNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDEG     KGV+WY+NK 
Sbjct  347  DGTPFYKAMWREAKECLYVEPDEGTGGSEKGVYWYRNKF  385



>gb|ADB93805.1| delta-12-fatty acid desaturase [Jatropha curcas]
Length=383

 Score =   383 bits (983),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNN PGR FTL I L LGWPLYL FNVSGR Y RFACHFDPYGPIY+DRER +IF
Sbjct  167  WFSKYLNNLPGRLFTLTITLALGWPLYLAFNVSGRHYDRFACHFDPYGPIYNDRERTEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AATY LY+LA AKG AWV+CVYGVPLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAATYGLYRLALAKGFAWVICVYGVPLLVVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP F AM+RE KECIYVEPD+ D+++GVFWYKNK 
Sbjct  347  DRTPFFKAMWREAKECIYVEPDDADQSRGVFWYKNKF  383



>ref|XP_006429873.1| hypothetical protein CICLE_v10011949mg [Citrus clementina]
 gb|ESR43113.1| hypothetical protein CICLE_v10011949mg [Citrus clementina]
Length=383

 Score =   383 bits (983),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+AKYLNNP GR  TL + LTLGWPLYL FNVSGRPY RFACHFDPYGPIYS RER+QIF
Sbjct  167  WYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSHRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY L AAKGL +V C+YG PLL+VNGFLVLIT LQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAMIYSLYCLVAAKGLVYVFCIYGGPLLVVNGFLVLITLLQHTHPSLPHYHSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDEGD+NKGVFWY+NK+
Sbjct  347  DGTPFYKAMWREAKECLYVEPDEGDQNKGVFWYRNKI  383



>gb|AFJ53078.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53079.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53080.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53081.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53082.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53083.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53084.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53085.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53086.1| fatty acid desaturase 2 [Linum usitatissimum]
 gb|AFJ53087.1| fatty acid desaturase 2 [Linum usitatissimum]
Length=378

 Score =   382 bits (982),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I+
Sbjct  162  WYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIY  221

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIF   Y+LY+L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  222  LSDAGIFTVCYILYRLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHPSLPHYKSSE  281

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW+RGALSTVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  282  WDWMRGALSTVDRDYGLLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  341

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KECIYVEPDEGD ++GVFWY NKL
Sbjct  342  DGTPFVKAMWREAKECIYVEPDEGDPSQGVFWYNNKL  378



>ref|XP_010044976.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Eucalyptus grandis]
 gb|KCW87115.1| hypothetical protein EUGRSUZ_B03641 [Eucalyptus grandis]
Length=380

 Score =   382 bits (982),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPP R+ +L + LTLGWPLYL FNVSGRPY RF CH+DPYGPIYSDRER+QIF
Sbjct  164  WFSKYLNNPPCRSLSLAVTLTLGWPLYLAFNVSGRPYDRFTCHYDPYGPIYSDRERLQIF  223

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI AATY LY++AAAKGLAW+VC+YGVPLLIVN FLV IT+LQHTH ALPHY+SSE
Sbjct  224  VSDAGIMAATYGLYRVAAAKGLAWLVCMYGVPLLIVNAFLVTITFLQHTHAALPHYDSSE  283

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  284  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYHF  343

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  A++RE +EC+YVEPDEG ++KGVFWYKNK 
Sbjct  344  DGTPVHKAIWREARECLYVEPDEGSESKGVFWYKNKF  380



>gb|ABB05230.1| delta 12 desaturase [Linum usitatissimum]
Length=378

 Score =   382 bits (982),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I+
Sbjct  162  WYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIY  221

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIF   Y+LY+L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  222  LSDAGIFTVCYILYRLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHPSLPHYKSSE  281

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW+RGALSTVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  282  WDWMRGALSTVDRDYGLLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  341

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KECIYVEPDEGD ++GVFWY NKL
Sbjct  342  DGTPFVKAMWREAKECIYVEPDEGDPSQGVFWYNNKL  378



>ref|XP_007162321.1| hypothetical protein PHAVU_001G142100g [Phaseolus vulgaris]
 gb|ADO17551.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
 gb|AGV54471.1| omega-6 fatty acid desaturase [Phaseolus vulgaris]
 gb|ESW34315.1| hypothetical protein PHAVU_001G142100g [Phaseolus vulgaris]
Length=383

 Score =   382 bits (981),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QI+
Sbjct  167  WYSKYLNNPLGRVLTLVITLTLGWPLYLAFNVSGRPYERFACHYDPYGPIYTDRERMQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L+ LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHYNSSE
Sbjct  227  ISDAGVLAVCYGLFHLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYNSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LGEYY+ 
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLISTMPHYHAMEATKAIKPILGEYYRL  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD G ++KGVFWYKNKL
Sbjct  347  DETPFVKAMWREARECIYVEPDHGTEHKGVFWYKNKL  383



>gb|AEQ28964.1| omega-6 desaturase [Linum grandiflorum]
Length=385

 Score =   382 bits (981),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I+
Sbjct  169  WYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIY  228

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIF  +Y+LY+L   KGLAWVVC+YGVPLLIVNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  229  LSDAGIFTVSYILYRLVLTKGLAWVVCIYGVPLLIVNGFLVLITFLQHTHPSLPHYKSSE  288

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALSTVDRDYG LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  289  WDWLRGALSTVDRDYGFLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  348

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP    M+RE KECIYVE  EGD  KGVFWY NKL
Sbjct  349  DGTPFVKTMWREAKECIYVEQHEGDPRKGVFWYNNKL  385



>ref|XP_009777156.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana sylvestris]
Length=383

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  +L I LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER+QIF
Sbjct  167  WYSKYLNNPPGRVISLTITLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYNDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+  A Y+LY++A  KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGVLGAGYLLYRIALVKGLAWLVCMYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHV HHLFSTMPHY+AMEATKA+KP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPLLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVE DE  + KGVFWYKNKL
Sbjct  347  DGTPVFKAMWREAKECIYVEKDEASQGKGVFWYKNKL  383



>gb|AGZ02023.1| microsomal omega-6-desaturase [Millettia pinnata]
Length=383

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR FTL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER+QI+
Sbjct  167  WYSKYLNNPPGRLFTLTVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T+ LY+LA AKGLAWVVCVYGVPLLIVN FLVLITYLQHTHP++PHY+SSE
Sbjct  227  ISDAGVLAVTFGLYRLALAKGLAWVVCVYGVPLLIVNAFLVLITYLQHTHPSIPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KECIYVEPDEG +NKGV+WYKNK 
Sbjct  347  DGTPFVKAMWREAKECIYVEPDEGTQNKGVYWYKNKF  383



>gb|ABA41034.1| delta12-fatty acid desaturase [Jatropha curcas]
 gb|KDP24621.1| hypothetical protein JCGZ_25537 [Jatropha curcas]
Length=383

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNN PGR FTL I L LGWPLYL FNVSGR Y RFACHFDPYGPIY+DRER +IF
Sbjct  167  WFSKYLNNLPGRLFTLTITLALGWPLYLAFNVSGRHYDRFACHFDPYGPIYNDRERTEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKG AWV+CVYGVPLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYRLALAKGFAWVICVYGVPLLVVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP F AM+RE KECIYVEPD+ D+++GVFWYKNK 
Sbjct  347  DRTPFFKAMWREAKECIYVEPDDADQSRGVFWYKNKF  383



>gb|AAT72296.2| microsomal omega-6-desaturase [Nicotiana tabacum]
Length=383

 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  +L + LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER+QIF
Sbjct  167  WYSKYLNNPPGRVMSLTVTLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYNDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+  A Y+LY++A  KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGVLGAGYLLYRIALVKGLAWLVCMYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHV HHLFSTMPHY+AMEATKA+KP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPLLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVE DE  + KGVFWYKNKL
Sbjct  347  DGTPVFKAMWREAKECIYVEKDEASQGKGVFWYKNKL  383



>ref|XP_007014826.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 ref|XP_007014827.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 ref|XP_007014828.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 gb|EOY32445.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 gb|EOY32446.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
 gb|EOY32447.1| Microsomal oleic acid desaturase isoform 1 [Theobroma cacao]
Length=377

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ +YLNNP GR  +L I LTLGWPLYL FNVSGR Y RFACHFDP+GPIYS+R+R+QI+
Sbjct  161  WYTRYLNNPLGRVVSLAITLTLGWPLYLAFNVSGRNYDRFACHFDPHGPIYSNRDRLQIY  220

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AATYVLY +AA KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHPALPHY SSE
Sbjct  221  ISDAGILAATYVLYNIAATKGLAWLVCIYGVPLLIVNGFLVLITYLQHTHPALPHYGSSE  280

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY+F
Sbjct  281  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYRF  340

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AM+RE KEC+YVEPDE   +KGVFWY+NK 
Sbjct  341  DGTPVYKAMWREAKECLYVEPDEDAGSKGVFWYRNKF  377



>gb|AGH32914.1| fatty acid desaturase [Camellia chekiangoleosa]
Length=383

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  T++I LTLGWPLYLMFNVSGR Y RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRILTVIITLTLGWPLYLMFNVSGRHYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+   +YVLY+ A  KGLAWV+C+YG PLLIVNGFLVLIT+LQHTHPALPHY+SSE
Sbjct  227  LSDAGVLGVSYVLYRFALVKGLAWVLCLYGGPLLIVNGFLVLITWLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ 
Sbjct  287  WDWLRGALATCDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQC  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  A++RE KECIYVE DE D+ KGVFWYKNKL
Sbjct  347  DGTPVLRAIWREAKECIYVENDESDQTKGVFWYKNKL  383



>ref|XP_010058087.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X2 [Eucalyptus grandis]
 gb|KCW90306.1| hypothetical protein EUGRSUZ_A02449 [Eucalyptus grandis]
Length=383

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNNP GR  TL + LTLGWPLYLMFNVSGRPY RFA H+DPYGPIY+DRER+QI+
Sbjct  167  WFSNYLNNPLGRVITLTVTLTLGWPLYLMFNVSGRPYDRFASHYDPYGPIYTDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY LAAAKGLAWV+CVYG PLL+VN FLVLITYLQHTH +LPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYHLAAAKGLAWVMCVYGGPLLVVNAFLVLITYLQHTHASLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFH+ITDTHVAHHLFSTMPHYHAMEATKAIKPVLG+YY F
Sbjct  287  WDWLRGALATVDRDYGVLNKVFHHITDTHVAHHLFSTMPHYHAMEATKAIKPVLGDYYHF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT ++ A +RE KECIYVEPDEGD+NKGVFWYKNKL
Sbjct  347  DGTSVYKAAWREAKECIYVEPDEGDQNKGVFWYKNKL  383



>gb|AFN53642.1| omega-6 desaturase [Linum usitatissimum]
Length=508

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            WH+KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF
Sbjct  160  WHSKYLNNPPGRVLTLAVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIF  219

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
             SD GI A ++ LYKLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  220  FSDAGILAVSFALYKLAVAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPSLPHYKSSE  279

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  280  WDWLRGALATMDRDYGFLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  339

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFW  113
            DGTP   AM+RE KEC+YVEPDEGD+NKGVFW
Sbjct  340  DGTPFIKAMWREAKECVYVEPDEGDQNKGVFW  371



>ref|XP_010087393.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXB29003.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=384

 Score =   381 bits (978),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  +LL+ LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QIF
Sbjct  168  WYSKYLNNPPGRLLSLLVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIF  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIF  T+VLY+LAAAKGLAW+VCVYGVPLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  228  VSDAGIFVTTFVLYQLAAAKGLAWIVCVYGVPLLIVNGFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN+VFHNI DTHVAHHLFSTMPHY+AMEATKA+KP+LGEYY+F
Sbjct  288  WDWLRGALATVDRDYGVLNRVFHNINDTHVAHHLFSTMPHYNAMEATKAVKPLLGEYYRF  347

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPIF AM+RE KEC+YVEPD+   NKGVFWY+NKL
Sbjct  348  DRTPIFKAMWREAKECLYVEPDDDAPNKGVFWYRNKL  384



>ref|XP_008443062.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Cucumis melo]
Length=492

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++ YLNNP GR  TL IQL LGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QIF
Sbjct  277  WYSTYLNNPVGRVLTLTIQLVLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIF  336

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y LY+L  AKG AWVVCVYGVPLLIVNGFLVLITYLQHTH ALPHY+SSE
Sbjct  337  ISDAGLLAVAYGLYRLVLAKGFAWVVCVYGVPLLIVNGFLVLITYLQHTHTALPHYDSSE  396

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LG+YY F
Sbjct  397  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLVSTMPHYHAMEATKAIKPILGQYYHF  456

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE KECIYVEPDEG+K KG++WYKNKL
Sbjct  457  DGTPVVKAMWREAKECIYVEPDEGEK-KGIYWYKNKL  492



>gb|KJB15034.1| hypothetical protein B456_002G156600 [Gossypium raimondii]
Length=377

 Score =   380 bits (976),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AK+ NNPPGR  ++ IQLTLGWPLYL FNV+GRPY RFACH+DPYGPI+SDRER+QI+
Sbjct  161  WWAKHFNNPPGRFLSITIQLTLGWPLYLAFNVAGRPYDRFACHYDPYGPIFSDRERLQIY  220

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y LY+L  AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  221  ISDAGVLAVAYALYRLVLAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHPSLPHYDSSE  280

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW+RGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAM ATKAIKP+LGEYYQF
Sbjct  281  WDWMRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMVATKAIKPILGEYYQF  340

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DG P++ A++RE KEC+YVEPDEGDK+KGVFW++NKL
Sbjct  341  DGMPVYKAIWREAKECLYVEPDEGDKDKGVFWFRNKL  377



>gb|AEI60128.1| microsomal delta-12 oleate desaturase [Vitis labrusca]
Length=382

 Score =   380 bits (976),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 198/217 (91%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL IQLTLGWPLYLMFNVSGR Y RFACH+DP+GPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNVSGRRYSRFACHYDPHGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA +KGL WV+CVYG PLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAITYGLYRLAVSKGLTWVLCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYGILNKVFH+ITDTHVAHHLFSTMPHYHAMEATKAIKPVLG+YYQF
Sbjct  287  WDWLRGALATMDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATKAIKPVLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YV+ D GDK+KGVFWY+NK 
Sbjct  347  DGTPFYKAMWREAKECVYVQSD-GDKSKGVFWYQNKF  382



>emb|CAA71199.1| omega-6 desaturase [Gossypium hirsutum]
Length=383

 Score =   380 bits (976),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AK+ NNPPGR  ++ IQLTLGWPLYL FNV+GRPY RFACH+DPYGPI+SDRER+QI+
Sbjct  167  WWAKHFNNPPGRFLSITIQLTLGWPLYLAFNVAGRPYDRFACHYDPYGPIFSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y LY+L  AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVAYALYRLVLAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW+RGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAM ATKAIKP+LGEYYQF
Sbjct  287  WDWMRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMVATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DG P++ A++RE KEC+YVEPDEGDK+KGVFW++NKL
Sbjct  347  DGMPVYKAIWREAKECLYVEPDEGDKDKGVFWFRNKL  383



>gb|AFK34956.1| unknown [Lotus japonicus]
Length=384

 Score =   380 bits (975),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  T+ I LTLGWPLYL FNVSGRPY RFACHFDPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRFLTITITLTLGWPLYLTFNVSGRPYERFACHFDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  + LY LA AKGLAWVVCVYGVPLL+VNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDVGVLAVCFGLYHLAVAKGLAWVVCVYGVPLLVVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTH+AHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHIAHHLFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP + A++RE  EC+YVEPD+G + KGVFWY  KL
Sbjct  347  DSTPFYKAIWREATECVYVEPDQGTETKGVFWYNKKL  383



>gb|AEW43691.1| fatty acid desaturase 2 [Jatropha curcas]
 gb|KDP44415.1| hypothetical protein JCGZ_19430 [Jatropha curcas]
Length=387

 Score =   380 bits (976),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+++YLNNP GRA  L   LT+GWPLYL FNVSGRPY RFACHFDP GPIYSDRER+QI+
Sbjct  171  WYSQYLNNPLGRALALAATLTVGWPLYLAFNVSGRPYNRFACHFDPSGPIYSDRERLQIY  230

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GIFAATYVLY++A AKGLAW++ +YG+PLLIVN FLV ITYLQHTHPALPHY+SSE
Sbjct  231  ISDIGIFAATYVLYQIAMAKGLAWLISIYGIPLLIVNAFLVTITYLQHTHPALPHYDSSE  290

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALSTVDRDYG+LNKVFHNITDTHV HHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  291  WDWLRGALSTVDRDYGVLNKVFHNITDTHVTHHLFSTMPHYHAMEATKAIKPILGEYYQF  350

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            DGTPI  A++RE KEC++VEP+EG  N+GV WY NK
Sbjct  351  DGTPILMALWREAKECLFVEPEEGGPNRGVLWYGNK  386



>dbj|BAD89862.1| microsomal omega-6 fatty acid desaturase [Glycine max]
Length=383

