BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051J20

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004236119.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    437   7e-148   
ref|XP_006345041.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    436   2e-147   Solanum tuberosum [potatoes]
ref|XP_009617290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    434   6e-147   Nicotiana tomentosiformis
ref|XP_009617291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    434   7e-147   Nicotiana tomentosiformis
gb|KJB53134.1|  hypothetical protein B456_008G294300                    418   1e-143   Gossypium raimondii
ref|XP_002511424.1|  aldehyde dehydrogenase, putative                   423   2e-142   
gb|KJB53133.1|  hypothetical protein B456_008G294300                    418   1e-140   Gossypium raimondii
gb|KCW83435.1|  hypothetical protein EUGRSUZ_B00357                     412   1e-140   Eucalyptus grandis [rose gum]
gb|KJB53131.1|  hypothetical protein B456_008G294300                    418   1e-140   Gossypium raimondii
ref|XP_002321583.2|  aldehyde dehydrogenase 1 precursor family pr...    417   2e-140   
ref|XP_002318034.1|  aldehyde dehydrogenase 1 precursor family pr...    418   2e-140   Populus trichocarpa [western balsam poplar]
gb|KHG08400.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    417   3e-140   Gossypium arboreum [tree cotton]
emb|CDP18933.1|  unnamed protein product                                417   3e-140   Coffea canephora [robusta coffee]
ref|XP_011044320.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    417   4e-140   Populus euphratica
ref|XP_011044321.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    417   6e-140   Populus euphratica
gb|EYU42550.1|  hypothetical protein MIMGU_mgv1a004919mg                415   7e-140   Erythranthe guttata [common monkey flower]
gb|KDP31120.1|  hypothetical protein JCGZ_11496                         416   9e-140   Jatropha curcas
gb|KEH35050.1|  NAD-dependent aldehyde dehydrogenase family protein     416   1e-139   Medicago truncatula
ref|XP_010546022.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    416   1e-139   Tarenaya hassleriana [spider flower]
ref|XP_010037573.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    416   2e-139   Eucalyptus grandis [rose gum]
ref|XP_010101190.1|  Aldehyde dehydrogenase family 2 member             416   2e-139   Morus notabilis
ref|XP_008360830.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    405   2e-139   
ref|XP_008453101.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    415   4e-139   Cucumis melo [Oriental melon]
ref|XP_010028184.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    414   5e-139   Eucalyptus grandis [rose gum]
gb|KHN18468.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    413   1e-138   Glycine soja [wild soybean]
ref|XP_004138115.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    413   2e-138   Cucumis sativus [cucumbers]
ref|XP_004508854.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    409   2e-138   Cicer arietinum [garbanzo]
ref|XP_004298932.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    412   4e-138   Fragaria vesca subsp. vesca
ref|XP_008374451.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    411   6e-138   Malus domestica [apple tree]
ref|XP_008367527.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    411   1e-137   
ref|XP_007155411.1|  hypothetical protein PHAVU_003G199100g             411   1e-137   Phaseolus vulgaris [French bean]
ref|XP_007155410.1|  hypothetical protein PHAVU_003G199100g             410   1e-137   Phaseolus vulgaris [French bean]
gb|AFK44278.1|  unknown                                                 404   2e-137   Medicago truncatula
gb|AAO72532.1|  aldehyde dehydrogenase 1 precursor                      410   2e-137   Lotus corniculatus
ref|XP_008239742.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    410   2e-137   Prunus mume [ume]
ref|XP_007210569.1|  hypothetical protein PRUPE_ppa003869mg             410   3e-137   Prunus persica
ref|XP_004508853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    409   4e-137   Cicer arietinum [garbanzo]
ref|XP_011028588.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    409   5e-137   Populus euphratica
ref|XP_006439785.1|  hypothetical protein CICLE_v10019638mg             407   5e-137   
gb|EPS72259.1|  hypothetical protein M569_02499                         400   7e-137   Genlisea aurea
ref|XP_006439784.1|  hypothetical protein CICLE_v10019638mg             409   8e-137   Citrus clementina [clementine]
gb|AEV54528.1|  aldehyde dehydrogenase ALDH2B4_V3                       408   9e-137   Vitis vinifera
gb|AEV54527.1|  aldehyde dehydrogenase ALDH2B4_V2                       406   1e-136   Vitis vinifera
ref|XP_002283132.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    408   1e-136   Vitis vinifera
emb|CAN63005.1|  hypothetical protein VITISV_013710                     408   2e-136   Vitis vinifera
ref|XP_007044551.1|  Aldehyde dehydrogenase 2B4                         408   2e-136   
gb|KDP26565.1|  hypothetical protein JCGZ_17723                         407   2e-136   Jatropha curcas
ref|XP_003527026.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    407   3e-136   
gb|EYU31278.1|  hypothetical protein MIMGU_mgv1a004311mg                406   5e-136   Erythranthe guttata [common monkey flower]
ref|XP_003608978.1|  Mitochondrial aldehyde dehydrogenase               406   1e-135   
ref|XP_006476755.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    405   1e-135   Citrus sinensis [apfelsine]
ref|XP_009150211.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    405   1e-135   Brassica rapa
emb|CDY36910.1|  BnaA06g16950D                                          405   2e-135   Brassica napus [oilseed rape]
gb|AAZ79358.1|  aldehyde dehydrogenase                                  404   2e-135   Vitis pseudoreticulata
gb|AAZ79356.1|  aldehyde dehydrogenase                                  403   2e-135   Vitis pseudoreticulata
ref|XP_011086550.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   3e-135   Sesamum indicum [beniseed]
ref|XP_010682578.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   4e-135   Beta vulgaris subsp. vulgaris [field beet]
gb|AAZ79355.1|  aldehyde dehydrogenase                                  404   5e-135   Vitis pseudoreticulata
ref|XP_009149853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   5e-135   Brassica rapa
gb|AFK41217.1|  unknown                                                 404   5e-135   Lotus japonicus
ref|XP_010678738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    404   6e-135   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY44985.1|  BnaCnng12150D                                          404   7e-135   Brassica napus [oilseed rape]
gb|ACM89738.1|  mitochondrial benzaldehyde dehydrogenase                403   1e-134   Antirrhinum majus [garden snapdragon]