 Score =   380 bits (975),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL  NVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L++LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY SSE
Sbjct  227  ISDAGVLAVCYGLFRLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGIL+KVFHNITDTHVAH LFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILDKVFHNITDTHVAHELFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  347  DETPFVKAMWREARECIYVEPDQSTESKGVFWYNNKL  383



>gb|AEW43690.1| fatty acid desaturase 2 [Jatropha curcas]
Length=383

 Score =   380 bits (975),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNN PGR FTL I L LGWPLYL FNVSGR Y RFACHFDPYGPIY+DRER +IF
Sbjct  167  WFSKYLNNLPGRLFTLTITLALGWPLYLAFNVSGRHYDRFACHFDPYGPIYNDRERTEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKG AWV+CVYGVPLL+V+ FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYRLALAKGFAWVICVYGVPLLVVSAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP F AM+RE KECIYVEPD+ D+++GVFWYKNK 
Sbjct  347  DRTPFFKAMWREAKECIYVEPDDADQSRGVFWYKNKF  383



>ref|XP_006354202.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum tuberosum]
Length=383

 Score =   380 bits (975),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  +L I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY++RER+QIF
Sbjct  167  WYSKYLNNPPGRVLSLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+    Y+LY++A  KGLAW+VC+YGVPLL+VNGFLVLITYLQHTHP+LPHY+S+E
Sbjct  227  VSDAGVLGVCYLLYRVALVKGLAWLVCIYGVPLLVVNGFLVLITYLQHTHPSLPHYDSTE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYG+LNKVFHNITDTHV HHLFSTMPHY+AMEATKA+KP+LG+YYQF
Sbjct  287  WDWLRGALATCDRDYGVLNKVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPLLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KEC+YVE DE  + KGVFWYKNKL
Sbjct  347  DGTPIFKAMWREAKECLYVEKDESSQGKGVFWYKNKL  383



>ref|XP_010058070.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Eucalyptus grandis]
 ref|XP_010058078.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 isoform X1 [Eucalyptus grandis]
Length=413

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNNP GR  TL + LTLGWPLYLMFNVSGRPY RFA H+DPYGPIY+DRER+QI+
Sbjct  197  WFSNYLNNPLGRVITLTVTLTLGWPLYLMFNVSGRPYDRFASHYDPYGPIYTDRERLQIY  256

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY LAAAKGLAWV+CVYG PLL+VN FLVLITYLQHTH +LPHY+SSE
Sbjct  257  ISDAGVLAVTYGLYHLAAAKGLAWVMCVYGGPLLVVNAFLVLITYLQHTHASLPHYDSSE  316

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFH+ITDTHVAHHLFSTMPHYHAMEATKAIKPVLG+YY F
Sbjct  317  WDWLRGALATVDRDYGVLNKVFHHITDTHVAHHLFSTMPHYHAMEATKAIKPVLGDYYHF  376

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT ++ A +RE KECIYVEPDEGD+NKGVFWYKNKL
Sbjct  377  DGTSVYKAAWREAKECIYVEPDEGDQNKGVFWYKNKL  413



>ref|XP_002279239.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Vitis vinifera]
Length=382

 Score =   379 bits (974),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 198/217 (91%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL IQLTLGWPLYLMFNVSGR Y RFACHFDP+GPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNVSGRRYSRFACHFDPHGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA +KGL WV+CVYG PLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAITYGLYRLAVSKGLTWVLCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYGILNKVFH+ITDTHVAHHLFST+PHYHAMEATKAIKPVLG+YYQF
Sbjct  287  WDWLRGALATMDRDYGILNKVFHHITDTHVAHHLFSTLPHYHAMEATKAIKPVLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YV+ D GDK+KGVFWY+NK 
Sbjct  347  DGTPFYKAMWREAKECVYVQSD-GDKSKGVFWYQNKF  382



>ref|XP_009613562.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nicotiana tomentosiformis]
Length=383

 Score =   379 bits (974),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  +L + LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER+QIF
Sbjct  167  WYSKYLNNPPGRVMSLTVTLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYNDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+  A Y+LY++A  KGLAW+VC+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGVLGAGYLLYRIALVKGLAWLVCMYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHV HHLFSTMPHY+A+EATKA+KP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVVHHLFSTMPHYNAVEATKAVKPLLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVE DE  + KGVFWYKNKL
Sbjct  347  DGTPVFKAMWREAKECIYVEKDEASQGKGVFWYKNKL  383



>ref|XP_002297660.2| microsomal omega-6 desaturase family protein [Populus trichocarpa]
 gb|EEE82465.2| microsomal omega-6 desaturase family protein [Populus trichocarpa]
Length=382

 Score =   379 bits (974),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGRA +L++ L LGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  166  WYSKYLNNPPGRALSLVVTLLLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GIFAAT+VLY +A ++GLA+++C+YGVPLLI NGFLV ITYLQHTHPALPHY+SSE
Sbjct  226  ISDLGIFAATFVLYSIAVSRGLAFLICIYGVPLLIANGFLVTITYLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            W+WLRGAL+T+DRDYGILNKVFHNITDTHVAHHLFS MPHYHAMEATKAIKP+LGE+YQF
Sbjct  286  WEWLRGALATMDRDYGILNKVFHNITDTHVAHHLFSNMPHYHAMEATKAIKPILGEFYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPI+ A++RE KEC+YV+PD+G   KGVFWY+NK 
Sbjct  346  DDTPIYKALWRETKECLYVDPDDGAPEKGVFWYRNKF  382



>gb|AFK31315.1| fatty acid desaturase [Camellia oleifera]
Length=383

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  T++I LTLGWPLYLMFNVSGR Y RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPPGRILTVVITLTLGWPLYLMFNVSGRHYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+   +YVLY+ A  KGLAWV+C+YG PLLIVNGFLVLIT+LQHTHPALPHY+SSE
Sbjct  227  LSDAGVLGVSYVLYRFALVKGLAWVLCLYGGPLLIVNGFLVLITWLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ 
Sbjct  287  WDWLRGALATCDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQC  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+  A++RE KECIYVE DE D+ KGVFWYKNKL
Sbjct  347  DATPVLRAIWREAKECIYVENDESDQTKGVFWYKNKL  383



>gb|KHN35589.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=361

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL  NVSGRPY RFA H+DPYGPIYSDRER+QI+
Sbjct  145  WYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFAYHYDPYGPIYSDRERLQIY  204

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L++LA AKGLAWVVCVYGVPLL+VNGF VLIT+LQHT PALPHY SSE
Sbjct  205  ISDAGVLAVCYGLFRLAMAKGLAWVVCVYGVPLLVVNGFSVLITFLQHTQPALPHYTSSE  264

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  265  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  324

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  325  DETPFVKAMWREARECIYVEPDQSTESKGVFWYNNKL  361



>ref|XP_007204396.1| hypothetical protein PRUPE_ppa007098mg [Prunus persica]
 gb|EMJ05595.1| hypothetical protein PRUPE_ppa007098mg [Prunus persica]
 gb|AGM53489.1| omega-6 fatty acid desaturase [Prunus persica]
Length=382

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL IQLTLGWPLYL FNVSGR Y  FACH+ PYGPI+SDRER+QIF
Sbjct  167  WYSKYLNNPPGRFLTLTIQLTLGWPLYLAFNVSGRHYEGFACHYHPYGPIFSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWVVC YG PL++VNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGVLAVVYGLYRLAVAKGLAWVVCYYGGPLMVVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ 
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQL  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+F AMFRE KECIYVE DEGDK KGVFWY NKL
Sbjct  347  DRTPVFKAMFREAKECIYVERDEGDK-KGVFWYNNKL  382



>ref|XP_004304366.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Fragaria vesca subsp. vesca]
Length=382

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL I LTLGWPLYL FNVSGRPY  FACH+ PYGPIYSDRER+QI+
Sbjct  167  WWSKYLNNPPGRVLTLAITLTLGWPLYLAFNVSGRPYDGFACHYHPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y LY+LA AKGLAWV+C YG PLL+VN FLVLIT+LQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVCYGLYRLAVAKGLAWVLCFYGGPLLVVNAFLVLITFLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPDE DK KGVFWYKNKL
Sbjct  347  DGTPFYKAMWREAKECIYVEPDEVDK-KGVFWYKNKL  382



>emb|CAA63432.1| D12 oleate desaturase [Solanum commersonii]
Length=383

 Score =   378 bits (970),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  +L I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY++RER+QIF
Sbjct  167  WYSKYLNNPPGRVLSLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+    Y+LY++A  KGLAW+VCVYGVPLL+VNGFLVLITYLQHTHP+LPHY+S+E
Sbjct  227  ISDAGVLGVCYLLYRIALVKGLAWLVCVYGVPLLVVNGFLVLITYLQHTHPSLPHYDSTE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYG+LNKVFHNITDTHV HHLFSTMPHY+AMEATKA+KP+LG+YYQF
Sbjct  287  WDWLRGALATCDRDYGVLNKVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPLLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPI+  M+RE KEC+YVE DE  + KGVFWYKNKL
Sbjct  347  DGTPIYKEMWREAKECLYVEKDESSQGKGVFWYKNKL  383



>gb|AAW63041.1| microsomal delta-12 oleate desaturase [Olea europaea]
Length=383

 Score =   377 bits (968),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +K LNNPPGR   L+ QLTLGWPLYLMFNVSGR Y RFACH++P+ P+YSDRER QI 
Sbjct  167  WISKNLNNPPGRVLLLVFQLTLGWPLYLMFNVSGRHYDRFACHYNPHSPMYSDRERAQIL  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T  LY+L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTCGLYRLTAAKGLAWVFCVYGGPLLVVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRD+GILNKVFHNITDTHV+HHLFSTMPHYHAMEATKAIKP+LG YYQF
Sbjct  287  WDWLRGALATVDRDWGILNKVFHNITDTHVSHHLFSTMPHYHAMEATKAIKPILGNYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KECIYVE DEGD+NKGVFWY N L
Sbjct  347  DGTPIFKAMWREAKECIYVERDEGDQNKGVFWYNNTL  383



>gb|ADZ39688.1| microsomal delta-12 oleate desaturase [Olea europaea subsp. europaea]
Length=383

 Score =   377 bits (968),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +K LNNPPGR   L+ QLTLGWPLYLMFNVSGR Y RFACH++P+ P+YSDRER QI 
Sbjct  167  WISKNLNNPPGRVLLLVFQLTLGWPLYLMFNVSGRHYDRFACHYNPHSPMYSDRERAQIL  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T  LY+L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTCGLYRLTAAKGLAWVFCVYGGPLLLVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRD+GILNKVFHNITDTHV+HHLFSTMPHYHAMEATKAIKP+LG YYQF
Sbjct  287  WDWLRGALATVDRDWGILNKVFHNITDTHVSHHLFSTMPHYHAMEATKAIKPILGNYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KECIYVE DEGD+NKGVFWY N L
Sbjct  347  DGTPIFKAMWREAKECIYVERDEGDQNKGVFWYNNTL  383



>dbj|BAD89863.1| microsomal omega-6 fatty acid desaturase [Glycine max]
Length=337

 Score =   375 bits (963),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL  NVSGRPY RFA H+DPYGPIYSDRER+QI+
Sbjct  121  WYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFAYHYDPYGPIYSDRERLQIY  180

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L++LA AKGLAWVVCVYGVPLL+VNGF VLIT+LQHT PALPHY SSE
Sbjct  181  ISDAGVLAVCYGLFRLAMAKGLAWVVCVYGVPLLVVNGFSVLITFLQHTQPALPHYTSSE  240

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  241  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  300

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  301  DETPFVKAMWREARECIYVEPDQSTESKGVFWYNNKL  337



>ref|NP_001237865.1| microsomal oleate desaturase FAD2-4 [Glycine max]
 gb|ABF84063.1| microsomal oleate desaturase FAD2-3 [Glycine max]
Length=383

 Score =   377 bits (967),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL  NVSGRPY RFA H DPY PIYSD ER+QI+
Sbjct  167  WYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFASHLDPYSPIYSDNERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A  Y L+ LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY SSE
Sbjct  227  ISDAGVLAVCYGLFCLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYTSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE +ECIYVEPD+  ++KGVFWY NKL
Sbjct  347  DGTPFVKAMWREARECIYVEPDQSTQSKGVFWYNNKL  383



>gb|AAC24586.1| omega-6 fatty acid desaturase [Prunus armeniaca]
Length=346

 Score =   375 bits (963),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL IQLTLGWPLYL FNVSGR Y  FACH+ PYGPI+SDRER+QIF
Sbjct  131  WYSKYLNNPPGRFLTLTIQLTLGWPLYLAFNVSGRHYEGFACHYHPYGPIFSDRERLQIF  190

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWVVC YG PL++VNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  191  LSDAGVLAVVYGLYRLAVAKGLAWVVCYYGGPLMVVNGFLVLITYLQHTHPSLPHYDSSE  250

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ 
Sbjct  251  WDWLKGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQL  310

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+F AMFRE KECIY++ DEGD+ KGVFWY NKL
Sbjct  311  DRTPVFKAMFREAKECIYIQRDEGDQ-KGVFWYNNKL  346



>gb|AGN95842.1| fatty acid delta12-desturase FAD2-2 [Hiptage benghalensis]
Length=383

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+AKYL+NP GR  TL+I LTLGWPLYL FNVSGRPY RFACH+DPY PIY+ RER+QI+
Sbjct  167  WYAKYLDNPVGRLVTLIITLTLGWPLYLAFNVSGRPYDRFACHYDPYSPIYTYRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKGLAWV+CVYG PLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDVGVLAVTYGLYRLAVAKGLAWVLCVYGGPLLVVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGSYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KECIYVEPDE   +KGV WY+NK 
Sbjct  347  DGTPVYKAIWREAKECIYVEPDEQSDSKGVLWYRNKF  383



>ref|XP_004228665.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
 ref|XP_004228667.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Solanum lycopersicum]
Length=383

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL + LTLGWPLYL FNVSGRPY RFACH+DPYGPIY++RER+QIF
Sbjct  167  WYSKYLNNPLGRVITLTVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+  A Y+LY++A  KGLAW+VC+YGVPLL+VNGFLVLITYLQHTHP+LPHY+S+E
Sbjct  227  LSDAGVLGACYLLYRVALVKGLAWLVCIYGVPLLVVNGFLVLITYLQHTHPSLPHYDSTE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYG+LNKVFHNITDTHV HHLFS MPHY+AMEATKA+KP+LG+YYQF
Sbjct  287  WDWLRGALATCDRDYGVLNKVFHNITDTHVVHHLFSAMPHYNAMEATKAVKPLLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KEC+YVE DE  + KGVFWYKNKL
Sbjct  347  DGTPIFKAMWREAKECLYVEKDESSQGKGVFWYKNKL  383



>ref|XP_008240937.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Prunus mume]
Length=382

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL IQLTLGWPLYL FNVSGR Y  FACH+ PYGPI+SDRER+QIF
Sbjct  167  WYSKYLNNPPGRFLTLTIQLTLGWPLYLAFNVSGRHYEGFACHYHPYGPIFSDRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LY+LA AKGLAWVVC YG PL++VNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGVLAVVYGLYRLAVAKGLAWVVCYYGGPLMVVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ 
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQL  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+F AMFRE KECIY++ DEGD+ KGVFWY NKL
Sbjct  347  DRTPVFKAMFREAKECIYIQRDEGDQ-KGVFWYNNKL  382



>gb|KHN12315.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Glycine soja]
Length=386

 Score =   376 bits (966),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNN PGR  TL I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYS+RER+QI+
Sbjct  170  WYSKYLNNSPGRVLTLAITLTLGWPLYLAFNVSGRSYERFACHYDPYGPIYSNRERLQIY  229

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LYK   AKGL WVVCVYGVPLL+VNGFLVLIT+LQHTHPA+PHY+SSE
Sbjct  230  VSDAGILAVCFGLYKAVLAKGLVWVVCVYGVPLLVVNGFLVLITFLQHTHPAVPHYDSSE  289

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKV HNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  290  WDWLRGALATVDRDYGILNKVLHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYHF  349

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPI+ AM+RE KEC+YVEPD+G   KGV+WY NKL
Sbjct  350  DETPIYKAMWREAKECMYVEPDKGSNGKGVYWYNNKL  386



>ref|XP_011004831.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Populus euphratica]
Length=387

 Score =   376 bits (966),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 195/220 (89%), Gaps = 3/220 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IF
Sbjct  167  WYSKYLNNPLGRFLTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A TY LY+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVTYGLYRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+TVDRDYGILNKVFHNITDTHVAHHLFS MPHYHAMEATK IKP+LG+YYQ+
Sbjct  287  WDWLKGALATVDRDYGILNKVFHNITDTHVAHHLFSMMPHYHAMEATKVIKPILGDYYQY  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGD---KNKGVFWYKNKL  98
            DGTPI+ A +RE KECIYV PDE D   KNKGVFWY+NKL
Sbjct  347  DGTPIYKATWRETKECIYVHPDEDDDKQKNKGVFWYRNKL  386