ref|XP_011071828.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    402   2e-134   Sesamum indicum [beniseed]
ref|XP_009761724.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    403   2e-134   Nicotiana sylvestris
ref|XP_010682575.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    402   2e-134   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK44454.1|  hypothetical protein AALP_AA1G258900                    402   3e-134   Arabis alpina [alpine rockcress]
ref|XP_010682577.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    402   3e-134   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX91724.1|  BnaC08g06430D                                          402   3e-134   
ref|XP_006404308.1|  hypothetical protein EUTSA_v10010271mg             402   4e-134   Eutrema salsugineum [saltwater cress]
emb|CDY57318.1|  BnaA08g20300D                                          401   5e-134   Brassica napus [oilseed rape]
emb|CDY21806.1|  BnaA06g20750D                                          400   6e-134   Brassica napus [oilseed rape]
gb|EPS72983.1|  mitochondrial benzaldehyde dehydrogenase                400   7e-134   Genlisea aurea
gb|KJB50198.1|  hypothetical protein B456_008G158500                    399   7e-134   Gossypium raimondii
ref|XP_009115500.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    401   9e-134   Brassica rapa
gb|KHG27537.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    400   1e-133   Gossypium arboreum [tree cotton]
ref|XP_010503421.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   1e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010552639.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   1e-133   Tarenaya hassleriana [spider flower]
ref|NP_564204.1|  aldehyde dehydrogenase 2B7                            400   2e-133   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50197.1|  hypothetical protein B456_008G158500                    399   2e-133   Gossypium raimondii
ref|XP_010316283.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    399   2e-133   Solanum lycopersicum
ref|XP_004155012.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   3e-133   
gb|AAC98035.1|  Strong similarity to gb|Y09876 aldehyde dehydroge...    399   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010914166.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    400   4e-133   Elaeis guineensis
ref|XP_003519638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    399   4e-133   
gb|KHN00347.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    399   4e-133   Glycine soja [wild soybean]
ref|XP_009600000.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    399   5e-133   
ref|XP_002893307.1|  hypothetical protein ARALYDRAFT_472641             399   5e-133   
gb|AES91175.2|  NAD-dependent aldehyde dehydrogenase family protein     399   7e-133   Medicago truncatula
ref|XP_010515110.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    399   7e-133   Camelina sativa [gold-of-pleasure]
ref|XP_003517756.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    398   7e-133   
ref|XP_006290873.1|  hypothetical protein CARUB_v10016983mg             398   9e-133   Capsella rubella
emb|CDY61548.1|  BnaA09g29890D                                          399   1e-132   Brassica napus [oilseed rape]
ref|XP_006416054.1|  hypothetical protein EUTSA_v10007303mg             398   1e-132   Eutrema salsugineum [saltwater cress]
gb|AFK40301.1|  unknown                                                 390   1e-132   Medicago truncatula
gb|KFK34098.1|  hypothetical protein AALP_AA5G101700                    398   1e-132   Arabis alpina [alpine rockcress]
ref|XP_010426271.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    397   1e-132   Camelina sativa [gold-of-pleasure]
ref|XP_004238676.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    397   2e-132   
ref|XP_009612265.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    397   2e-132   Nicotiana tomentosiformis
ref|XP_006307216.1|  hypothetical protein CARUB_v10008816mg             397   3e-132   Capsella rubella
ref|XP_010653335.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    396   5e-132   Vitis vinifera
ref|XP_009759823.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    396   5e-132   Nicotiana sylvestris
ref|XP_009110081.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    396   6e-132   Brassica rapa
emb|CAA71003.1|  aldehyde dehydrogenase (NAD+)                          396   7e-132   Nicotiana tabacum [American tobacco]
ref|XP_010251301.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    395   1e-131   Nelumbo nucifera [Indian lotus]
ref|XP_003532011.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    395   1e-131   
ref|XP_002877590.1|  ALDH2B4                                            395   1e-131   
ref|XP_010044646.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    395   1e-131   Eucalyptus grandis [rose gum]
ref|XP_008781996.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    395   2e-131   Phoenix dactylifera
emb|CDY47634.1|  BnaC05g18900D                                          395   2e-131   Brassica napus [oilseed rape]
ref|XP_010551563.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    395   2e-131   Tarenaya hassleriana [spider flower]
ref|NP_190383.1|  aldehyde dehydrogenase 2B4                            394   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    394   4e-131   Elaeis guineensis
emb|CDP00179.1|  unnamed protein product                                394   4e-131   Coffea canephora [robusta coffee]
ref|XP_003552014.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    394   5e-131   
ref|XP_006355977.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    393   6e-131   Solanum tuberosum [potatoes]
ref|XP_007157468.1|  hypothetical protein PHAVU_002G072100g             394   6e-131   Phaseolus vulgaris [French bean]
gb|KCW56066.1|  hypothetical protein EUGRSUZ_I01821                     389   8e-131   Eucalyptus grandis [rose gum]
gb|AAL99612.1|AF348416_1  mitochondrial aldehyde dehydrogenase          393   9e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KCW86739.1|  hypothetical protein EUGRSUZ_B03349                     393   1e-130   Eucalyptus grandis [rose gum]
gb|AAL77005.1|  aldehyde dehydrogenase                                  381   1e-130   Allium cepa
ref|XP_007153639.1|  hypothetical protein PHAVU_003G052500g             392   2e-130   Phaseolus vulgaris [French bean]
gb|AGV54428.1|  mitochondrial aldehyde dehydrogenase                    392   2e-130   Phaseolus vulgaris [French bean]
ref|XP_007031425.1|  Aldehyde dehydrogenase 2B7 isoform 3               388   2e-130   
ref|XP_007036177.1|  Aldehyde dehydrogenase family 2 member B4          393   2e-130   
gb|EYU22484.1|  hypothetical protein MIMGU_mgv1a004342mg                392   2e-130   Erythranthe guttata [common monkey flower]
ref|XP_010271955.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    392   2e-130   Nelumbo nucifera [Indian lotus]