>emb|CAN71892.1| hypothetical protein VITISV_040865 [Vitis vinifera]
Length=382

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL IQLTLGWPLYLMFNVSGR Y RFACH DP+GPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRFVTLTIQLTLGWPLYLMFNVSGRRYSRFACHXDPHGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA +KGL WV+CVYG PLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAITYGLYRLAVSKGLTWVLCVYGCPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYGILNKVFH+ITDTHVAHHLFST PHYHAMEATKAIKPVLG+YYQF
Sbjct  287  WDWLRGALATMDRDYGILNKVFHHITDTHVAHHLFSTXPHYHAMEATKAIKPVLGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YV+ D GDK+KGVFWY+NK 
Sbjct  347  DGTPFYKAMWREAKECVYVQSD-GDKSKGVFWYQNKF  382



>gb|AGN95841.1| fatty acid delta12-desturase FAD2-1 [Hiptage benghalensis]
Length=383

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+AKYL+NP GR  TL+I LTLGWPLYL FNVSGRPY RFACH+DPY P+Y+DRER QI+
Sbjct  167  WYAKYLDNPVGRLMTLIITLTLGWPLYLAFNVSGRPYDRFACHYDPYSPMYTDRERRQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA A+GLAWV+CVYG PLL+VN FLV ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDVGVLAVTYGLYRLAVAEGLAWVICVYGGPLLVVNAFLVTITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGSYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KECIYVEPDE   +KGVFWY+ K 
Sbjct  347  DGTPVYKAIWREAKECIYVEPDEQSDSKGVFWYRKKF  383



>ref|XP_010277281.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
 ref|XP_010277282.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
Length=382

 Score =   375 bits (964),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  +L I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYSDRERIQI+
Sbjct  166  WYSKYLNNPLGRVLSLAITLTLGWPLYLAFNVSGRHYDRFACHYDPYGPIYSDRERIQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY L+ L A KGL+WV+C+YGVPLLIVNGFLV ITYLQHTHP+LPHY+SSE
Sbjct  226  ISDAGVLAVTYGLFCLVAMKGLSWVICIYGVPLLIVNGFLVTITYLQHTHPSLPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  286  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE +EC+YVEPDE  + +GVFWY+NK 
Sbjct  346  DGTPFYKAMWREARECLYVEPDENLQERGVFWYRNKF  382



>gb|ADP07951.1| microsomal omega-6 desaturase [Phaseolus lunatus]
Length=352

 Score =   374 bits (961),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL++ LT GWP+YL FNVSGRPY RFACH+DPYGPIY+D ERIQI+
Sbjct  136  WYSKYLNNPLGRVLTLVVTLTPGWPMYLAFNVSGRPYDRFACHYDPYGPIYTDSERIQIY  195

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A +Y L+ LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHYNSSE
Sbjct  196  ISDAGVLAVSYGLFHLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYNSSE  255

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LGEYY+ 
Sbjct  256  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLISTMPHYHAMEATKAIKPILGEYYRL  315

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP   AM+RE +ECIYVEPD G  +KGVFWY NKL
Sbjct  316  DETPFVKAMWREARECIYVEPDHGTDHKGVFWYNNKL  352



>ref|XP_011037927.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Populus euphratica]
Length=382

 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+++YLNNPPGRA +L + + LGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  166  WYSQYLNNPPGRALSLGVTILLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GIFAAT+VLY +A ++GL +++C+YGVPLLI NGFLV ITYLQHTHPALPHY+SSE
Sbjct  226  ISDLGIFAATFVLYSIAVSRGLGFLICIYGVPLLIANGFLVTITYLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            W+WLRGALST+DRDYGILNKVFHNITDTHVAHHLFS MPHYHAMEATKAIKP+LGE+YQF
Sbjct  286  WEWLRGALSTMDRDYGILNKVFHNITDTHVAHHLFSNMPHYHAMEATKAIKPILGEFYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPI+ A++RE KEC+YV+PD+G   KGVFWY+NK 
Sbjct  346  DDTPIYKALWRETKECLYVDPDDGAPEKGVFWYRNKF  382



>ref|XP_009395096.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=392

 Score =   375 bits (964),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++ YLNNPPGR  TL + LTLGWPLYL FNVSGR YPRFACH+DPYGPIYSDRER QIF
Sbjct  176  WYSTYLNNPPGRILTLAVTLTLGWPLYLAFNVSGRAYPRFACHYDPYGPIYSDRERAQIF  235

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AA Y LY++AA+ G  WVV VYGVPLLIVNG+LVLITYLQHTHP+LPHY+SSE
Sbjct  236  ISDAGLMAAVYALYRIAASYGFWWVVRVYGVPLLIVNGWLVLITYLQHTHPSLPHYDSSE  295

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILN VFHNITDTHVAHHLFSTMPHYHAMEAT+ IKP+LGEYYQ+
Sbjct  296  WDWLRGALATVDRDYGILNNVFHNITDTHVAHHLFSTMPHYHAMEATRVIKPLLGEYYQY  355

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE +EC+YVEPDEG   KGVFWY+N +
Sbjct  356  DGTPLLKAMWREARECLYVEPDEGSTKKGVFWYRNDI  392



>ref|XP_006445919.1| hypothetical protein CICLE_v10015614mg [Citrus clementina]
 gb|ESR59159.1| hypothetical protein CICLE_v10015614mg [Citrus clementina]
Length=379

 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -1

Query  745  HAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFI  566
            ++KY NNPPGRA TLL+ LTLGWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+I
Sbjct  164  YSKYFNNPPGRALTLLVTLTLGWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYI  223

Query  565  SDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  386
            SD GIFAATYVLY++A AKGLAW++CVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW
Sbjct  224  SDAGIFAATYVLYRVAMAKGLAWLICVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  283

Query  385  DWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFD  206
            DWLRGALSTVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT A+KP+LGEYYQFD
Sbjct  284  DWLRGALSTVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATIAMKPILGEYYQFD  343

Query  205  GTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            G P + A +RE KEC+YVEPDE    KG+FWY+NKL
Sbjct  344  GMPFYKAAWREAKECLYVEPDENSPTKGIFWYRNKL  379



>gb|AEK67593.1| omega-6 fatty acid desaturase [Citrus medica var. sarcodactylis]
Length=383

 Score =   375 bits (963),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -1

Query  745  HAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFI  566
            ++KY NNPPGRA TLL+ LTLGWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+I
Sbjct  168  YSKYFNNPPGRALTLLVTLTLGWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYI  227

Query  565  SDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  386
            SD GIFAATYVLY++A AKGLAW++CVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW
Sbjct  228  SDAGIFAATYVLYRVAMAKGLAWLICVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  287

Query  385  DWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFD  206
            DWLRGALSTVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT A+KP+LGEYYQFD
Sbjct  288  DWLRGALSTVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATIAMKPILGEYYQFD  347

Query  205  GTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            G P + A +RE KEC+YVEPDE    KG+FWY+NKL
Sbjct  348  GMPFYKAAWREAKECLYVEPDENSPTKGIFWYRNKL  383



>ref|XP_010943510.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Elaeis guineensis]
Length=391

 Score =   375 bits (963),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  T+++ LTLGWPLYL FNVSGRPYPR ACH+DPY PIYSDRER QIF
Sbjct  175  WYSKYLNNPPGRLLTMVVTLTLGWPLYLAFNVSGRPYPRLACHYDPYSPIYSDRERAQIF  234

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISDTG+ AA++ LY+L  A G  WVV VYGVPLLIVNG+LV ITYLQHTH ALPHY+SSE
Sbjct  235  ISDTGVLAASFALYRLVGAFGFWWVVRVYGVPLLIVNGWLVTITYLQHTHAALPHYDSSE  294

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN+VFH+ITDTHVAHHLFSTMPHYHAMEATKAI+P+LGEYY+F
Sbjct  295  WDWLRGALATVDRDYGLLNRVFHHITDTHVAHHLFSTMPHYHAMEATKAIRPILGEYYRF  354

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F A++RE KECIYVEPDEG   KGVFWY+N+ 
Sbjct  355  DGTPVFKALWREGKECIYVEPDEGGARKGVFWYRNEF  391



>ref|XP_009390650.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=386

 Score =   375 bits (962),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL I LTLGWPLYL FNVSGR YPRFA HFDPYGPIYSDRER QIF
Sbjct  170  WFSKYLNNPPGRILTLAITLTLGWPLYLAFNVSGRCYPRFASHFDPYGPIYSDRERAQIF  229

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AA YVLY++AA  G  W+V VYGVPLLIVNG+LVLITYLQHTHP+LPHY+SSE
Sbjct  230  ISDAGLMAALYVLYRVAACYGFWWLVRVYGVPLLIVNGWLVLITYLQHTHPSLPHYDSSE  289

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  290  WDWLRGALATVDRDYGMLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  349

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+  AM+RE +ECIYVEPD+G K KGVFWY+ +L
Sbjct  350  DDTPLLKAMWREAQECIYVEPDQGSKLKGVFWYRKEL  386



>ref|XP_006492662.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X2 [Citrus sinensis]
 ref|XP_006492663.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X3 [Citrus sinensis]
 gb|KDO56437.1| hypothetical protein CISIN_1g040843mg [Citrus sinensis]
Length=379

 Score =   374 bits (961),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -1

Query  745  HAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFI  566
            ++KY NNPPGRA TLL+ LTLGWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+I
Sbjct  164  YSKYFNNPPGRALTLLVTLTLGWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYI  223

Query  565  SDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  386
            SD GIFAATYVLY++A AKGLAW++CVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW
Sbjct  224  SDAGIFAATYVLYRVAMAKGLAWLICVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  283

Query  385  DWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFD  206
            DWLRGALSTVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT A+KP+LGEYYQFD
Sbjct  284  DWLRGALSTVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATIAMKPILGEYYQFD  343

Query  205  GTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            G P + A +RE KEC+YVEPDE    KG+FWY+NKL
Sbjct  344  GMPFYKAAWREAKECLYVEPDENSPTKGLFWYRNKL  379



>gb|ABI96919.1| delta-12 fatty acid desaturase [Triadica sebifera]
Length=381

 Score =   374 bits (960),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL+I LTLGWPLYL FNVSGR Y RFACH+DPYGPIY+DRER +I+
Sbjct  167  WYSKYLNNPPGRFLTLVITLTLGWPLYLAFNVSGRSYDRFACHYDPYGPIYTDRERTEIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LAAAKGLAWV+C+YGVPLL+VN FLV+ITYLQHTHP+LPHYNSSE
Sbjct  227  ISDAGVLAVTYGLYRLAAAKGLAWVICIYGVPLLVVNAFLVMITYLQHTHPSLPHYNSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDR+YGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRNYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKN  104
            D TP + AM+RE +ECIYV+ D+ D++KGVFWY  
Sbjct  347  DDTPFYKAMWREARECIYVDADD-DQSKGVFWYNK  380



>ref|XP_006492661.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like isoform X1 [Citrus sinensis]
Length=391

 Score =   374 bits (961),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -1

Query  745  HAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFI  566
            ++KY NNPPGRA TLL+ LTLGWPLYL  NVSGRPY RFACHFDP  PIYSDRER+QI+I
Sbjct  176  YSKYFNNPPGRALTLLVTLTLGWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYI  235

Query  565  SDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  386
            SD GIFAATYVLY++A AKGLAW++CVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW
Sbjct  236  SDAGIFAATYVLYRVAMAKGLAWLICVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEW  295

Query  385  DWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFD  206
            DWLRGALSTVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEAT A+KP+LGEYYQFD
Sbjct  296  DWLRGALSTVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATIAMKPILGEYYQFD  355

Query  205  GTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            G P + A +RE KEC+YVEPDE    KG+FWY+NKL
Sbjct  356  GMPFYKAAWREAKECLYVEPDENSPTKGLFWYRNKL  391



>gb|AEE69020.1| Fad2 [Vernicia fordii]
Length=383

 Score =   374 bits (960),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR FTL I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+
Sbjct  167  WFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T+ LY+LAAAKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP++PHY+SSE
Sbjct  227  ISDAGVLAVTFGLYRLAAAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPSIPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVE D+GD++KGV+WY  K 
Sbjct  347  DGTPFYKAMWREAKECIYVEADDGDESKGVYWYNKKF  383



>ref|XP_009420049.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=376

 Score =   374 bits (959),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL + LTLGWPLYL FNVSGRPYPRFACHFDPYGPIY+DRER QIF
Sbjct  160  WYSKYLNNPLGRLVTLAVTLTLGWPLYLAFNVSGRPYPRFACHFDPYGPIYTDRERAQIF  219

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A +Y LY+ AA+ G  W+  VYGVPLLIVNG+LVLITYLQHTHPALPHY+SSE
Sbjct  220  ISDAGLMATSYALYRFAASYGFWWLARVYGVPLLIVNGWLVLITYLQHTHPALPHYDSSE  279

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHA EAT+ IKP+LGEYYQF
Sbjct  280  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHATEATRVIKPLLGEYYQF  339

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE +ECIYVEPDEG K +GVFWY+ + 
Sbjct  340  DGTPLLKAMWREARECIYVEPDEGSKQEGVFWYRKEF  376



>gb|AAN87573.1| delta 12 oleic acid desaturase FAD2 [Vernicia fordii]
Length=383

 Score =   374 bits (959),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR FTL I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+
Sbjct  167  WFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T+ LY+LAAAKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP++PHY+SSE
Sbjct  227  ISDAGVLAVTFGLYRLAAAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPSIPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVE D+GD++KGV+WY  K 
Sbjct  347  DGTPFYKAMWREAKECIYVEADDGDESKGVYWYNKKF  383



>gb|ABL86147.1| delta-12 oleic acid desaturase [Vernicia montana]
Length=383

 Score =   374 bits (959),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR FTL I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +IF
Sbjct  167  WFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T+ LY+LAAAKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTFGLYRLAAAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEA+KAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEASKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVE D+GD++KGV+WY  + 
Sbjct  347  DGTPFYKAMWREAKECIYVEADDGDESKGVYWYNKEF  383



>gb|AGG38092.1| omega-6 fatty acid desaturase 2 endoplasmic reticulum isozyme 
2c [Musa AB Group]
Length=394

 Score =   374 bits (959),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++ YLNNPPGR  TL + LTLGWPLYL FNVSGR YPRFACH+DPYGPIYSDRER QIF
Sbjct  178  WYSTYLNNPPGRILTLAVTLTLGWPLYLAFNVSGRAYPRFACHYDPYGPIYSDRERAQIF  237

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AA Y LY++AA+ G  WVV VYGVPLLIVNG+LVLITYLQHTHP+LPHY+SS+
Sbjct  238  ISDAGLMAAVYALYRIAASYGFWWVVRVYGVPLLIVNGWLVLITYLQHTHPSLPHYDSSK  297

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            W+WLRGAL+TVDRDYGILN VFHNITDTHVAHHLFSTMPHYHAMEATK IKP+LGEYYQ+
Sbjct  298  WEWLRGALATVDRDYGILNNVFHNITDTHVAHHLFSTMPHYHAMEATKVIKPLLGEYYQY  357

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE +EC+YVEPDEG   KGVFWY+N +
Sbjct  358  DGTPLLKAMWREARECLYVEPDEGSTKKGVFWYRNDI  394



>ref|XP_010105456.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXC04784.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=381

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 197/215 (92%), Gaps = 1/215 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL I LTLGWPLYL+FNVSGRPY RFACHFDPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRFLTLTITLTLGWPLYLLFNVSGRPYDRFACHFDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISDTGI A  Y LY+L   KGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  227  ISDTGILAVCYGLYRLTMVKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKN  104
            DGTP++ AMFRE KEC++VEPDE D+ KGVFWYK 
Sbjct  347  DGTPVYKAMFRETKECVFVEPDESDE-KGVFWYKK  380



>gb|ACJ66779.1| omega-6 desaturase [Portulaca oleracea]
Length=383

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 197/216 (91%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TLL+ LTLGWPLYL+FNVSGR Y RFACH+DPYGPIYSDRER+QI+
Sbjct  166  WFSKYLNNPPGRVLTLLVTLTLGWPLYLLFNVSGRKYERFACHYDPYGPIYSDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A +Y LY+LA AKGLAWV+CVYG PLL+VN +LVLITYLQHTHP+LPHY SSE
Sbjct  226  LSDAGILAVSYGLYRLAVAKGLAWVLCVYGGPLLVVNAYLVLITYLQHTHPSLPHYESSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  286  WDWLRGALATMDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            DGTP + AM+RE KEC+YVEPDEG++NKG+ WY NK
Sbjct  346  DGTPFYKAMWREAKECLYVEPDEGEQNKGILWYNNK  381



>gb|AFX61781.1| omega-6 fatty acid desaturase endoplasmic reticulum isozyme 2b 
[Musa AB Group]
Length=381

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W  KYLNNPPGR  TL+I L+LGWPLYL FNVSGR YPRFACHFDPYGPI+SDRER QIF
Sbjct  165  WFTKYLNNPPGRVLTLVITLSLGWPLYLAFNVSGRAYPRFACHFDPYGPIFSDRERGQIF  224

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AA+YVLY++AA+ G  W+V VYGVPLLIVN +LV+ITYLQHTHP+LPHY+SSE
Sbjct  225  ISDAGIVAASYVLYRVAASYGFWWLVRVYGVPLLIVNAWLVIITYLQHTHPSLPHYDSSE  284

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ 
Sbjct  285  WDWLRGALATVDRDYGALNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPLLGEYYQS  344

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+  AM+REV+ECIYVEPDE  K KGV WY+N+ 
Sbjct  345  DATPLLKAMWREVRECIYVEPDEDSKQKGVLWYRNEF  381



>gb|ADZ39687.1| microsomal delta-12 oleate desaturase [Olea europaea subsp. europaea]
Length=381

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 193/217 (89%), Gaps = 2/217 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W  KYLNNPPGR  TL+I LTLGWPLYL FNVSGRPY RFACH+DP+GPIY+DRER+QI+
Sbjct  167  WFTKYLNNPPGRVMTLVITLTLGWPLYLAFNVSGRPYDRFACHYDPHGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD  + A +Y+LY++A A+GL W+ CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDVCVIATSYILYRVALAQGLVWLTCVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN VFHNITDTH AHHLFSTMPHYHAMEATKAIKP+LGEYYQ 
Sbjct  287  WDWLRGALATVDRDYGVLNNVFHNITDTHEAHHLFSTMPHYHAMEATKAIKPLLGEYYQS  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDE   NKGVFWYKNK 
Sbjct  347  DGTPFYKAMWREAKECLYVEPDE--PNKGVFWYKNKF  381



>gb|AEE69021.1| Fad2 [Vernicia fordii]
Length=383

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR FTL I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER +I+
Sbjct  167  WFSKYLNNPPGRLFTLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERTEIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T+ LY+LAAAKGLAWV+CVYGVPLLIVN FLV+ITYLQHTHP++PHY+SSE
Sbjct  227  ISDAGVLAVTFGLYRLAAAKGLAWVICVYGVPLLIVNAFLVMITYLQHTHPSIPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEA+KAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEASKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVE D+GD++KGV+WY  K 
Sbjct  347  DGTPFYKAMWREAKECIYVEADDGDESKGVYWYNKKF  383



>ref|XP_004493583.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cicer arietinum]
Length=384

 Score =   372 bits (956),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYL-NNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQI  572
            W++KYL NNP GR  T+ I LTLGWPLYL  NVSGRPY RFACHF+PYGPIYSDRER+QI
Sbjct  167  WYSKYLSNNPLGRVLTITITLTLGWPLYLALNVSGRPYDRFACHFNPYGPIYSDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            ++SD GI A  Y LY LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY+SS
Sbjct  227  YVSDAGILAVCYGLYLLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATK+IKPVLGEYY+
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKSIKPVLGEYYR  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
             D TP + A++RE +EC+YVEPD+G + KGVFWY NK
Sbjct  347  LDETPFYKALWREARECVYVEPDQGTEKKGVFWYNNK  383



>ref|XP_010265904.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Nelumbo nucifera]
Length=382

 Score =   372 bits (955),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 198/215 (92%), Gaps = 0/215 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W ++YLNNPPGR  TL I LTLGWPLYL+FNVSGR Y RFACH+DPYGPIYS+RER+QI+
Sbjct  166  WFSRYLNNPPGRVLTLTITLTLGWPLYLLFNVSGRHYDRFACHYDPYGPIYSNRERMQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY L++L AAKGLAWVVCVYGVPLLIVNGFLV+ITYLQHTHP+LPHY+S+E
Sbjct  226  ISDAGVLAVTYGLFRLVAAKGLAWVVCVYGVPLLIVNGFLVMITYLQHTHPSLPHYDSTE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAI+P+LG+YYQF
Sbjct  286  WDWLRGALATMDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIRPILGDYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKN  104
            DGTP + AM+RE KECIYVEPDE  K+KGV+WYKN
Sbjct  346  DGTPFYMAMWREAKECIYVEPDENSKDKGVYWYKN  380



>gb|AAW63040.1| microsomal delta-12 oleate desaturase [Olea europaea]
Length=381

 Score =   372 bits (954),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 192/217 (88%), Gaps = 2/217 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W  KYLNNPPGR  TL+I LTLGWPLYL  NVSGRPY RFACH+DP+GPIY+DRER+QI+
Sbjct  167  WFTKYLNNPPGRVMTLVITLTLGWPLYLALNVSGRPYDRFACHYDPHGPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD  + A +Y+LY++A A+GL W+ CVYGVPLLIVNGFLVLITYLQHTHP LPHY+SSE
Sbjct  227  ISDVCVIATSYILYRVALAQGLVWLTCVYGVPLLIVNGFLVLITYLQHTHPPLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ 
Sbjct  287  WDWLRGALATVDRDYGVLNNVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPLLGEYYQS  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDE   NKGVFWYKNK 
Sbjct  347  DGTPFYKAMWREAKECLYVEPDE--PNKGVFWYKNKF  381



>gb|ABP49577.1| oleate desaturase [Caragana korshinskii]
Length=383

 Score =   372 bits (954),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR   + I LTLGWPLYL  NVSGRPY RFACHFDPYGPIYSDRER+QI+
Sbjct  167  WYSKYLNNPLGRVVAITITLTLGWPLYLALNVSGRPYERFACHFDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  Y LY L  AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY+SSE
Sbjct  227  VSDAGILAVCYGLYHLVMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY+ 
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYRL  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            D TP + A++RE +EC+Y EPD+   +KGVFWY NK
Sbjct  347  DETPFYKALWREARECVYAEPDQSTGSKGVFWYNNK  382



>gb|AFX61782.1| omega-6 fatty acid desaturase endoplasmic reticulum isozyme 2a 
[Musa AB Group]
Length=386

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL I LTLGWPLY  FNVSGR YPRFA HFDPYGPIYSDRER QIF
Sbjct  170  WFSKYLNNPPGRILTLAITLTLGWPLYPAFNVSGRCYPRFASHFDPYGPIYSDRERAQIF  229

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AA YVLY++AA  G  W+V VYGVPLLIVNG+LVLITYLQHTHP+LPHY+S+E
Sbjct  230  ISDAGLMAALYVLYRVAACYGFWWLVRVYGVPLLIVNGWLVLITYLQHTHPSLPHYDSNE  289

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  290  WDWLRGALATVDRDYGMLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  349

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+  AM+RE KECIYVEPD+G K KGVFWY+ +L
Sbjct  350  DDTPLLKAMWREAKECIYVEPDQGSKLKGVFWYRKEL  386



>gb|AAL23676.1| delta-12 fatty acid desaturase [Persea americana]
Length=382

 Score =   371 bits (953),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL   LTLGWPLYL FNVSGR Y RFACHFDPYGPIYSDRER+QI 
Sbjct  166  WFSKYLNNPPGRFLTLAFSLTLGWPLYLAFNVSGRKYDRFACHFDPYGPIYSDRERLQIL  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A    L++L A  GL WVVCVYGVPLLIVNGFLVLIT+LQHTHP+LPHY+S E
Sbjct  226  ISDLGVLAVLCGLFRLVAVCGLGWVVCVYGVPLLIVNGFLVLITFLQHTHPSLPHYDSEE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAI+P+LG+YY  
Sbjct  286  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIRPILGDYYHS  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AM+RE KEC+YVEPDEG   KGVFWY+NK 
Sbjct  346  DGTPVYKAMYREAKECVYVEPDEGSGVKGVFWYRNKF  382



>gb|AIN36675.1| delta 12 desaturase [Cannabis sativa]
Length=387

 Score =   371 bits (953),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR  +L + LTLGWPLYL FNVSGRPY RFACH+DPYGPIYS+RER+QIFIS
Sbjct  172  AKYLNNPPGRVLSLFVTLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSNRERLQIFIS  231

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D GIF AT+ LY L +AKGL WVV VYGVPLLIVNGFLVLITYLQHTHPALPHY+SSEWD
Sbjct  232  DIGIFIATFALYHLVSAKGLGWVVLVYGVPLLIVNGFLVLITYLQHTHPALPHYDSSEWD  291

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGALSTVDRDYGILN+VFHNITDTHV HHLFSTMPHY+AMEATKA+KP+LGEYY+ D 
Sbjct  292  WLRGALSTVDRDYGILNRVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPILGEYYRLDD  351

Query  202  TPIFAAMFREVKECIYVEPDEGD-KNKGVFWYKNKL  98
            TPI  AM+RE KEC+YVE D+    NKGVFWYKNK 
Sbjct  352  TPIVKAMWREAKECLYVEQDDDSPSNKGVFWYKNKF  387



>gb|ABC41578.1| endoplasmic reticulum 18:1 desaturase [Populus tomentosa]
Length=388

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 195/221 (88%), Gaps = 4/221 (2%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  T+ I LTLGWPLYL  NVSGRPY RFACH+DPYGPIY+DRER++IF
Sbjct  167  WYSKYLNNPVGRFLTITITLTLGWPLYLAVNVSGRPYDRFACHYDPYGPIYNDRERVEIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA A+GL WV+CVYG PLL+VN FLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYRLAVAEGLGWVLCVYGGPLLVVNAFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLKGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGD----KNKGVFWYKNKL  98
            DGTPI  A +RE +ECIYV PD+ D    K+KGVFWY+NKL
Sbjct  347  DGTPICKATWREARECIYVHPDDEDDDKQKSKGVFWYRNKL  387



>ref|XP_011037928.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Populus euphratica]
Length=376

 Score =   370 bits (951),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGRA +L + L +GWPLYL FNVSGRPY RFACH+DPY PIYSDRER+Q++
Sbjct  160  WYSKYLNNPPGRALSLAVSLLVGWPLYLTFNVSGRPYDRFACHYDPYSPIYSDRERLQVY  219

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AAT+VLY +A ++GLA++VC+YGVPLLI NGFLV ITYLQHTHPALPHY+SSE
Sbjct  220  ISDLGILAATFVLYNIATSQGLAFLVCIYGVPLLIANGFLVTITYLQHTHPALPHYDSSE  279

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            W WLRGAL+T+DRDYGILNKVFHNITDTHVAHHLFS MPHYHAMEATKAIKP+LGE+YQF
Sbjct  280  WGWLRGALATMDRDYGILNKVFHNITDTHVAHHLFSNMPHYHAMEATKAIKPLLGEFYQF  339

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPI+ A++RE KEC+YVEPD+G   KG+FWY+N+ 
Sbjct  340  DDTPIYKALWREAKECLYVEPDDGAPQKGMFWYRNEF  376



>gb|EYU39931.1| hypothetical protein MIMGU_mgv1a008167mg [Erythranthe guttata]
Length=377

 Score =   370 bits (951),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR   L +Q TLGWPLYL+FNVSGRPY RFACHFDP  PIYSDRER QI IS
Sbjct  163  AKYLNNPPGRILMLTVQFTLGWPLYLLFNVSGRPYNRFACHFDPNSPIYSDRERAQILIS  222

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D G+ A  Y LY+L  AKGL+W  CVYG PLL+VNGFLVLITYLQHTHPALPHY+SSEWD
Sbjct  223  DAGVLAIVYGLYRLVLAKGLSWAFCVYGGPLLVVNGFLVLITYLQHTHPALPHYDSSEWD  282

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQFDG
Sbjct  283  WLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQFDG  342

Query  202  TPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            TP + A +RE KECIYVE D  +K+KGVFWY NK+
Sbjct  343  TPFYKAAWREAKECIYVEADGNEKDKGVFWYNNKI  377



>gb|ACR83861.1| omega-6 fatty acid desaturase [Portulaca oleracea]
Length=382

 Score =   370 bits (951),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  TL I LTLGWPLYL+FNVSGR Y R+ACH+DPYGPIYSDRER+QI+
Sbjct  166  WFSKYLNNPPGRVLTLTITLTLGWPLYLLFNVSGRHYDRYACHYDPYGPIYSDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+L AA+G+ WV+CVYG PLL+VNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  226  ISDAGILAVVYGLYRLTAARGIMWVLCVYGGPLLVVNGFLVLITFLQHTHPSLPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHV HHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  286  WDWLRGALATVDRDYGVLNKVFHNITDTHVGHHLFSTMPHYHAMEATKAIKPILGEYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVEPDEG++NKG+ WY NKL
Sbjct  346  DGTPFYKAMWREAKECLYVEPDEGEQNKGIHWYNNKL  382



>gb|AAF82295.1| microsomal oleate desaturase [Arachis ipaensis]
Length=379

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>gb|EYU39930.1| hypothetical protein MIMGU_mgv1a008167mg [Erythranthe guttata]
Length=383

 Score =   370 bits (951),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR   L +Q TLGWPLYL+FNVSGRPY RFACHFDP  PIYSDRER QI IS
Sbjct  169  AKYLNNPPGRILMLTVQFTLGWPLYLLFNVSGRPYNRFACHFDPNSPIYSDRERAQILIS  228

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D G+ A  Y LY+L  AKGL+W  CVYG PLL+VNGFLVLITYLQHTHPALPHY+SSEWD
Sbjct  229  DAGVLAIVYGLYRLVLAKGLSWAFCVYGGPLLVVNGFLVLITYLQHTHPALPHYDSSEWD  288

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQFDG
Sbjct  289  WLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQFDG  348

Query  202  TPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            TP + A +RE KECIYVE D  +K+KGVFWY NK+
Sbjct  349  TPFYKAAWREAKECIYVEADGNEKDKGVFWYNNKI  383



>gb|AIA21669.1| oleate desaturase [Crambe kralikii]
Length=383

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+GLA ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGLASMICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEEKGVFWYNNKL  383



>gb|AEW67305.1| delta-12 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>ref|XP_002323284.1| Omega-6 fatty acid desaturase family protein [Populus trichocarpa]
 gb|EEF05045.1| Omega-6 fatty acid desaturase family protein [Populus trichocarpa]
Length=385

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 193/218 (89%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  T+ I LTLGWPLYL  NVSGRPY RFACH+DPYGPI++DRER +I+
Sbjct  167  WFSKYLNNPPGRFLTITITLTLGWPLYLACNVSGRPYDRFACHYDPYGPIFNDRERAEIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKGLAWV+CVYG PLL+VN FLVLITYLQHTH ALPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYRLAVAKGLAWVLCVYGGPLLVVNAFLVLITYLQHTHVALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGD-KNKGVFWYKNKL  98
            DGTP + AM+RE KECIYV+ DEG  K+KGV+WY NK 
Sbjct  347  DGTPFYKAMWREGKECIYVQQDEGKPKSKGVYWYSNKF  384



>gb|AAF82293.1| microsomal oleate desaturase [Arachis hypogaea]
 gb|AAZ22543.1| oleate desaturase [Arachis hypogaea]
 gb|ABM47430.1| delta-12 fatty acid desaturase [Arachis hypogaea]
 gb|ABM47431.1| delta-12 fatty acid desaturase [Arachis hypogaea]
 gb|ADI46402.1| omega-6 fatty acid desaturase [Arachis hypogaea]
 gb|ADM83593.1| omega 6 fatty acid desaturase [Arachis hypogaea]
 gb|ADN86004.1| oleate desaturase [Arachis hypogaea var. hirsuta]
Length=379

 Score =   370 bits (950),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>gb|AHV83758.1| omega-6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>gb|AFN53713.1| omega-6 desaturase [Linum usitatissimum]
Length=769

 Score =   382 bits (981),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL + LTLGWPLYL FNVSGRPY RFACHFDP+GPIY+DRER++I+
Sbjct  156  WYSKYLNNPPGRVITLAVTLTLGWPLYLAFNVSGRPYDRFACHFDPHGPIYNDRERMEIY  215

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GIF   Y+LY+L   KGL WVV +YGVPLLIVNGFLVLIT+LQHTHP+LPHY SSE
Sbjct  216  LSDAGIFTVCYILYRLVLTKGLVWVVSIYGVPLLIVNGFLVLITFLQHTHPSLPHYKSSE  275

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW+RGALSTVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF
Sbjct  276  WDWMRGALSTVDRDYGLLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  335

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            DGTP   AM+RE KECIYVEPDEGD ++GVFWY  +
Sbjct  336  DGTPFVKAMWREAKECIYVEPDEGDPSQGVFWYNKQ  371



>gb|AIN52150.1| fatty acid desaturase-2 [Camellia oleifera]
Length=382

 Score =   370 bits (949),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL+I LTLGWP YL FNVSGRPY RFACH+DPYGPIY++RER+QI+
Sbjct  166  WYSKYLNNPVGRVVTLVITLTLGWPSYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI   +YVL +LA AKGLAW+VCVYGVPLLIVNGFLVLIT+LQHTHPALPHY+SSE
Sbjct  226  ISDVGIITNSYVLCRLAFAKGLAWLVCVYGVPLLIVNGFLVLITFLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALST+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYY F
Sbjct  286  WDWLRGALSTMDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYLF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKN  104
            DGT  + AM+RE +EC+YVE D+    KGVFWYKN
Sbjct  346  DGTAFYKAMWREARECLYVESDDDTTTKGVFWYKN  380