ref|XP_011463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    392   2e-130   Fragaria vesca subsp. vesca
ref|XP_010477682.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    392   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_004297641.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    392   2e-130   Fragaria vesca subsp. vesca
ref|XP_004297642.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    391   4e-130   Fragaria vesca subsp. vesca
ref|XP_010100483.1|  Aldehyde dehydrogenase family 2 member             392   4e-130   Morus notabilis
dbj|BAB92019.1|  mitochondrial aldehyde dehydrogenase                   392   4e-130   Sorghum bicolor [broomcorn]
ref|XP_008221788.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    391   6e-130   Prunus mume [ume]
ref|XP_010477684.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    390   7e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010029206.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    390   1e-129   Eucalyptus grandis [rose gum]
gb|KEH19981.1|  NAD-dependent aldehyde dehydrogenase family protein     389   1e-129   Medicago truncatula
emb|CBI32134.3|  unnamed protein product                                391   2e-129   Vitis vinifera
gb|KEH19980.1|  NAD-dependent aldehyde dehydrogenase family protein     390   2e-129   Medicago truncatula
ref|XP_006844236.1|  hypothetical protein AMTR_s00006p00268060          389   2e-129   
dbj|BAB62757.1|  mitochondrial aldehyde dehydrogenase ALDH2             390   2e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007031423.1|  Aldehyde dehydrogenase 2B4 isoform 1               389   2e-129   
ref|XP_007221800.1|  hypothetical protein PRUPE_ppa004036mg             389   3e-129   Prunus persica
gb|AFK40600.1|  unknown                                                 384   3e-129   Medicago truncatula
ref|XP_006356663.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    389   4e-129   Solanum tuberosum [potatoes]
gb|KJB11464.1|  hypothetical protein B456_001G261100                    384   5e-129   Gossypium raimondii
gb|KJB11463.1|  hypothetical protein B456_001G261100                    384   7e-129   Gossypium raimondii
ref|NP_001105891.1|  mitochondrial aldehyde dehydrogenase 2             389   8e-129   Zea mays [maize]
ref|XP_010265814.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    388   8e-129   Nelumbo nucifera [Indian lotus]
gb|EMS51754.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    389   8e-129   Triticum urartu
ref|XP_011071082.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    387   1e-128   
gb|EMT04899.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    387   2e-128   
ref|XP_002301540.1|  mitochondrial aldehyde dehydrogenase family ...    387   2e-128   Populus trichocarpa [western balsam poplar]
dbj|BAB92017.1|  mitochondrial aldehyde dehydrogenase                   387   2e-128   Secale cereale
gb|ABK24267.1|  unknown                                                 387   2e-128   Picea sitchensis
gb|AHM26656.1|  aldehyde dehydrogenase 2-1                              387   3e-128   Zea mays subsp. mays [corn]
ref|XP_003542700.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    386   4e-128   
ref|XP_006594290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    386   5e-128   Glycine max [soybeans]
ref|XP_004245256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    386   5e-128   Solanum lycopersicum
ref|XP_010029207.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    385   7e-128   Eucalyptus grandis [rose gum]
gb|KCW56067.1|  hypothetical protein EUGRSUZ_I01824                     385   8e-128   Eucalyptus grandis [rose gum]
ref|XP_006656871.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    385   1e-127   Oryza brachyantha
gb|KDO82491.1|  hypothetical protein CISIN_1g009035mg                   377   1e-127   Citrus sinensis [apfelsine]
ref|XP_008389628.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    384   2e-127   
ref|XP_004965205.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    385   2e-127   Setaria italica
gb|AAK58370.1|AF269064_1  T-cytoplasm male sterility restorer fac...    385   2e-127   Zea mays [maize]
gb|KHG06517.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    384   2e-127   Gossypium arboreum [tree cotton]
gb|KJB11461.1|  hypothetical protein B456_001G261100                    384   3e-127   Gossypium raimondii
ref|XP_010498885.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    383   9e-127   Camelina sativa [gold-of-pleasure]
dbj|BAB92018.1|  mitochondrial aldehyde dehydrogenase                   383   9e-127   Sorghum bicolor [broomcorn]
ref|XP_003563967.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    383   1e-126   Brachypodium distachyon [annual false brome]
ref|XP_004509835.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    382   1e-126   
gb|KDO82489.1|  hypothetical protein CISIN_1g009035mg                   377   1e-126   Citrus sinensis [apfelsine]
ref|XP_004509834.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    382   1e-126   Cicer arietinum [garbanzo]
ref|XP_006647839.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    382   2e-126   
ref|XP_009363532.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   3e-126   Pyrus x bretschneideri [bai li]
ref|XP_011003158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   4e-126   Populus euphratica
gb|KDO82486.1|  hypothetical protein CISIN_1g009035mg                   377   5e-126   Citrus sinensis [apfelsine]
ref|NP_001057358.1|  Os06g0270900                                       381   5e-126   
gb|EAZ00462.1|  hypothetical protein OsI_22484                          381   5e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_004139235.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   5e-126   
gb|AAF73828.1|AF162665_1  aldehyde dehydrogenase                        381   6e-126   Oryza sativa [red rice]
ref|XP_004156463.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    381   6e-126   
ref|XP_010460154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    380   6e-126   Camelina sativa [gold-of-pleasure]
ref|NP_001105576.1|  aldehyde dehydrogenase2                            381   6e-126   Zea mays [maize]
gb|ACG32898.1|  aldehyde dehydrogenase                                  380   1e-125   Zea mays [maize]
gb|AAL99614.2|AF348418_1  mitochondrial aldehyde dehydrogenase RF2B     380   2e-125   Zea mays [maize]
gb|KHN47185.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    379   2e-125   Glycine soja [wild soybean]
gb|KGN60807.1|  hypothetical protein Csa_2G010420                       381   3e-125   Cucumis sativus [cucumbers]
gb|AHM26657.1|  aldehyde dehydrogenase 2-2                              379   5e-125   Zea mays subsp. mays [corn]
ref|XP_002274863.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    378   7e-125   Vitis vinifera
gb|KDO82484.1|  hypothetical protein CISIN_1g009035mg                   377   7e-125   Citrus sinensis [apfelsine]
ref|XP_008456004.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    377   1e-124   Cucumis melo [Oriental melon]
gb|KDO82485.1|  hypothetical protein CISIN_1g009035mg                   377   3e-124   Citrus sinensis [apfelsine]
ref|XP_006438422.1|  hypothetical protein CICLE_v10031155mg             377   3e-124   Citrus clementina [clementine]
ref|XP_009391258.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    376   4e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391259.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    376   4e-124   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD15920.1|  putative mitochondrial aldehyde dehydrogenase AL...    372   5e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391257.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    375   7e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953799.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    375   9e-124   Setaria italica
ref|XP_009391256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    375   1e-123   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI16844.3|  unnamed protein product                                369   2e-123   Vitis vinifera
ref|XP_002970420.1|  hypothetical protein SELMODRAFT_231526             372   3e-123   
ref|XP_004953798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    374   5e-123   
dbj|BAJ85552.1|  predicted protein                                      369   6e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008793866.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    373   6e-123   Phoenix dactylifera
ref|XP_009399660.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    373   7e-123   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC73936.1|  hypothetical protein OsI_08800                          373   9e-123   Oryza sativa Indica Group [Indian rice]
ref|NP_001048010.1|  Os02g0730000                                       373   1e-122   
ref|XP_002978501.1|  hypothetical protein SELMODRAFT_233128             371   1e-122   
ref|XP_010928601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    372   3e-122   Elaeis guineensis
ref|XP_010928603.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    370   9e-122   Elaeis guineensis
ref|XP_009363534.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    369   2e-121   Pyrus x bretschneideri [bai li]
ref|XP_008793883.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    367   9e-121   
ref|XP_001785650.1|  predicted protein                                  366   2e-120   
gb|KHN23562.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    363   2e-119   Glycine soja [wild soybean]
gb|ABU96176.1|  aldehyde dehydrogenase                                  350   3e-116   Populus tremula x Populus alba [gray poplar]
gb|AEV40467.1|  mitochondrial aldehyde dehydrogenase                    340   7e-115   Miscanthus sinensis
gb|EMT22926.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    355   4e-114   
ref|XP_002961352.1|  hypothetical protein SELMODRAFT_266598             348   9e-114   
ref|XP_002983210.1|  hypothetical protein SELMODRAFT_234195             346   3e-113   
emb|CAN80790.1|  hypothetical protein VITISV_020547                     341   4e-111   Vitis vinifera
ref|XP_007151102.1|  hypothetical protein PHAVU_004G018000g             340   2e-110   Phaseolus vulgaris [French bean]
gb|KJB31274.1|  hypothetical protein B456_005G183300                    334   3e-108   Gossypium raimondii
ref|XP_001690955.1|  aldehyde dehydrogenase                             321   1e-102   Chlamydomonas reinhardtii
emb|CAD10505.1|  aldehyde dehydrogenase                                 319   3e-102   Polytomella sp. Pringsheim 198.80
ref|XP_011483309.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   2e-99    
ref|XP_003977205.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   3e-99    
ref|WP_011612157.1|  betaine-aldehyde dehydrogenase                     311   3e-99    Trichodesmium erythraeum
ref|XP_010783440.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   7e-99    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004635979.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   1e-98    
ref|XP_005080706.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   2e-98    
ref|XP_005472420.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-98    
ref|XP_004571367.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    310   2e-98    
ref|XP_009296559.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   3e-98    
ref|XP_003965899.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    309   4e-98    Takifugu rubripes [tiger puffer]
ref|XP_003446212.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   4e-98    Oreochromis niloticus
ref|XP_004595352.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   6e-98    
ref|XP_005642984.1|  aldehyde dehydrogenase                             310   7e-98    Coccomyxa subellipsoidea C-169
gb|ABR16485.1|  unknown                                                 307   7e-98    Picea sitchensis
gb|AAK57732.1|  aldehyde dehydrogenase                                  306   7e-98    Rattus norvegicus [brown rat]
ref|XP_007058380.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   7e-98    
ref|XP_006178148.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   8e-98    
ref|XP_003462991.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   8e-98    
ref|XP_005752934.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   8e-98    
ref|XP_006178149.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   9e-98    
ref|XP_007529029.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   1e-97    
ref|XP_005080705.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   1e-97    
ref|XP_004635978.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   1e-97    
ref|XP_004691129.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   1e-97    
ref|XP_006204899.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   1e-97    
ref|WP_009547631.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       306   1e-97    Cyanothece
ref|XP_008687110.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    304   2e-97    Ursus maritimus [white bear]
ref|WP_008181335.1|  betaine-aldehyde dehydrogenase                     306   2e-97    Moorea producens
ref|XP_005612652.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-97    
ref|XP_004571368.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    308   2e-97    Maylandia zebra
ref|XP_006865491.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   2e-97    Chrysochloris asiatica
ref|XP_005902646.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-97    
ref|XP_007058379.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-97    
ref|XP_003462990.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    307   2e-97    Cavia porcellus [guinea pig]