>gb|AAS57577.1| delta12-oleic acid desaturase [Euphorbia lagascae]
Length=382

 Score =   369 bits (948),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGRA +L   L +GWPLYL FNVSGRPY RFACH+DPYGPI+S+RER+QI+
Sbjct  166  WYSKYLNNPPGRALSLAGTLLIGWPLYLAFNVSGRPYDRFACHYDPYGPIFSERERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+F  TY+LY+ AA KG AW+VC YG+PLLIVN FLV ITYLQHTHP+LPHY+S E
Sbjct  226  ISDIGMFVTTYILYQAAAVKGFAWLVCTYGIPLLIVNSFLVTITYLQHTHPSLPHYDSVE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALSTVDRDYG+LNKVFHNITDTH+AHHLFSTMPHYHA+EATKAIKP+LGEYY +
Sbjct  286  WDWLRGALSTVDRDYGVLNKVFHNITDTHIAHHLFSTMPHYHALEATKAIKPILGEYYSY  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            DGTP++ A++RE KEC++VE DEG   +GVFWY+NK
Sbjct  346  DGTPVYKALWREAKECLFVEADEGANKQGVFWYRNK  381



>gb|AGS12443.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   369 bits (948),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A +VCVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMVCVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|AAC31698.1| delta-12 fatty acid desaturase [Borago officinalis]
Length=383

 Score =   369 bits (948),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W ++YLNNPPGR   LL+QLTLGWPLYLMFNVSGRPY RFACHFDP  PIY+DRER+QI+
Sbjct  167  WSSEYLNNPPGRVLVLLVQLTLGWPLYLMFNVSGRPYDRFACHFDPKSPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+L AAKG+AWVVC YGVPLL+VNGFLVLITYLQHT P+LPHY+SSE
Sbjct  227  ISDAGIVAVMYGLYRLVAAKGVAWVVCYYGVPLLVVNGFLVLITYLQHTQPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+TVDRDYG LNKV HNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ 
Sbjct  287  WDWLKGALATVDRDYGFLNKVLHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQC  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+F AM+REVKECIYVE DEGD  KGVFWYKNKL
Sbjct  347  DRTPVFKAMYREVKECIYVEADEGDNKKGVFWYKNKL  383



>ref|XP_010928433.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Elaeis guineensis]
Length=391

 Score =   369 bits (948),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+++Y+NNPPGR  TL + L LGWPLYL FNVSGRPYPRFACH+DPYGPIYSDRER QIF
Sbjct  175  WYSRYINNPPGRLLTLAVTLILGWPLYLAFNVSGRPYPRFACHYDPYGPIYSDRERAQIF  234

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AA Y L +LA A G  WVV VYGVPLLIVNG+LV ITYLQHTH ALPHY+S E
Sbjct  235  ISDAGVLAAFYALCRLAGAFGFWWVVRVYGVPLLIVNGWLVTITYLQHTHAALPHYDSGE  294

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYG+LN+VFH+ITDTHVAHHLFSTMPHYHAMEATKAI+P+LGEYYQF
Sbjct  295  WDWFRGALATVDRDYGVLNRVFHHITDTHVAHHLFSTMPHYHAMEATKAIRPILGEYYQF  354

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F A++RE +ECIYVEPDEG + KGVFWY++K 
Sbjct  355  DGTPVFKALWREARECIYVEPDEGGEKKGVFWYRHKF  391



>gb|AAX14399.1| oleate desaturase [Arachis monticola]
Length=379

 Score =   369 bits (947),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFAGHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>gb|AER27513.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   369 bits (947),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK+
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKI  379



>gb|ACZ06072.1| microsomal omega-6 fatty acid desaturase [Arachis hypogaea]
Length=383

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GR  TL I LTLGWPLYL FNVSGRPY RFACH+DPYGPIYSDRER+QI+
Sbjct  167  WWSKYLNNPLGRVLTLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A +Y L +L  AKGLAWVV VYGVPLL+VNGFLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDAGVLAVSYGLIRLVMAKGLAWVVAVYGVPLLVVNGFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYY+F
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYRF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KEC+YVE D+G +NKGVFWY NKL
Sbjct  347  DGTPFYKAMWREAKECLYVESDQGAQNKGVFWYNNKL  383



>ref|XP_008799208.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Phoenix dactylifera]
Length=394

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+++YLNNPPGR   L + LTLGWPLYL FN+SGRPYPRFACH+DPYGPIYS RER QIF
Sbjct  178  WYSRYLNNPPGRVLFLAVTLTLGWPLYLAFNISGRPYPRFACHYDPYGPIYSHRERAQIF  237

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            I+D G+ AA Y L +LA   GL WVV VYGVPLLIVNG+LV ITYLQHTH +LPHY+SSE
Sbjct  238  IADAGVLAAFYALCRLAGPFGLWWVVRVYGVPLLIVNGWLVTITYLQHTHASLPHYDSSE  297

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN+VFH+ITDTHVAHHLFSTMPHYHA+EATKAI+P+LGEYYQF
Sbjct  298  WDWLRGALATVDRDYGVLNRVFHHITDTHVAHHLFSTMPHYHALEATKAIRPILGEYYQF  357

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F A++RE KECIYVEPDE  + KGVFWY+NKL
Sbjct  358  DGTPVFKALWREAKECIYVEPDEAGEKKGVFWYRNKL  394



>ref|XP_010091397.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
 gb|EXB44402.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Morus notabilis]
Length=381

 Score =   369 bits (946),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL I LTLGWPLYL+FNVSGRPY RFACHFDPYGPIY DRER+QI+
Sbjct  167  WYSKYLNNPLGRFLTLTITLTLGWPLYLLFNVSGRPYDRFACHFDPYGPIYLDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISDTGI A  Y LY+L   KGLAWV+CVYGVPLL+VNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  227  ISDTGILAVCYGLYRLTMVKGLAWVLCVYGVPLLVVNGFLVLITFLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKN  104
            DGTP++ AMFRE KEC++VEPDE D+ KGVFWYK 
Sbjct  347  DGTPVYKAMFRETKECVFVEPDESDE-KGVFWYKK  380



>gb|AGZ15438.1| FAD2 [Eucalyptus camaldulensis]
Length=389

 Score =   369 bits (947),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 194/223 (87%), Gaps = 6/223 (3%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GR  TL + LTLGWPLYLMFNVSGRPY RFA H+DPYGPIY+DRER+QI+
Sbjct  167  WFSKYLNNPLGRVITLTVTLTLGWPLYLMFNVSGRPYDRFASHYDPYGPIYTDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY LAAAKGLAWV+CVYG PLL+VN FLVLITYLQHTH +LPHY+SSE
Sbjct  227  ISDAGVLAVTYGLYHLAAAKGLAWVLCVYGGPLLVVNAFLVLITYLQHTHASLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITD------THVAHHLFSTMPHYHAMEATKAIKPVL  227
            WDWLRGAL+TVDRDYG+LNKVFH+ +       THVAHHLFSTMPHYHAMEATKAIKPVL
Sbjct  287  WDWLRGALATVDRDYGVLNKVFHHNSRSTPFVLTHVAHHLFSTMPHYHAMEATKAIKPVL  346

Query  226  GEYYQFDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            G+YY FDGT ++ A +RE KECIYVEPDEGD+NKGVFWYKNKL
Sbjct  347  GDYYHFDGTSVYKAAWREAKECIYVEPDEGDQNKGVFWYKNKL  389



>gb|ADI46403.1| omega-6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   369 bits (946),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHL+STMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLYSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>gb|AIA21668.1| oleate desaturase [Crambe kralikii]
Length=383

 Score =   369 bits (946),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+GLA ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGLASMICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYV+PD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVKPDRQGEEKGVFWYNNKL  383



>gb|AER27514.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFIALTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|AIA21657.1| oleate desaturase [Crambe filiformis]
Length=383

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A +VC+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMVCLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|AAF82294.1| microsomal oleate desaturase [Arachis duranensis]
 gb|ADM83592.1| omega 6 fatty acid desaturase [Arachis hypogaea]
 gb|ADX20839.1| omega 6 fatty acid desaturase [Arachis hypogaea]
 gb|AER27517.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|AAB84262.1| omega-6 desaturase [Arachis hypogaea]
 gb|ADN86003.1| oleate desaturase [Arachis hypogaea var. hirsuta]
Length=379

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|AGS12444.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
 gb|AIA21645.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + +GVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKRGVFWYNNKL  383



>dbj|BAC22091.1| delta-12 desaturase [Spinacia oleracea]
Length=382

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYL+NPPGR  TL++ LTLGWPLYL+FNVSGR Y RFACH+DP  PIYSDRER+QIF
Sbjct  166  WFSKYLSNPPGRILTLVVTLTLGWPLYLLFNVSGRKYERFACHYDPSSPIYSDRERLQIF  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI    + LY LAAAKG++WV+CVYG PLL+VNGFLVLIT+LQHTHP+LPHY++SE
Sbjct  226  ISDVGISIVAFGLYHLAAAKGISWVLCVYGGPLLVVNGFLVLITFLQHTHPSLPHYDTSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYGILNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LG+YY+ 
Sbjct  286  WDWLRGALATADRDYGILNKVFHNITDTHVAHHLISTMPHYHAMEATKAIKPILGKYYRL  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+F AM+RE KEC+YVE DE D+NKGV WY+NKL
Sbjct  346  DSTPVFKAMWREAKECMYVEADEDDQNKGVLWYRNKL  382



>gb|ADM83594.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>ref|XP_003625259.1| Omega-6 fatty acid desaturase, endoplasmic reticulum [Medicago 
truncatula]
 gb|AES81477.1| microsomal omega-3 fatty acid desaturase [Medicago truncatula]
Length=434

 Score =   370 bits (950),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYL-NNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQI  572
            W++KYL NNP GR  T+ I LTLGWPLYL  NVSGRPY RFACHF+P+GPIYSDRER+QI
Sbjct  217  WYSKYLSNNPLGRVLTITITLTLGWPLYLALNVSGRPYDRFACHFNPHGPIYSDRERLQI  276

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            ++SD GI A  + LY LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY+SS
Sbjct  277  YVSDAGILAVCFGLYHLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYDSS  336

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY+
Sbjct  337  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYR  396

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
             D TP + A++RE +ECIYVEPD+G + KGVFWY NK
Sbjct  397  LDETPFYQALWREARECIYVEPDQGTERKGVFWYNNK  433



>gb|AAY53559.1| oleate desaturase [Arachis hypogaea]
Length=379

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYINNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|AIA21646.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + +GVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKRGVFWYNNKL  383



>gb|AIA21652.1| oleate desaturase [Crambe filiformis]
Length=383

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|AIA21660.1| oleate desaturase [Crambe glabrata]
Length=383

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|AIA21661.1| oleate desaturase [Crambe glabrata]
 gb|AIA21662.1| oleate desaturase [Crambe glabrata]
 gb|AIA21663.1| oleate desaturase [Crambe glabrata]
 gb|AIA21664.1| oleate desaturase [Crambe glabrata]
Length=383

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>ref|XP_006407366.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 ref|XP_006407367.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 ref|XP_006407368.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48819.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48820.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
 gb|ESQ48821.1| hypothetical protein EUTSA_v10020910mg [Eutrema salsugineum]
Length=383

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 193/218 (89%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L++Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLIVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGMASMLCVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD EGDK KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDREGDK-KGVFWYNNKL  383



>ref|XP_006368553.1| hypothetical protein POPTR_0001s05000g [Populus trichocarpa]
 gb|ERP65122.1| hypothetical protein POPTR_0001s05000g [Populus trichocarpa]
Length=360

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++K+LNNPPGRA +L + L +GWPLYL FNVSGRPY RFACH+DPY PIYSDRE++Q++
Sbjct  144  WYSKHLNNPPGRALSLAVSLLIGWPLYLTFNVSGRPYDRFACHYDPYSPIYSDREKLQVY  203

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AAT+VLY +A ++GLA+++C+YGVPLLI NGFLV ITYLQHTHPALPHY+SSE
Sbjct  204  ISDLGILAATFVLYSIATSQGLAFLICIYGVPLLIANGFLVTITYLQHTHPALPHYDSSE  263

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            W WLRGAL+T+DRDYGILNKVFHNITDTHVAHHLFS +PHYHAMEATKAIKP+LGE+YQF
Sbjct  264  WGWLRGALATMDRDYGILNKVFHNITDTHVAHHLFSNIPHYHAMEATKAIKPILGEFYQF  323

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPI+ A++RE KEC+YVEPD+G   KGVFWY+N+ 
Sbjct  324  DDTPIYKALWREAKECLYVEPDDGAPEKGVFWYRNEF  360



>gb|AER27515.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   367 bits (943),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDVGASKKGVYWYKNKF  379



>gb|AAK67829.1| delta-12 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHY AMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYRAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPVYKALWREAKECLYVEPDDGASQKGVYWYKNKF  379



>ref|XP_009417293.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=381

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W  KYLNN PGR  TL I L+LGWPLYL FNVSGR YPRFACHFDPYGPIYSDRER QIF
Sbjct  165  WFTKYLNNLPGRVLTLAITLSLGWPLYLAFNVSGRAYPRFACHFDPYGPIYSDRERGQIF  224

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AA++VLY++AA+ G  W+V VYGVPLLIVN +LV+ITYLQHTHP+LPHY+SSE
Sbjct  225  ISDAGIVAASFVLYRVAASYGFWWLVRVYGVPLLIVNAWLVIITYLQHTHPSLPHYDSSE  284

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATK IKP+LGEYYQ 
Sbjct  285  WDWLRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKVIKPLLGEYYQS  344

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP+  AM+REV+ECIYVEPDE  K KGV WY+N+ 
Sbjct  345  DDTPLLKAMWREVRECIYVEPDEDSKQKGVLWYRNEF  381



>gb|ACJ84618.1| unknown [Medicago truncatula]
 gb|AFK49601.1| unknown [Medicago truncatula]
Length=411

 Score =   368 bits (945),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 192/217 (88%), Gaps = 1/217 (0%)
 Frame = -1

Query  748  WHAKYL-NNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQI  572
            W++KYL NNP GR  T+ I LTLGWPLYL  NVSGRPY RFACHF+P+GPIYSDRER+QI
Sbjct  188  WYSKYLSNNPLGRVLTITITLTLGWPLYLALNVSGRPYDRFACHFNPHGPIYSDRERLQI  247

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            ++SD GI A  + LY LA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHPALPHY+SS
Sbjct  248  YVSDAGILAVCFGLYHLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPALPHYDSS  307

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGI NKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY+
Sbjct  308  EWDWLRGALATVDRDYGIQNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYR  367

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
             D TP + A++RE +ECIYVEPD+G + KGVFWY NK
Sbjct  368  LDETPFYQALWREARECIYVEPDQGTERKGVFWYNNK  404



>gb|AIA21649.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   367 bits (942),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A +VCVYGVPLLIVNGFLVLITYLQHTHP+LP Y+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMVCVYGVPLLIVNGFLVLITYLQHTHPSLPRYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|ADX20841.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   367 bits (941),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+N+PPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNDPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|AAL93620.1| fatty acid desaturase 2 [Olea europaea subsp. europaea]
Length=383

 Score =   367 bits (941),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +K LNNPPGR   L+ QLTLGWPLYLMFNVSGR Y RFACH++P  P+YSDRER QI 
Sbjct  167  WISKNLNNPPGRVLLLVFQLTLGWPLYLMFNVSGRHYDRFACHYNPNSPMYSDRERAQIL  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T  LY+L AAKGLAWV CVYG PLL+VNGFLVLITYLQHTHP+LPHY+SS 
Sbjct  227  ISDAGVLAVTCGLYRLTAAKGLAWVFCVYGGPLLVVNGFLVLITYLQHTHPSLPHYDSSG  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRD+GILNKVF NITDTHV+HHLFSTMPHYHAMEATKAIKP+L  YYQF
Sbjct  287  WDWLRGALATVDRDWGILNKVFRNITDTHVSHHLFSTMPHYHAMEATKAIKPILWNYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPIF AM+RE KECIYVE DEGD+NKGVFWY N L
Sbjct  347  DGTPIFKAMWREAKECIYVERDEGDQNKGVFWYNNTL  383



>gb|AGS12442.1| omega-6 fatty acid desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   367 bits (941),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGMLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|AER27516.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   366 bits (940),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  K L WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKSLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|AAY67653.1| oleate desaturase [Arachis hypogaea]
Length=379