ref|XP_004595351.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-97    Ochotona princeps [southern American pika]
ref|XP_007625900.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-97    Cricetulus griseus [Chinese hamsters]
gb|AGN03869.1|  retinol dehydrogenase 1                                 304   2e-97    Aurelia aurita
sp|P81178.1|ALDH2_MESAU  RecName: Full=Aldehyde dehydrogenase, mi...    306   3e-97    Mesocricetus auratus [Syrian golden hamster]
gb|AAM94394.2|  mitochondrial aldehyde dehydrogenase                    305   3e-97    Rattus norvegicus [brown rat]
ref|XP_005080704.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   3e-97    Mesocricetus auratus [Syrian golden hamster]
ref|XP_007079670.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   3e-97    Panthera tigris altaica
ref|XP_003796032.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   3e-97    
ref|XP_006178147.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   3e-97    Camelus ferus
ref|XP_004430030.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   3e-97    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004691128.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    Condylura cristata
gb|AAS75813.1|  mitochondrial aldehyde dehydrogenase precursor          306   4e-97    Rattus norvegicus [brown rat]
ref|XP_006249447.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   4e-97    Rattus norvegicus [brown rat]
ref|XP_004635977.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   4e-97    Octodon degus
ref|NP_115792.1|  aldehyde dehydrogenase, mitochondrial precursor       306   4e-97    Rattus norvegicus [brown rat]
ref|XP_007170973.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-97    Balaenoptera acutorostrata scammoni
gb|ABK24518.1|  unknown                                                 297   4e-97    Picea sitchensis
ref|XP_006640511.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    306   4e-97    
gb|AAS75815.1|  mitochondrial aldehyde dehydrogenase precursor          306   5e-97    Rattus norvegicus [brown rat]
gb|AAS75814.1|  mitochondrial aldehyde dehydrogenase precursor          306   5e-97    
ref|XP_005403231.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   5e-97    
ref|XP_008140951.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   6e-97    
ref|XP_003433425.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   6e-97    
ref|XP_003932291.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   6e-97    
ref|XP_005902645.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   6e-97    
ref|XP_008556898.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   6e-97    
ref|XP_006865490.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   6e-97    
ref|XP_005691616.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   7e-97    
ref|XP_006894735.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   7e-97    
gb|AAI07975.1|  Aldh2b protein                                          304   7e-97    
ref|XP_004671034.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   8e-97    
ref|XP_004753301.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   8e-97    
ref|XP_007529021.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   8e-97    
ref|XP_009048780.1|  hypothetical protein LOTGIDRAFT_177987             304   1e-96    
ref|XP_005657378.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   1e-96    
ref|XP_003796031.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   1e-96    
ref|XP_005329686.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   1e-96    
dbj|BAE31741.1|  unnamed protein product                                305   1e-96    
ref|XP_004053952.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   1e-96    
gb|AGN03871.1|  retinol dehydrogenase 2                                 304   1e-96    
dbj|BAE29958.1|  unnamed protein product                                305   1e-96    
ref|XP_006204898.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   1e-96    
ref|NP_033786.1|  aldehyde dehydrogenase, mitochondrial precursor       305   1e-96    
ref|WP_008272605.1|  betaine-aldehyde dehydrogenase                     304   1e-96    
ref|NP_998466.2|  aldehyde dehydrogenase 2 family (mitochondrial)...    305   2e-96    
ref|XP_005403230.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   2e-96    
ref|XP_004671033.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-96    
ref|NP_001191818.1|  aldehyde dehydrogenase, mitochondrial isofor...    303   2e-96    
dbj|BAE35596.1|  unnamed protein product                                305   2e-96    
ref|XP_011450475.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    305   2e-96    
ref|XP_008140950.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-96    
ref|XP_010994150.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-96    
gb|AJF41243.1|  mitochondrial aldehyde dehydrogenase 2                  303   2e-96    
ref|XP_004876327.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   2e-96    
ref|XP_004395896.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   2e-96    
ref|XP_007628867.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-96    
ref|XP_010967936.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   2e-96    
dbj|BAE27044.1|  unnamed protein product                                304   2e-96    
ref|XP_008570927.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-96    
ref|XP_006894734.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
ref|XP_853628.1|  PREDICTED: aldehyde dehydrogenase, mitochondria...    304   3e-96    
ref|XP_007529015.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
gb|AAB59500.1|  aldehyde dehydrogenase 2 (EC 1.2.1.3)                   300   3e-96    
ref|XP_010602778.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
gb|ACI33614.1|  Aldehyde dehydrogenase, mitochondrial precursor         304   3e-96    
ref|XP_006148056.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   3e-96    
pdb|1O05|A  Chain A, Apo Form Of Human Mitochondrial Aldehyde Deh...    303   3e-96    
ref|XP_006769063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   3e-96    
ref|XP_004379128.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   3e-96    
ref|XP_004753300.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
ref|NP_001038076.1|  aldehyde dehydrogenase, mitochondrial precursor    304   3e-96    
pdb|3N81|A  Chain A, T244a Mutant Of Human Mitochondrial Aldehyde...    303   3e-96    
ref|XP_005344528.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   3e-96    
ref|XP_003994722.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   3e-96    
ref|XP_006204897.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    304   3e-96    
ref|XP_005329685.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   4e-96    
ref|XP_006114495.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   4e-96    