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DDTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>ref|XP_010672659.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672660.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   365 bits (938),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KY+NNP GR  TL + LTLGWPLYL+FNVSGR Y RFACHFDP  PIYSDRER+QI+
Sbjct  166  WFSKYMNNPLGRLLTLSVTLTLGWPLYLLFNVSGRRYERFACHFDPSSPIYSDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI   TY LY+LAAAKGLAWV+CVYG PLL+VNGFLVLIT+LQHTHP+LPHY+S+E
Sbjct  226  ISDVGILTMTYGLYRLAAAKGLAWVLCVYGGPLLVVNGFLVLITFLQHTHPSLPHYDSTE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHVAHHL STMPHYHAMEATKAIKP+LG+YYQF
Sbjct  286  WDWLRGALATVDRDYGLLNKVFHNITDTHVAHHLISTMPHYHAMEATKAIKPILGKYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+F AMFREVKEC+YVE DE  +NKGV WY+NK 
Sbjct  346  DGTPVFKAMFREVKECMYVEADEDAQNKGVLWYRNKF  382



>gb|KHG24863.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
1 [Gossypium arboreum]
Length=385

 Score =   365 bits (938),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR  +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIY+DRER+Q++IS
Sbjct  168  AKYLNNPPGRVLSLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYTDRERLQVYIS  227

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            DTGIFA  YVLYK+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH ALPHY+SSEWD
Sbjct  228  DTGIFAVIYVLYKIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTHSALPHYDSSEWD  287

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGALST+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY FDG
Sbjct  288  WLRGALSTMDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYPFDG  347

Query  202  TPIFAAMFREVKECIYVEPD---EGDKNKGVFWYKNKL  98
            TPI+ AM+RE KEC+YVEPD    G  +KGVFWY+NK 
Sbjct  348  TPIYKAMWREAKECLYVEPDVGGGGGGSKGVFWYRNKF  385



>gb|ADM83591.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   365 bits (937),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I L LGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLALGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITD HVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDAHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>ref|XP_002309307.2| hypothetical protein POPTR_0006s20640g [Populus trichocarpa]
 gb|EEE92830.2| hypothetical protein POPTR_0006s20640g [Populus trichocarpa]
Length=462

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 194/221 (88%), Gaps = 4/221 (2%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER++IF
Sbjct  241  WYSKYLNNPLGRFLTITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNDRERVEIF  300

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A TY LY+LA AKGL WV+CVYG PLL+VN FLVLITYLQHTHP+LPHY+SSE
Sbjct  301  ISDAGILAVTYGLYRLAVAKGLGWVLCVYGGPLLVVNAFLVLITYLQHTHPSLPHYDSSE  360

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+TVDRDYGILNKVFHNITDTHVAHHLFS MPHYHAMEATKAIKP+LG+YYQ 
Sbjct  361  WDWLKGALATVDRDYGILNKVFHNITDTHVAHHLFSMMPHYHAMEATKAIKPILGDYYQH  420

Query  208  DGTPIFAAMFREVKECIYVEP----DEGDKNKGVFWYKNKL  98
            DGTP++ A +RE KECIYV P    D+  KNKGVFWY+NKL
Sbjct  421  DGTPVYKATWREAKECIYVHPDDDDDDKQKNKGVFWYRNKL  461



>gb|ADX20840.1| omega 6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   365 bits (936),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWP+YL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPVYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQ TH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQRTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKAFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGTPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>gb|ADP02395.1| delta-12 oleate desaturase [Gossypium hirsutum]
Length=385

 Score =   365 bits (936),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR  +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIYSDRER+Q++IS
Sbjct  168  AKYLNNPPGRVLSLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYSDRERLQVYIS  227

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            DTGIFA  YVLYK+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH ALPHY+SSEWD
Sbjct  228  DTGIFAVIYVLYKIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTHSALPHYDSSEWD  287

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGALST+DRD+G+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY FDG
Sbjct  288  WLRGALSTMDRDFGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYPFDG  347

Query  202  TPIFAAMFREVKECIYVEPD---EGDKNKGVFWYKNKL  98
            TPI+ AM+RE KEC+YVEPD    G  +KGVFWY+NK 
Sbjct  348  TPIYKAMWREAKECLYVEPDVGGGGGGSKGVFWYRNKF  385



>ref|XP_011033218.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2 [Populus euphratica]
Length=454

 Score =   367 bits (942),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 191/218 (88%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNPPGR  T+ I LTLGWPLYL  NVSGRPY RFACH+DPYGPI++DRER +I+
Sbjct  236  WFSKYLNNPPGRFLTIAITLTLGWPLYLACNVSGRPYDRFACHYDPYGPIFNDRERAEIY  295

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A TY LY+LA AKGLAWV+CVYG PLL+VN FLVLITYLQHTH ALPHY+SSE
Sbjct  296  ISDAGVLAVTYGLYRLAVAKGLAWVLCVYGGPLLVVNAFLVLITYLQHTHVALPHYDSSE  355

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK FHNITDTHVAHHLFSTMPHYHAMEATK IKP+LGEYYQF
Sbjct  356  WDWLRGALATVDRDYGILNKAFHNITDTHVAHHLFSTMPHYHAMEATKTIKPILGEYYQF  415

Query  208  DGTPIFAAMFREVKECIYVEPDEGD-KNKGVFWYKNKL  98
            DGTP + A++RE KECIYV+ DEG  K+KGV+WY NK 
Sbjct  416  DGTPFYKALWREGKECIYVQQDEGKPKSKGVYWYSNKF  453



>gb|AHV83757.1| omega-6 fatty acid desaturase [Arachis hypogaea]
Length=379

 Score =   364 bits (935),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KY+NNPPGRA +L I LTLGWPLYL FNVSGRPY RFA H+DPY PIYS+RER+ I+
Sbjct  163  WYNKYMNNPPGRAISLFITLTLGWPLYLAFNVSGRPYDRFASHYDPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD+ +FA TY+LY +A  KGL WVVCVYGVPLLIVNGFLV ITYLQHTH +LPHY+SSE
Sbjct  223  VSDSSVFAVTYLLYHIATLKGLGWVVCVYGVPLLIVNGFLVTITYLQHTHASLPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNK  H+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LG+YYQF
Sbjct  283  WDWLRGALATVDRDYGILNKASHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGDYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DG P + A++RE KEC+YVEPD+G   KGV+WYKNK 
Sbjct  343  DGAPFYKALWREAKECLYVEPDDGASKKGVYWYKNKF  379



>emb|CAA65744.1| omega-6 desaturase [Gossypium hirsutum]
Length=385

 Score =   364 bits (935),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR  +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIYSDRER+Q++IS
Sbjct  168  AKYLNNPPGRVLSLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYSDRERLQVYIS  227

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            DTGIFA  YVLYK+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH ALPHY+SSEWD
Sbjct  228  DTGIFAVIYVLYKIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTHSALPHYDSSEWD  287

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGALST+DRD+G+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY FDG
Sbjct  288  WLRGALSTMDRDFGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYPFDG  347

Query  202  TPIFAAMFREVKECIYVEPD---EGDKNKGVFWYKNKL  98
            TPI+ AM+RE KEC+YVEPD    G  +KGVFWY+NK 
Sbjct  348  TPIYKAMWREAKECLYVEPDVGGGGGGSKGVFWYRNKF  385



>gb|AIE48273.1| omega-6 fatty acid desaturase [Rhus chinensis]
 gb|AIE48274.1| omega-6 fatty acid desaturase [Rhus chinensis]
Length=383

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 194/218 (89%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL I LTLGWPLYL FNVSGR Y RFACHFDP  PIYSDRER+QIF
Sbjct  166  WYSKYLNNPPGRILTLTITLTLGWPLYLAFNVSGRHYDRFACHFDPKSPIYSDRERLQIF  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A TY LY +  AKGLAWV CVYG PLL+VNGFLVLIT+LQHTHP+LPHY+SSE
Sbjct  226  ISDVGILAITYGLYHIVLAKGLAWVFCVYGGPLLVVNGFLVLITFLQHTHPSLPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKVFH+ITDTHVAHHLFSTMPHYHA EATKAIKP+LGEYYQ+
Sbjct  286  WDWFRGALATVDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAEEATKAIKPILGEYYQY  345

Query  208  DGTPIFAAMFREVKECIYVEPDEG-DKNKGVFWYKNKL  98
            DGT IF AM+RE KECIYVEP+EG D+NKGV+WYKNK+
Sbjct  346  DGTSIFKAMYRETKECIYVEPEEGEDQNKGVYWYKNKI  383



>ref|XP_004497897.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Cicer arietinum]
Length=384

 Score =   363 bits (933),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYL+NP GR  TLLI LTLGWPLYL FNVSGRPY RFA H+DPYGPIYSDRER+QI+
Sbjct  168  WYYKYLDNPFGRFLTLLITLTLGWPLYLTFNVSGRPYDRFASHYDPYGPIYSDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ AA+Y LY+L  A+GL WVVCVYG+PLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  228  ISDAGVIAASYGLYRLVLAQGLNWVVCVYGIPLLIVNGFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHV HH+FSTMPHYHAMEATKA+KP+LGEYY+F
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVVHHMFSTMPHYHAMEATKAVKPILGEYYRF  347

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP++ A +RE KECIYVEPDEG + KGV+WYKNKL
Sbjct  348  DETPVYKAAWREAKECIYVEPDEGSEVKGVYWYKNKL  384



>gb|AIT96964.1| FAD2 desaturase [Corylus avellana]
Length=382

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KY NNPPGR  TLLI LTLGWPLYL  NVSGRPY RFACH+DPYGPIYS+RER QIF
Sbjct  166  WFSKYFNNPPGRVLTLLITLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSNRERCQIF  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+FA TYVLY  A +KGLAW+V +YG+PLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  226  VSDAGVFATTYVLYYAAMSKGLAWLVSIYGMPLLIVNGFLVLITYLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYG+LNKVFHNI DTHVAHHLFSTMPHYHAMEATKAIK +LG+YYQF
Sbjct  286  WDWLRGALATADRDYGMLNKVFHNIIDTHVAHHLFSTMPHYHAMEATKAIKSILGKYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVE DEG  NKGVFWY++KL
Sbjct  346  DGTPVYKAVWREAKECLYVESDEGAPNKGVFWYQSKL  382



>gb|AIA21647.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=384

 Score =   362 bits (930),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVSGRPYSNGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ AAA+G+A ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYALYRYAAAQGVASLICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|AIT96965.1| FAD2 desaturase [Corylus avellana]
Length=382

 Score =   362 bits (930),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KY NNPPGR  TLLI LTLGWPLYL  NVSGRPY RFACH+DPYGPIYS+RER QIF
Sbjct  166  WFSKYFNNPPGRVLTLLITLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYSNRERCQIF  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+FA TYVLY  A +KGLAW+V +YG+PLLIVNGFLVLITYLQHTHPALPHY+SSE
Sbjct  226  VSDAGVFATTYVLYYAAMSKGLAWLVFIYGMPLLIVNGFLVLITYLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T DRDYG+LNKVFHNI DTHVAHHLFSTMPHYHAMEATKAIK +LG+YYQF
Sbjct  286  WDWLRGALATADRDYGMLNKVFHNIIDTHVAHHLFSTMPHYHAMEATKAIKSILGKYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE KEC+YVE DEG  NKGVFWY++KL
Sbjct  346  DGTPVYKAVWREAKECLYVESDEGAPNKGVFWYQSKL  382



>gb|AFC41106.1| FAD2-1 [Brassica oleracea]
Length=384

 Score =   362 bits (928),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AAA+G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAAQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>ref|XP_008813208.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 2-like [Phoenix dactylifera]
Length=391

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR  TL + LTLGWPLYL FNVSGRPYPRFACH+DPY P+YSDRER QIF
Sbjct  175  WYTKYLNNPPGRVLTLALTLTLGWPLYLAFNVSGRPYPRFACHYDPYSPMYSDRERAQIF  234

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ AA++ LY+LA A G  WVV VYGVPLLIVNG+LV ITYLQHTH ALPHY++SE
Sbjct  235  VSDAGVLAASFALYRLAGAFGFWWVVRVYGVPLLIVNGWLVTITYLQHTHAALPHYDTSE  294

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN VFHNITDTHVAHHLFSTMPHYHAMEATKAI+P+LGEYYQF
Sbjct  295  WDWLRGALATVDRDYGVLNSVFHNITDTHVAHHLFSTMPHYHAMEATKAIRPILGEYYQF  354

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE +EC+YVEPDE  + KGVFWY+N+ 
Sbjct  355  DGTPVYKALWREARECMYVEPDEQGEKKGVFWYRNEF  391



>gb|AAV52834.1| delta-12 fatty acid desaturase [Tropaeolum majus]
Length=383

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++ YLNNP GR  T+ I LTLGWPLYL FNVSGRPY RFACH+DPYGPIY+DRER QI+
Sbjct  167  WYSPYLNNPLGRIITITITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYTDRERFQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A +Y +Y+L  AKGLAW  CVYG PLL+VN FLV+ITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGVLAMSYGIYRLVLAKGLAWAFCVYGGPLLVVNAFLVMITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  287  WDWFRGALATVDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT ++ A++RE KECIYVEPDE  +NKGVFWY+NKL
Sbjct  347  DGTSVYKAIWREAKECIYVEPDEEGENKGVFWYRNKL  383



>gb|AAL68983.1|AF251844_1 delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19365.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19366.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19367.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19368.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19369.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19370.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19371.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19372.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19373.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19374.1| delta-12 oleate desaturase [Helianthus annuus]
 gb|AAX19375.1| delta-12 oleate desaturase [Helianthus annuus]
Length=382

 Score =   361 bits (926),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKYLNNPPGR  TLL+ LT+GWPLYLMFNVSGR Y RFACHFDP  PIYS+RER QIFIS
Sbjct  169  AKYLNNPPGRILTLLVTLTMGWPLYLMFNVSGRYYDRFACHFDPNSPIYSNRERAQIFIS  228

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D GI    Y+L++LA+ KGL WV+ +YG PLL+VNGFLVLIT+LQHTHP+LPHY+S+EWD
Sbjct  229  DAGILTVFYILFRLASTKGLVWVLTMYGGPLLVVNGFLVLITFLQHTHPSLPHYDSTEWD  288

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGAL+TVDRDYGILNKVFHNITDTHV HHLFSTMPHYHAMEATKAIKP+LG+YYQFDG
Sbjct  289  WLRGALATVDRDYGILNKVFHNITDTHVTHHLFSTMPHYHAMEATKAIKPILGDYYQFDG  348

Query  202  TPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            T IF AM+RE KECIYV+ DE D   GV+WY+NK+
Sbjct  349  TSIFKAMYRETKECIYVDKDE-DVKDGVYWYRNKI  382



>ref|XP_010673536.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLN P GR  +L++ L LGWPLYL+FN SGRPY RFACH+DP GPI+S RER Q+ 
Sbjct  172  WYSKYLNTPLGRLGSLIVTLMLGWPLYLLFNASGRPYDRFACHYDPNGPIFSSRERAQVM  231

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+    ++LYK+A AKGLAW++C+YGVPLL+VNGFLV ITYLQHTHP+LPHY+SSE
Sbjct  232  VSDLGLIGVLFLLYKVAMAKGLAWLICIYGVPLLVVNGFLVTITYLQHTHPSLPHYDSSE  291

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+T+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQF
Sbjct  292  WDWLKGALATMDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQF  351

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DG P + A++RE KEC+YVEPDE    KGVFWYKN+ 
Sbjct  352  DGLPFYKALWREAKECLYVEPDEDSHEKGVFWYKNQF  388



>gb|AAB80696.1| omega-6 fatty acid desaturase [Petroselinum crispum]
Length=382

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKY NNPPGR  TLL+ LTLGWPLYL+FNVSGR Y RFACH+DP  PIYSDRER QI +S
Sbjct  168  AKYTNNPPGRVLTLLVTLTLGWPLYLLFNVSGRHYERFACHYDPKSPIYSDRERAQILVS  227

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D G+ A +Y LY+LA AKGL WV+CVYG PLL+VNGFLVLIT+LQHTHPALPHYNSSEWD
Sbjct  228  DAGVLAVSYGLYRLAVAKGLTWVLCVYGGPLLVVNGFLVLITFLQHTHPALPHYNSSEWD  287

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGAL+TVDRDYGILNKV HNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YY+FD 
Sbjct  288  WLRGALATVDRDYGILNKVLHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYRFDD  347

Query  202  TPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            TP+  AM+RE KEC+YVEPDEGD+ KG+FWY NKL
Sbjct  348  TPVVKAMWREAKECLYVEPDEGDQGKGIFWYNNKL  382



>gb|ACP39505.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y L++ AAA+G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLFRYAAAQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ACP39502.1| delta-12 oleate desaturase [Brassica napus]
 gb|ACR47974.1| fatty acid desaturase [Brassica napus]
 gb|AFJ19031.1| fatty acid desaturase BnaC.FAD2.a [Brassica napus]
 gb|AGV77099.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   360 bits (924),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y L++ AAA+G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLFRYAAAQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ACP39504.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   360 bits (924),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y L++ AAA+G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLFRYAAAQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|AAD19742.1| delta-12 desaturase [Brassica carinata]
Length=384