gb|EAW97974.1|  aldehyde dehydrogenase 2 family (mitochondrial), ...    300   4e-96    
pdb|1CW3|A  Chain A, Human Mitochondrial Aldehyde Dehydrogenase C...    303   4e-96    
gb|KDR10336.1|  Retinal dehydrogenase 2                                 302   4e-96    
ref|XP_007936366.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   4e-96    
ref|XP_006816163.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   4e-96    
ref|WP_020722661.1|  betaine-aldehyde dehydrogenase                     303   4e-96    
ref|XP_004017459.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   4e-96    
ref|XP_006099100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   5e-96    
gb|ELR51433.1|  Aldehyde dehydrogenase, mitochondrial                   302   5e-96    
gb|KFQ50915.1|  hypothetical protein N334_09435                         302   5e-96    
ref|XP_004483075.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   5e-96    
ref|XP_002913100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   6e-96    
ref|XP_004053953.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   6e-96    
gb|AAP36614.1|  Homo sapiens aldehyde dehydrogenase 2 family (mit...    303   6e-96    
ref|XP_007160345.1|  hypothetical protein PHAVU_002G314000g             303   6e-96    
ref|XP_002961274.1|  hypothetical protein SELMODRAFT_164447             302   6e-96    
ref|NP_000681.2|  aldehyde dehydrogenase, mitochondrial isoform 1...    303   6e-96    
gb|AAA51693.1|  aldehyde dehydrogenase                                  303   6e-96    
ref|XP_004876326.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   6e-96    
gb|AAT41621.1|  mitochondrial aldehyde dehydrogenase 2                  303   6e-96    
ref|XP_005572337.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   6e-96    
gb|AAI16560.1|  Aldh2b protein                                          303   6e-96    
ref|XP_006865489.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   7e-96    
gb|EHH21190.1|  hypothetical protein EGK_04197                          303   7e-96    
ref|NP_956784.1|  aldehyde dehydrogenase 2                              303   7e-96    
ref|XP_006099101.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   7e-96    
dbj|BAD97093.1|  mitochondrial aldehyde dehydrogenase 2 precursor...    303   7e-96    
ref|XP_004843837.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   7e-96    
ref|XP_010162096.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   8e-96    
gb|EHH66723.1|  hypothetical protein EGM_03768                          303   8e-96    
ref|XP_005298651.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   8e-96    
ref|XP_006053037.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   8e-96    
ref|XP_004281483.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   8e-96    
ref|XP_004395895.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   8e-96    
ref|XP_004315892.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   8e-96    
ref|XP_005642981.1|  aldehyde dehydrogenase                             301   8e-96    
ref|NP_001068835.1|  aldehyde dehydrogenase, mitochondrial precursor    303   8e-96    
ref|XP_003832508.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   9e-96    
ref|XP_007489887.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   9e-96    
ref|XP_008002940.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   9e-96    
ref|XP_005344527.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   9e-96    
ref|XP_010377208.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   1e-95    
gb|KFZ60519.1|  hypothetical protein N338_08333                         301   1e-95    
ref|XP_004017458.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   1e-95    
emb|CAG33272.1|  ALDH2                                                  302   1e-95    
ref|XP_010283913.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   1e-95    
ref|XP_005237664.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   1e-95    
ref|XP_008002939.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   1e-95    
ref|XP_004379127.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   1e-95    
ref|XP_005876284.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   1e-95    
ref|XP_009675586.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   1e-95    
ref|XP_009907917.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   1e-95    
gb|ELK26353.1|  Aldehyde dehydrogenase, mitochondrial                   301   1e-95    
gb|EFB19337.1|  hypothetical protein PANDA_000873                       302   1e-95    
pdb|2ONN|A  Chain A, Arg475gln Mutant Of Human Mitochondrial Alde...    301   1e-95    
gb|KFV77329.1|  hypothetical protein N307_00927                         301   1e-95    
ref|XP_009695502.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   1e-95    
ref|XP_007653633.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-95    
gb|AAM19352.1|AF260121_1  aldehyde dehydrogenase 2 precursor            302   2e-95    
gb|KFQ73002.1|  hypothetical protein N337_02121                         300   2e-95    
ref|XP_004483074.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   2e-95    
gb|AJF41242.1|  mitochondrial aldehyde dehydrogenase 2                  300   2e-95    
ref|WP_016874813.1|  betaine-aldehyde dehydrogenase                     301   2e-95    
ref|XP_009470890.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   2e-95    
ref|XP_005876285.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-95    
ref|XP_005572336.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   2e-95    
ref|XP_007130063.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-95    
ref|XP_010883396.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    302   2e-95    
ref|XP_009332689.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   2e-95    
ref|XP_006970829.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-95    
ref|XP_006053036.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   2e-95    
ref|XP_004053951.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-95    
ref|XP_009907916.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   2e-95    
ref|XP_001767457.1|  predicted protein                                  301   2e-95    
ref|NP_001087022.1|  aldehyde dehydrogenase 2 family (mitochondrial)    301   2e-95    
emb|CCQ61589.1|  Aldehyde dehydrogenase                                 301   2e-95    
ref|NP_001124747.1|  aldehyde dehydrogenase, mitochondrial precursor    301   2e-95    
ref|XP_009634365.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   3e-95    
gb|EFX80526.1|  hypothetical protein DAPPUDRAFT_51170                   301   3e-95    
ref|XP_003761072.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   3e-95    
gb|KFP63560.1|  hypothetical protein N322_11016                         300   3e-95    
ref|XP_009948983.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   3e-95    
ref|XP_005237662.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   3e-95    