 Score =   360 bits (924),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPYP  FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYPEGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            ++SD GI A  Y LY+ AAA+G+A +VC+YGVPLLIVN FLVLITYLQHTHP+LPHY+SS
Sbjct  227  YVSDAGILAVCYGLYRYAAAQGVASMVCLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP   AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPWVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ACN53522.1| fatty acid desaturase 2 [Brassica juncea]
 gb|ACN53523.1| fatty acid desaturase 2 [Brassica juncea]
Length=384

 Score =   360 bits (923),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>emb|CAD30827.1| fatty acid desaturase 2 [Brassica rapa]
 emb|CAG26981.1| fatty acid desaturase 2 [Brassica rapa]
 gb|ACP39503.1| delta-12 oleate desaturase [Brassica napus]
 gb|AEA76336.1| microsomal oleic acid desaturase [Brassica rapa subsp. pekinensis]
 gb|AFJ19030.1| fatty acid desaturase BnaA.FAD2.a [Brassica napus]
Length=384

 Score =   360 bits (923),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ADN10829.1| fatty acid desaturase [Camelina hispida]
Length=384

 Score =   360 bits (923),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+GLA ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGLASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>gb|AIA21650.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=383

 Score =   359 bits (922),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY  FACH  P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGFACHLHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ +  Y LY+ AA +G+A ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGVLSVCYALYRYAAVQGVASLICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+ GEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPIHGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>gb|ADN10825.1| fatty acid desaturase [Camelina sativa]
Length=384

 Score =   359 bits (922),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>gb|AFQ60942.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   359 bits (922),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>gb|ADN10832.1| fatty acid desaturase [Camelina microcarpa]
Length=385

 Score =   359 bits (922),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  169  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  228

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  229  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  288

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  289  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  348

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  349  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  385



>gb|ADN10835.1| fatty acid desaturase [Camelina rumelica]
Length=384

 Score =   359 bits (921),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>gb|ADN10834.1| fatty acid desaturase [Camelina rumelica]
Length=384

 Score =   359 bits (921),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>ref|XP_007145683.1| hypothetical protein PHAVU_007G259500g [Phaseolus vulgaris]
 gb|ESW17677.1| hypothetical protein PHAVU_007G259500g [Phaseolus vulgaris]
Length=383

 Score =   359 bits (921),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TL I LTLGWPLYL FNVSGR Y RFACH+DPYGPIYSDRER+QI+
Sbjct  168  WYSKYLNNPVGRVLTLFITLTLGWPLYLAFNVSGRNYERFACHYDPYGPIYSDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A  Y LYKL  AKG  WVVCVYGVPL++VN  LVLIT+LQHTHPA+PHY+SSE
Sbjct  228  VSDVGVLAVCYGLYKLVLAKGFLWVVCVYGVPLMVVNALLVLITFLQHTHPAVPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW RGAL+TVDRDYGILNKV HNITDTH+AHHLFSTMPHYHAMEATKAIKP+LG+YY F
Sbjct  288  WDWFRGALATVDRDYGILNKVLHNITDTHIAHHLFSTMPHYHAMEATKAIKPILGDYYHF  347

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGT ++ AM+RE +EC+YV  DE  KN GV+WY NK+
Sbjct  348  DGTSVYKAMWREARECMYV--DEDSKNNGVYWYNNKV  382



>emb|CDY01103.1| BnaC05g40970D [Brassica napus]
Length=458

 Score =   362 bits (928),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  241  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  300

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y L++ AAA+G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  301  YISDAGILAVCYGLFRYAAAQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  360

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  361  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  420

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  421  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  458



>gb|AIA21648.1| oleate desaturase [Crambe hispanica subsp. abyssinica]
Length=384

 Score =   359 bits (921),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 167/218 (77%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACH  P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVSGRPYSNGFACHLHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ AA +G+A ++CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYALYRYAAVQGVASLICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ABS86964.2| delta-12 fatty acid desaturase [Descurainia sophia]
Length=383

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L++Q TLGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPVGRIVMLIVQFTLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++C YGVPLLIVNGFLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGMASMICFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGA++TVDRDYGILNKVFHNITDTHVAHHLFSTMPH++AMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGAMATVDRDYGILNKVFHNITDTHVAHHLFSTMPHHNAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD   + KGV+WY NKL
Sbjct  347  DGTPWYKAMYREAKECIYVEPDREGEKKGVYWYNNKL  383



>emb|CDY08454.1| BnaA05g26900D [Brassica napus]
Length=457

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  240  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  299

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  300  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  359

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  360  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  419

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  420  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  457



>gb|AIA21667.1| oleate desaturase [Crambe kralikii]
Length=384

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVSGRPYHNGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ AA++G+A  +CVYGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYGLYRYAASQGVASTICVYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLR AL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YYQ
Sbjct  287  EWDWLRRALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGDYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVFKAMWREAKECIYVEPDRHGEKKGVFWYNNKL  384



>gb|KJB83458.1| hypothetical protein B456_013G248800 [Gossypium raimondii]
 gb|KJB83459.1| hypothetical protein B456_013G248800 [Gossypium raimondii]
Length=383

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 189/216 (88%), Gaps = 1/216 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            AKY NNPPGR  +L++ LTLGWP+YL FNVSGR Y R A H++PYGPIYS+RER+Q++IS
Sbjct  168  AKYFNNPPGRVLSLVVTLTLGWPMYLAFNVSGRYYDRLASHYNPYGPIYSERERLQVYIS  227

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D GI A  YVLYK+AA KGLAW++C YGVPLLIVN FLVLITYLQHTH ALPHY+SSEWD
Sbjct  228  DAGIVAVIYVLYKIAATKGLAWLLCTYGVPLLIVNAFLVLITYLQHTHSALPHYDSSEWD  287

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            W RGALST+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LG+YY FDG
Sbjct  288  WFRGALSTIDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGKYYPFDG  347

Query  202  TPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            TPI+ AM+RE KEC+YVE D  G  +KGVFWY+NK 
Sbjct  348  TPIYKAMWREAKECLYVEADVGGGGSKGVFWYRNKF  383



>gb|AIA21654.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   F CHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVSGRPYNSGFPCHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMP YHAMEATKAIKP+LG+YYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPRYHAMEATKAIKPILGDYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ACA14460.1| oleate desaturase [Caragana korshinskii]
Length=380

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNP GR  TLLI LTLGWPLYL FNVSGRPY RFA HF P+ PIYSDRER+ I+
Sbjct  164  WYSKYLNNPIGRGVTLLITLTLGWPLYLAFNVSGRPYDRFASHFHPHAPIYSDRERLLIY  223

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
             SD  +FAATY+LY +A  KG+ WVVCVY  PLLIVNGFLV ITYLQHTH +LPHY+S E
Sbjct  224  ASDAAVFAATYLLYHIATIKGMVWVVCVYEAPLLIVNGFLVTITYLQHTHFSLPHYDSKE  283

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFH+ITDTHVAHHLFST+PHYHAMEATKA+KP+LGEYYQF
Sbjct  284  WDWLRGALATVDRDYGILNKVFHHITDTHVAHHLFSTVPHYHAMEATKAMKPILGEYYQF  343

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP + A++RE KEC+YVEPDEG   KGV+WY+NK 
Sbjct  344  DDTPFYKALWREAKECLYVEPDEGTSQKGVYWYRNKF  380



>gb|AAF78778.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y L++ AAA+G+A +VC YGVPLLIVNG LVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLFRYAAAQGVASMVCFYGVPLLIVNGLLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>ref|XP_006297892.1| hypothetical protein CARUB_v10013933mg [Capsella rubella]
 gb|ADN10827.1| fatty acid desaturase [Capsella rubella]
 gb|EOA30790.1| hypothetical protein CARUB_v10013933mg [Capsella rubella]
Length=383

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPFGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  347  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  383



>gb|AFP21683.1| FAD2 [Physaria fendleri]
 gb|AGT36609.1| oleate 12-desaturase [Physaria fendleri]
Length=382

 Score =   358 bits (918),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FA HF P  PIY+DRER+QI+
Sbjct  166  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYNGFASHFFPNAPIYNDRERLQIY  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+GLA ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  226  ISDAGILAVCYGLYRYAAAQGLASMICLYGVPLLIVNFFLVLITYLQHTHPALPHYDSSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  286  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD   + KGV+WY NKL
Sbjct  346  DGTPWYVAMYREAKECIYVEPDREGEKKGVYWYNNKL  382



>gb|AAS92240.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   358 bits (918),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATK IKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKVIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|KEH41705.1| microsomal omega-3 fatty acid desaturase [Medicago truncatula]
Length=384

 Score =   357 bits (917),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYL+NP GR  TL I LTLGWPLYL FNVSGRPY RFA H+DPYGPIYSDRER+QI+
Sbjct  168  WYFKYLDNPLGRFLTLTITLTLGWPLYLAFNVSGRPYDRFASHYDPYGPIYSDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A +Y LY+L  A+GL WV+CVYG+PLLIVNGFLVLITYLQHTHPALPHY+S+E
Sbjct  228  VSDVGVLAVSYGLYRLVLAQGLNWVICVYGIPLLIVNGFLVLITYLQHTHPALPHYDSTE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDW+RGAL+TVDRDYGILNKVFHNITDTHV HH+FSTMPHYHAMEATK +KP+LGEYY F
Sbjct  288  WDWMRGALATVDRDYGILNKVFHNITDTHVVHHMFSTMPHYHAMEATKGVKPILGEYYHF  347

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPI+ AM+RE KEC+YVE DEG + KGV+WYKNK 
Sbjct  348  DGTPIYKAMWREAKECLYVEADEGSEVKGVYWYKNKF  384



>ref|XP_009146642.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Brassica rapa]
 gb|AFC41105.1| FAD2-1 [Brassica rapa]
Length=384

 Score =   357 bits (917),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFST PHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTTPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|ADU18249.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   357 bits (917),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+  AA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYVAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>ref|XP_010464962.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Camelina sativa]
 gb|ADN10830.1| fatty acid desaturase [Camelina laxa]
Length=385

 Score =   357 bits (917),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNPPGR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  169  WYGKYLNNPPGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  228

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+  AA+G+A ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  229  LSDAGILAVCFGLYRYVAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  288

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  289  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  348

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  349  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  385



>gb|ABG76201.1| delta 12 desaturase [Brassica napus]
Length=384

 Score =   357 bits (916),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDR YGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRGYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|KHG30631.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
2 [Gossypium arboreum]
Length=383

 Score =   357 bits (916),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AK+ NNP GR   + IQLTLGWPLYL+FN++G PY R ACH+DPYGPI+SDR+R+QI+
Sbjct  167  WWAKHFNNPLGRFLEISIQLTLGWPLYLLFNITGPPYDRLACHYDPYGPIFSDRQRLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A TY LY+L  AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP+LPHY SSE
Sbjct  227  VSDAGVLAVTYALYRLVLAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHPSLPHYESSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALSTVDRDYGILNKVFH IT  HVAHHLF T+PH HAMEATK IKPVLGEYYQF
Sbjct  287  WDWLRGALSTVDRDYGILNKVFHGITRIHVAHHLFPTIPHCHAMEATKVIKPVLGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE+KEC+YVEPDEGD +KGV W++NKL
Sbjct  347  DGTPVYKAIWRELKECVYVEPDEGDNDKGVLWFRNKL  383



>ref|XP_010486902.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum-like 
[Camelina sativa]
 gb|ADN10826.1| fatty acid desaturase [Camelina sativa]
 gb|ADN10833.1| fatty acid desaturase [Camelina microcarpa]
 gb|ADU18247.1| microsomal oleate desaturase [Camelina sativa]
 gb|AFQ60940.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   357 bits (916),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPAGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+GLA ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGLASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>gb|ABR27357.1| fatty acid desaturase 2 [Brassica juncea]
Length=384

 Score =   357 bits (916),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPL L FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLCLAFNVSGRPYDGGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>ref|NP_001291954.1| omega-6 fatty acid desaturase, endoplasmic reticulum [Camelina 
sativa]
 ref|XP_010498539.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
[Camelina sativa]
 gb|ADN10824.1| fatty acid desaturase [Camelina sativa]
 gb|ADN10831.1| fatty acid desaturase [Camelina microcarpa]
 gb|ADU18248.1| microsomal oleate desaturase [Camelina sativa]
 gb|AFQ60941.1| microsomal oleate desaturase [Camelina sativa]
Length=384

 Score =   357 bits (915),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  168  WYGKYLNNPAGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  227

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+GLA ++C+YGVPLLIVN FLVLITYLQHTHPALPHY+SSE
Sbjct  228  LSDAGILAVCFGLYRYAAAQGLASMICLYGVPLLIVNAFLVLITYLQHTHPALPHYDSSE  287

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  288  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  347

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  348  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  384



>gb|AAN87574.1| delta 12 fatty acid conjugase FADX [Vernicia fordii]
Length=386

 Score =   357 bits (915),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGRA TL+  L +GWPLYL FNVSGR Y RFACH+DPY PIYSDRER+QI+
Sbjct  170  WYSKYLNNPPGRALTLVATLFIGWPLYLAFNVSGRYYDRFACHYDPYSPIYSDRERLQIY  229

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD  IF A YVLYK+A AKGLAW+VC+YGVPLLIVN  +V IT LQHTH ALPHY+SSE
Sbjct  230  ISDAMIFVAAYVLYKIAMAKGLAWLVCIYGVPLLIVNALVVTITSLQHTHVALPHYDSSE  289

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRG L+TVDRDYG+ NK+FHN TDTHV HHLFS+MPHYH +EAT+AIKP+LG+YY F
Sbjct  290  WDWLRGGLATVDRDYGVFNKIFHNATDTHVIHHLFSSMPHYHGVEATRAIKPILGDYYLF  349

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TPI  A++RE KEC++VEPDEGD N GVFWY NK 
Sbjct  350  DDTPIHVALWREAKECLFVEPDEGDNNNGVFWYSNKF  386



>gb|AEK06377.1| microsomal oleate desaturase FAD2-8 [Carthamus tinctorius]
Length=379

 Score =   356 bits (914),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  T+   L LGWPLYL FNVSGRPY RFACH+ P  PI++ RER+QI+
Sbjct  166  WYSKYLNNPPGRLITVFTTLVLGWPLYLAFNVSGRPYDRFACHYAPNSPIFTSRERLQIW  225

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A +Y+LY++A AK +AWVVC+YGVPLLIVNGFLV+ITYLQHTHP+LPHY+ SE
Sbjct  226  ISDAGIIAVSYLLYRMALAKSVAWVVCIYGVPLLIVNGFLVMITYLQHTHPSLPHYDDSE  285

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LNKVFHNITDTHV HHLFSTMPHYHAMEATKA++PVLGEYY+F
Sbjct  286  WDWLRGALATVDRDYGLLNKVFHNITDTHVVHHLFSTMPHYHAMEATKAVEPVLGEYYRF  345

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            D TP + AM+RE KEC+YVE DE  K  GVFWYKNK
Sbjct  346  DDTPFYVAMWREAKECLYVETDE--KKGGVFWYKNK  379



>ref|XP_006850001.1| hypothetical protein AMTR_s00022p00172860 [Amborella trichopoda]
 gb|ERN11582.1| hypothetical protein AMTR_s00022p00172860 [Amborella trichopoda]
Length=375

 Score =   356 bits (914),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W + YLNNPPGR  TL + LT+GWPLYL FNVSGR YPRFACHFDPYGPIYSDRE  QIF
Sbjct  161  WFSPYLNNPPGRVMTLFVSLTMGWPLYLAFNVSGRAYPRFACHFDPYGPIYSDRECTQIF  220

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI AA Y +Y+ + A G   VVCVYGVPLLIVNGFLVLIT+LQHTHPALPHY+ +E
Sbjct  221  ISDLGILAALYAIYRASFAYGFTHVVCVYGVPLLIVNGFLVLITFLQHTHPALPHYDGTE  280

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILN VFH+ITDTHVAHHLFSTMPHYHA EATKAIKP+LGEYY++
Sbjct  281  WDWLRGALATVDRDYGILNTVFHHITDTHVAHHLFSTMPHYHAEEATKAIKPILGEYYRY  340

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            D TP + AM+RE KEC+YVEPD+  K +GVFWYKN+ 
Sbjct  341  DATPFYKAMYREAKECVYVEPDK--KGEGVFWYKNEF  375



>gb|AGN95843.1| fatty acid delta12-desturase FAD2-3 [Hiptage benghalensis]
Length=385

 Score =   357 bits (915),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR  TL+  L  GWPLYL  N SGR Y RFACH+DPY PIYS+RER  I 
Sbjct  169  WYFKYLNNPLGRMLTLVTTLVGGWPLYLTLNASGRHYDRFACHYDPYSPIYSERERALIC  228

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GIF  ++VLY++   KGL+WV+C+YGVPLLIVN FLV+ITYLQHTHPALPHY+SSE
Sbjct  229  ISDIGIFITSFVLYQVFMLKGLSWVICIYGVPLLIVNAFLVMITYLQHTHPALPHYDSSE  288

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALST DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATK IKP+LGEYY+F
Sbjct  289  WDWLRGALSTADRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKVIKPILGEYYRF  348