ref|XP_009916021.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   3e-95    
ref|XP_009510567.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   3e-95    
ref|XP_005572335.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    303   3e-95    
gb|KFQ67066.1|  hypothetical protein N335_09513                         300   3e-95    
ref|XP_011312780.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   3e-95    
ref|XP_010114028.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   4e-95    
gb|KFP98428.1|  hypothetical protein N330_00232                         300   4e-95    
ref|XP_008845744.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    301   4e-95    
gb|KFW62606.1|  hypothetical protein AS28_06355                         300   4e-95    
ref|XP_009282142.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   4e-95    
gb|ELW66580.1|  Aldehyde dehydrogenase, mitochondrial                   301   4e-95    
ref|XP_010303219.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   5e-95    
gb|KFP09214.1|  hypothetical protein Z169_08064                         300   5e-95    
ref|XP_010132992.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   5e-95    
ref|XP_010718484.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   5e-95    
ref|XP_010150586.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   5e-95    
gb|KFQ02971.1|  hypothetical protein N329_07724                         300   5e-95    
ref|XP_002983288.1|  hypothetical protein SELMODRAFT_180171             300   5e-95    
gb|AJF41241.1|  mitochondrial aldehyde dehydrogenase 2                  299   5e-95    
ref|XP_006620105.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   6e-95    
sp|P12762.1|ALDH2_HORSE  RecName: Full=Aldehyde dehydrogenase, mi...    300   6e-95    
ref|XP_009570652.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    297   6e-95    
gb|EPQ13952.1|  Aldehyde dehydrogenase, mitochondrial                   301   6e-95    
ref|XP_008270467.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   6e-95    
ref|XP_009877625.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    297   6e-95    
dbj|BAG62916.1|  unnamed protein product                                299   6e-95    
ref|XP_003979770.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    290   6e-95    
pdb|1NZW|A  Chain A, Cys302ser Mutant Of Human Mitochondrial Alde...    300   7e-95    
pdb|1AG8|A  Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria    300   7e-95    
gb|KFW95044.1|  hypothetical protein N336_12440                         299   7e-95    
ref|XP_008322067.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    300   7e-95    
emb|CAA28990.1|  unnamed protein product                                300   7e-95    
gb|EQB77383.1|  aldehyde dehydrogenase, mitochondrial precursor         300   8e-95    
gb|ACD02422.1|  mitochondrial aldehyde dehydrogenase 2                  300   8e-95    
gb|KFZ54393.1|  hypothetical protein N321_09165                         299   9e-95    
gb|KFM10649.1|  hypothetical protein AS27_00800                         299   9e-95    
gb|KFV93503.1|  hypothetical protein N326_03098                         299   9e-95    
ref|XP_010155846.1|  PREDICTED: retinal dehydrogenase 1                 291   9e-95    
gb|ACN27968.1|  unknown                                                 295   9e-95    
gb|KFO12057.1|  hypothetical protein N312_10195                         299   1e-94    
pdb|3N80|A  Chain A, Human Mitochondrial Aldehyde Dehydrogenase, ...    299   1e-94    
ref|XP_009470881.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   1e-94    
gb|KFV95675.1|  Retinal dehydrogenase 1                                 291   1e-94    
ref|WP_007312907.1|  betaine-aldehyde dehydrogenase                     299   1e-94    
gb|KFV89938.1|  hypothetical protein N327_06370                         298   1e-94    
ref|WP_041229752.1|  betaine-aldehyde dehydrogenase                     296   1e-94    
gb|KFV59939.1|  hypothetical protein N328_09910                         298   1e-94    
emb|CCQ69085.1|  Aldehyde dehydrogenase                                 299   1e-94    
emb|CAA68290.1|  unnamed protein product                                299   1e-94    
gb|AJF41246.1|  mitochondrial aldehyde dehydrogenase 2                  298   1e-94    
ref|XP_006015235.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    295   2e-94    
ref|XP_009878604.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    296   2e-94    
gb|KFP53510.1|  hypothetical protein N323_12997                         298   2e-94    
gb|ACK65581.1|  transposase, IS605 OrfB family                          296   2e-94    
ref|XP_005055123.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    295   2e-94    
ref|XP_005145216.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    299   2e-94    
gb|KFQ57335.1|  hypothetical protein N333_07072                         298   2e-94    
ref|XP_009939330.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    296   2e-94    
ref|XP_009817685.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    296   2e-94    
ref|XP_004945656.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   2e-94    
gb|KDR23477.1|  Aldehyde dehydrogenase, mitochondrial                   299   2e-94    
ref|XP_003642229.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   2e-94    
ref|XP_007448232.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   2e-94    
gb|KGL89437.1|  hypothetical protein N301_08459                         298   2e-94    
ref|XP_007448233.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   2e-94    
gb|KFV73366.1|  hypothetical protein N308_00184                         298   3e-94    
ref|XP_010724044.1|  PREDICTED: retinal dehydrogenase 1                 291   3e-94    
ref|XP_623084.1|  PREDICTED: aldehyde dehydrogenase, mitochondria...    298   3e-94    
gb|KFR15788.1|  hypothetical protein N306_07931                         298   3e-94    
ref|XP_008431064.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    296   3e-94    
gb|KFQ91788.1|  hypothetical protein Y956_05867                         297   3e-94    
ref|XP_008632281.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    296   3e-94    
ref|XP_007433657.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    299   3e-94    
ref|XP_010021190.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    297   3e-94    
ref|XP_010212198.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    298   3e-94    
ref|XP_005498279.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    297   4e-94    
ref|XP_009986764.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    295   4e-94    
ref|WP_007307870.1|  betaine-aldehyde dehydrogenase                     297   4e-94    
gb|ABI24013.1|  mitochondrial Aldh2                                     292   4e-94    
ref|XP_009558681.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    295   4e-94    