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTPI+ A++RE KEC++VEPDEG ++ GVFWY+NK 
Sbjct  349  DGTPIYKALWREAKECMFVEPDEGTRDPGVFWYRNKF  385



>gb|ACN53524.1| fatty acid desaturase 2 [Brassica juncea]
Length=384

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYDGGFACHFHPNAPIYNDRERPQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD GI A  Y LY+ AA +G+A +VC YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGILAVCYGLYRYAAVQGVASMVCFYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDR+YGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRNYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|AHY24226.1| delta-12 fatty acid desaturase [Paeonia lactiflora]
Length=383

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL+I LTLGWPLYL FNVSGRPY RFACH+DPYGPIYS+RER+QIF
Sbjct  167  WYSKYLNNPPGRLLTLVITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYSNRERLQIF  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+ A T +LY++  AKG AW+V VY +PLLIVN FLV+ITYLQHTH  LPHY+SSE
Sbjct  227  ISDAGLLAMTSLLYRVLLAKGFAWLVNVYVIPLLIVNAFLVMITYLQHTHITLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+T+DRDYG+LNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVL EYY F
Sbjct  287  WDWLRGALATMDRDYGVLNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLAEYYNF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            DGTP + AM+RE +EC YVEPDEGD NKGVFWY+N+
Sbjct  347  DGTPFYKAMWREARECHYVEPDEGDANKGVFWYRNE  382



>sp|Q39287.1|FAD6E_BRAJU RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum; 
AltName: Full=Delta(12) desaturase [Brassica juncea]
 emb|CAA62578.1| oleate desaturase [Brassica juncea]
Length=384

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLY  FNVSGRPYP  FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYWAFNVSGRPYPEGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            ++SD GI A  Y LY+ AAA+G+A +VC+YGVPLLIVN FLVLITYLQHTHP+LPHY+SS
Sbjct  227  YVSDAGILAVCYGLYRYAAAQGVASMVCLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAME TKAIKP+LG+YYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEVTKAIKPILGDYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP   AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPWVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|AFC41107.1| FAD2-2 [Brassica oleracea]
Length=384

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYSDGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ A ++G+A +VCVYGVPL+IVN FLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYGLYRYAGSRGVASMVCVYGVPLMIVNCFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|KJB15033.1| hypothetical protein B456_002G156500 [Gossypium raimondii]
Length=383

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W AK+ NNP GR   + IQLTLGWPLYL+FN++G PY R ACH+DPYGPI+SDR+R+QI+
Sbjct  167  WWAKHFNNPLGRFLEISIQLTLGWPLYLLFNITGPPYDRLACHYDPYGPIFSDRQRLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD G+ A TY LY L  AKG+ WV+ VYGVPLL+VN FLV+ITYLQHTHP+LPHY SSE
Sbjct  227  VSDAGVLAVTYALYLLVLAKGVGWVISVYGVPLLVVNAFLVMITYLQHTHPSLPHYESSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGALSTVDRDYGILNKVFH+IT  HVAHHLF T+PHYHAMEATK IKP+LGEYYQF
Sbjct  287  WDWLRGALSTVDRDYGILNKVFHDITRIHVAHHLFPTIPHYHAMEATKVIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ A++RE+KEC+YVEPD GD +KGV W++NKL
Sbjct  347  DGTPVYKAIWRELKECVYVEPDAGDNDKGVLWFRNKL  383



>gb|AEQ28965.1| omega-6 desaturase [Linum grandiflorum]
Length=383

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  706  TLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFISDTGIFAATYVLY  527
            T L+ LTLGWPLYL FNVSGRPY RFACH+DP  PIY+DRER +IF SD GI A ++ LY
Sbjct  181  TWLVTLTLGWPLYLAFNVSGRPYDRFACHYDPKSPIYNDRERTEIFFSDAGILAVSFALY  240

Query  526  KLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWDWLRGALSTVDRD  347
            KLA AKGLAWVVCVYGVPLL+VNGFLVLIT+LQHTHP+LPHY SSEWDWLRGAL+T+D D
Sbjct  241  KLAIAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTHPSLPHYKSSEWDWLRGALATMDSD  300

Query  346  YGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDGTPIFAAMFREVK  167
            YG LN VFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDGTP   AM+RE K
Sbjct  301  YGFLNTVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDGTPFIKAMWREDK  360

Query  166  ECIYVEPDEGDKNKGVFWYKNKL  98
            EC+YVE DEGD+NKGVFWY NKL
Sbjct  361  ECVYVEHDEGDQNKGVFWYNNKL  383



>gb|ACR15954.1| fatty acid desaturase 2 [Lepidium campestre]
Length=383

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L IQ  LGWPLYL FNVSGRPY  FA HF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRVVMLTIQFVLGWPLYLAFNVSGRPYDGFASHFFPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD GI A  Y LY+ AAA+G+A + C+YGVPLLIVN FLVLITYLQHTHP+LPHY+SSE
Sbjct  227  ISDAGILAVCYGLYRYAAAQGMASMFCLYGVPLLIVNFFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD  D+ KGV+WY NKL
Sbjct  347  DGTPWYKAMYREAKECIYVEPDREDEKKGVYWYNNKL  383



>gb|ACP39506.1| delta-12 oleate desaturase [Brassica napus]
Length=384

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYSDGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ A ++G+A +VCVYGVPL+IVN FLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYGLYRYAGSRGVASMVCVYGVPLMIVNCFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|AIA21651.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   F CHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTLMLTVQFTLGWPLYLAFNVSGRPYNNGFPCHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ AA +G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYGLYRYAAVQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHV HHLFSTMPHY+AMEAT+AIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVTHHLFSTMPHYNAMEATEAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+F AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVFKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>gb|AFJ19032.1| fatty acid desaturase BnaC.FAD2.b [Brassica napus]
Length=384

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   FACHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYSDGFACHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ A ++G+A +VCVYGVPL+IVN FLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYGLYRYAGSRGVASMVCVYGVPLMIVNCFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  384



>ref|NP_187819.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
 ref|NP_001078140.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
 sp|P46313.1|FAD6E_ARATH RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum; 
AltName: Full=Delta(12) desaturase [Arabidopsis thaliana]
 gb|AAG51042.1|AC069473_4 omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2); 
20389-21540 [Arabidopsis thaliana]
 gb|AAA32782.1| delta-12 desaturase [Arabidopsis thaliana]
 dbj|BAB01960.1| omega-6 fatty acid desaturase, endoplasmic reticulum (delta-12 
desaturase) [Arabidopsis thaliana]
 gb|AAK62627.1| AT3g12120/T21B14_107 [Arabidopsis thaliana]
 gb|AAM98321.1| At3g12120/T21B14_107 [Arabidopsis thaliana]
 gb|AEE75152.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
 gb|AEE75153.1| omega-6 fatty acid desaturase [Arabidopsis thaliana]
Length=383

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  347  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  383



>ref|XP_002884883.1| hypothetical protein ARALYDRAFT_478568 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61142.1| hypothetical protein ARALYDRAFT_478568 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ADN10828.1| fatty acid desaturase [Arabidopsis lyrata]
Length=383

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 190/218 (87%), Gaps = 2/218 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q  LGWPLYL FNVSGRPY  FACHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRIMMLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  + LY+ AAA+G+A ++C+YGVPLLIVN FLVLITYLQHTHP+LPHY+SSE
Sbjct  227  LSDAGILAVCFGLYRYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPD-EGDKNKGVFWYKNKL  98
            DGTP + AM+RE KECIYVEPD EGDK KGV+WY NKL
Sbjct  347  DGTPWYVAMYREAKECIYVEPDREGDK-KGVYWYNNKL  383



>gb|AIA21656.1| oleate desaturase [Crambe filiformis]
Length=384

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPR-FACHFDPYGPIYSDRERIQI  572
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPY   F CHF P  PIY+DRER+QI
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYNNGFPCHFHPNAPIYNDRERLQI  226

Query  571  FISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSS  392
            +ISD G+ +  Y LY+ AA +G+A ++C+YGVPLLIVNGFLVLITYLQHTHP+LPHY+SS
Sbjct  227  YISDAGVLSVCYGLYRYAAVQGVASMICLYGVPLLIVNGFLVLITYLQHTHPSLPHYDSS  286

Query  391  EWDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQ  212
            EWDWLRGAL+TVDRDYGILNKVFHNITDTHVAHHLFSTMPHY+AMEATKAIKP+LGEYYQ
Sbjct  287  EWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGEYYQ  346

Query  211  FDGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            FDGTP+  AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  FDGTPVVKAMWREAKECIYVEPDRHGERKGVFWYNNKL  384



>gb|EPS73825.1| delta-12 oleate desaturase, partial [Genlisea aurea]
Length=385

 Score =   354 bits (908),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 188/214 (88%), Gaps = 1/214 (0%)
 Frame = -1

Query  742  AKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIFIS  563
            +KY+NNPPGR   L++QLT+GWPLYL FNVSGRPY RFACHFDPYGPIY+DRER+QIF+S
Sbjct  173  SKYMNNPPGRLLGLVVQLTIGWPLYLAFNVSGRPYDRFACHFDPYGPIYNDRERLQIFVS  232

Query  562  DTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWD  383
            D GI AA ++LY  A A+G AW++CVYGVPLL+VN FLV ITYLQHTHP LPHY++SEWD
Sbjct  233  DAGISAALFLLYHAARARGTAWLLCVYGVPLLVVNAFLVTITYLQHTHPELPHYDASEWD  292

Query  382  WLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQFDG  203
            WLRGAL+TVDRDYGILN+VFHNITDTHVAHHLFSTMPHYHA EAT+AI+PVLG+YY+ D 
Sbjct  293  WLRGALATVDRDYGILNRVFHNITDTHVAHHLFSTMPHYHAEEATRAIRPVLGDYYRLDR  352

Query  202  TPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
             P + A++RE KEC+YVE  E D ++G+FWYKNK
Sbjct  353  KPFYGALWREAKECLYVE-REDDDDRGIFWYKNK  385



>emb|CDP11063.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   353 bits (905),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYL+NPPGRA TL+I L LGWPLYL  N SGR Y RFACH+DPY PIY+ RER+ I+
Sbjct  135  WYYKYLSNPPGRAITLMITLALGWPLYLAINASGRQYDRFACHYDPYSPIYNARERLPIY  194

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            ISD G+F  TY+LY++A AKGLAW++C+YG+PLLI+NGF V ITYLQHTHP+LPHY+SSE
Sbjct  195  ISDVGVFVTTYLLYRVALAKGLAWLICIYGLPLLILNGFTVFITYLQHTHPSLPHYDSSE  254

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYG+LN VFHNIT+THV HHLFS MPHYHA+EAT+A+KP+LGEYY F
Sbjct  255  WDWLRGALATVDRDYGVLNNVFHNITNTHVPHHLFSAMPHYHAVEATEAMKPILGEYYHF  314

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP++ AM+RE +EC+YVEPD+G  +KGVFWY NK 
Sbjct  315  DGTPVYKAMWREARECLYVEPDDG--SKGVFWYNNKF  349



>gb|AAX29989.1| microsomal omega-6-desaturase [Glycine max]
Length=379

 Score =   353 bits (907),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GRA +LL+ LT+GWP+YL FNVSGRPY  FA H+ PY PIYS+RER+ I+
Sbjct  163  WFSKYLNNPLGRAVSLLVTLTIGWPMYLAFNVSGRPYDSFASHYHPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD  +F+ TY LY++A  KGL W++CVYGVPLLIVNGFLV ITYLQHTH ALPHY+SSE
Sbjct  223  VSDVALFSVTYSLYRVATLKGLVWLLCVYGVPLLIVNGFLVTITYLQHTHFALPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+T+DRDYGILNKVFH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  283  WDWLKGALATMDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            D TP + A++RE +EC+YVEPDEG   KGV+WY+NK
Sbjct  343  DDTPFYKALWREARECLYVEPDEGTSEKGVYWYRNK  378



>gb|ADJ58018.1| fatty acid desaturase 2 [Brassica nigra]
Length=383

 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W+ KYLNNP GR   L +Q TLGWPLYL FNVSGRPYP+  CHF P  PIY+DRER+QI+
Sbjct  167  WYGKYLNNPLGRTVMLTVQFTLGWPLYLAFNVSGRPYPKVRCHFHPNAPIYNDRERLQIY  226

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD GI A  Y LY+ AA +G+A +V +YGVPLLIVN FLVLITYLQHTHP+LPHY+SSE
Sbjct  227  VSDAGILAVCYGLYRYAAVQGVASMVSLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSE  286

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGAL+TVDRDYGILNKVFHNITDTHVAH LFSTMPHYHAMEATKAIKP+LG+YYQF
Sbjct  287  WDWLRGALATVDRDYGILNKVFHNITDTHVAHQLFSTMPHYHAMEATKAIKPILGDYYQF  346

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNKL  98
            DGTP   AM+RE KECIYVEPD   + KGVFWY NKL
Sbjct  347  DGTPWVKAMWREAKECIYVEPDRQGEKKGVFWYNNKL  383



>ref|NP_001238342.1| omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
1 [Glycine max]
 ref|XP_006588506.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1 isoform X1 [Glycine max]
 sp|P48630.1|FD6E1_SOYBN RecName: Full=Omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1 [Glycine max]
 gb|AAB00859.1| microsomal omega-6 desaturase [Glycine max]
 dbj|BAD89860.1| mocrosomal omega-6 fatty acid desaturase [Glycine max]
Length=387

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GRA +LL+ LT+GWP+YL FNVSGRPY  FA H+ PY PIYS+RER+ I+
Sbjct  171  WFSKYLNNPLGRAVSLLVTLTIGWPMYLAFNVSGRPYDSFASHYHPYAPIYSNRERLLIY  230

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD  +F+ TY LY++A  KGL W++CVYGVPLLIVNGFLV ITYLQHTH ALPHY+SSE
Sbjct  231  VSDVALFSVTYSLYRVATLKGLVWLLCVYGVPLLIVNGFLVTITYLQHTHFALPHYDSSE  290

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+T+DRDYGILNKVFH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  291  WDWLKGALATMDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQF  350

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            D TP + A++RE +EC+YVEPDEG   KGV+WY+NK
Sbjct  351  DDTPFYKALWREARECLYVEPDEGTSEKGVYWYRNK  386



>gb|KHN37429.1| Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 
1 [Glycine soja]
Length=379

 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W +KYLNNP GRA +LL+ LT+GWP+YL FNVSGRPY  FA H+ PY PIYS+RER+ I+
Sbjct  163  WFSKYLNNPLGRAVSLLVTLTIGWPMYLAFNVSGRPYDSFASHYHPYAPIYSNRERLLIY  222

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            +SD  +F+ TY LY++A  KGL W++CVYGVPLLIVNGFLV ITYLQHTH ALPHY+SSE
Sbjct  223  VSDVALFSVTYSLYRVATLKGLVWLLCVYGVPLLIVNGFLVTITYLQHTHFALPHYDSSE  282

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWL+GAL+T+DRDYGILNKVFH+ITDTHVAHHLFSTMPHYHAMEAT AIKP+LGEYYQF
Sbjct  283  WDWLKGALATMDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQF  342

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            D TP + A++RE +EC+YVEPDEG   KGV+WY+NK
Sbjct  343  DDTPFYKALWREARECLYVEPDEGTSEKGVYWYRNK  378



>ref|XP_002528127.1| oleate 12-hydroxylase [Ricinus communis]
 gb|EEF34257.1| oleate 12-hydroxylase [Ricinus communis]
 emb|CDG23427.1| oleate 12-hydroxylase [synthetic construct]
Length=387

 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  WHAKYLNNPPGRAFTLLIQLTLGWPLYLMFNVSGRPYPRFACHFDPYGPIYSDRERIQIF  569
            W++KYLNNPPGR  TL   L LGWPLYL FNVSGRPY RFACH+DPYGPI+S+RER+QI+
Sbjct  171  WYSKYLNNPPGRVLTLAATLLLGWPLYLAFNVSGRPYDRFACHYDPYGPIFSERERLQIY  230

Query  568  ISDTGIFAATYVLYKLAAAKGLAWVVCVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSE  389
            I+D GIFA T+VLY+   AKGLAWV+ +YGVPLLIVN FLV+ITYLQHTHPA+P Y SSE
Sbjct  231  IADLGIFATTFVLYQATMAKGLAWVMRIYGVPLLIVNCFLVMITYLQHTHPAIPRYGSSE  290

Query  388  WDWLRGALSTVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPVLGEYYQF  209
            WDWLRGA+ TVDRDYG+LNKVFHNI DTHVAHHLF+T+PHYHAMEATKAIKP++GEYY++
Sbjct  291  WDWLRGAMVTVDRDYGVLNKVFHNIADTHVAHHLFATVPHYHAMEATKAIKPIMGEYYRY  350

Query  208  DGTPIFAAMFREVKECIYVEPDEGDKNKGVFWYKNK  101
            DGTP + A++RE KEC++VEPDEG   +GVFWY+NK
Sbjct  351  DGTPFYKALWREAKECLFVEPDEGAPTQGVFWYRNK  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630