>ref|XP_004236119.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=535

 Score =   437 bits (1123),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARAMRRVVGD
Sbjct  308  PFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQF+K+LRYIR G++S ATLECGGDRIGSKGYFIQPT+FS+VKEDM
Sbjct  368  PFKKGVEQGPQIDSEQFQKILRYIREGRDSSATLECGGDRIGSKGYFIQPTVFSNVKEDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGTVW+
Sbjct  428  SIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGTVWV  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA IPFGGYKMSG+GREKG+YSLNNYLQVKAVVTPLKNPAWI
Sbjct  488  NCYDIFDAGIPFGGYKMSGMGREKGIYSLNNYLQVKAVVTPLKNPAWI  535



>ref|XP_006345041.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Solanum tuberosum]
Length=535

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARAMRRVVGD
Sbjct  308  PFIICEDADVDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQF+K+LRYIR G++S ATLECGGDRIGSKGYFIQPT+FS+VKEDM
Sbjct  368  PFKKGVEQGPQIDSEQFKKILRYIREGRDSSATLECGGDRIGSKGYFIQPTVFSNVKEDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGTVWI
Sbjct  428  SIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGTVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPLKNPAWI
Sbjct  488  NCYDIFDAGIPFGGYKMSGTGREKGIYSLNNYLQVKAVVTPLKNPAWI  535



>ref|XP_009617290.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Nicotiana tomentosiformis]
Length=536

 Score =   434 bits (1117),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHER+YDEF+EKAK RAMRRVVGD
Sbjct  309  PFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFIEKAKTRAMRRVVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQF+K+LRYIRSG++S ATLECGGDR GSKGYFIQPT+FS+VKEDM
Sbjct  369  PFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKGYFIQPTVFSNVKEDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGTVW+
Sbjct  429  LIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGTVWV  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  489  NCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNPAWI  536



>ref|XP_009617291.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Nicotiana tomentosiformis]
Length=535

 Score =   434 bits (1116),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHER+YDEF+EKAK RAMRRVVGD
Sbjct  308  PFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFIEKAKTRAMRRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQF+K+LRYIRSG++S ATLECGGDR GSKGYFIQPT+FS+VKEDM
Sbjct  368  PFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKGYFIQPTVFSNVKEDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID ANTL RGLRAGTVW+
Sbjct  428  LIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGLRAGTVWV  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  488  NCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNPAWI  535



>gb|KJB53134.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=328

 Score =   418 bits (1075),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRVVGD
Sbjct  101  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRVVGD  160

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V +DM
Sbjct  161  PFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVMDDM  220

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGTVW+
Sbjct  221  LIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGTVWV  280

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  281  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  328



>ref|XP_002511424.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF52026.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=534

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PF++C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEF+EKAKARAMRRVVGD
Sbjct  307  PFVVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFLEKAKARAMRRVVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQIDSEQF+KVLRYI+SG ES ATLECGGDR G +GYFIQPT+FS+V++DM
Sbjct  367  PFRKGVEQGPQIDSEQFQKVLRYIKSGIESNATLECGGDRFGPRGYFIQPTVFSNVQDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T++ID ANTL+R LRAGTVW+
Sbjct  427  LIAQDEIFGPVQSILKFKDLDEVIRRANTTRYGLAAGVFTNNIDTANTLSRALRAGTVWV  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  534



>gb|KJB53133.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=530

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRVVGD
Sbjct  303  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRVVGD  362

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V +DM
Sbjct  363  PFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVMDDM  422

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGTVW+
Sbjct  423  LIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGTVWV  482

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  483  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  530



>gb|KCW83435.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=378

 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA++R VGD
Sbjct  151  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALKRSVGD  210

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF+KVLRYIR+G +S ATLECGGDR+GSKG+F+QPT+FS+V++DM
Sbjct  211  PFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKGFFVQPTVFSNVQDDM  270

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEV++RAN+T YGLAAGV+T DID AN L+R LR GTVWI
Sbjct  271  LIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDVANALSRALRVGTVWI  330

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  331  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  378



>gb|KJB53131.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=541

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRVVGD
Sbjct  314  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRVVGD  373

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V +DM
Sbjct  374  PFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVMDDM  433

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGTVW+
Sbjct  434  LIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGTVWV  493

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  494  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  541



>ref|XP_002321583.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEF05710.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=497

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+RRVVGD
Sbjct  270  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALRRVVGD  329

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQFEK+LRYI+SG ES ATLECGG R GSKGYFIQPT+FS+V++DM
Sbjct  330  PFKKGVEQGPQIDSEQFEKILRYIKSGVESNATLECGGQRFGSKGYFIQPTVFSNVQDDM  389

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAG++T ++D ANTL+R LR G+VW+
Sbjct  390  LIAKDEIFGPVQSILKFKNIDEVIQRANTTRYGLAAGIFTKNVDTANTLSRALRVGSVWV  449

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  450  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  497



>ref|XP_002318034.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEE96254.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=536

 Score =   418 bits (1074),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRTYVHER+YDEF+EKAKARA+RRVVGD
Sbjct  309  PFIVCEDADVDKAVELAHHALFFNQGQCCCAGSRTYVHERVYDEFIEKAKARALRRVVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKGYFIQPT+FS+V++DM
Sbjct  369  PFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKGYFIQPTVFSNVEDDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK++DEVI+R+N+T YGLAAG++T ++D ANTL+R LR GTVW+
Sbjct  429  LIAQDEIFGPVQSILKFKNVDEVIRRSNSTRYGLAAGIFTKNVDTANTLSRALRVGTVWV  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  489  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  536



>gb|KHG08400.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=540

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  313  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KGYF+QPT+FS+V +DM
Sbjct  373  PFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYFVQPTVFSNVMDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ ANTL R LRAGTVW+
Sbjct  433  LIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETANTLTRALRAGTVWV  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  493  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  540



>emb|CDP18933.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE+AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RR VGD
Sbjct  307  PFIVCEDADIDKAVEEAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRTVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQIDSEQF+KVLRYI+SG +S ATLECGG+RIGSKG+FIQPT+FS+V+++M
Sbjct  367  PFRKGVEQGPQIDSEQFDKVLRYIKSGVDSNATLECGGERIGSKGFFIQPTVFSNVQDNM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEVIKRAN T YGLAAGVYT +ID ANTL+RGLRAGTVWI
Sbjct  427  LIAKDEIFGPVQSILKFKDLDEVIKRANATRYGLAAGVYTKNIDTANTLSRGLRAGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGHGREKGFYSLQNYLQVKAVVTPLKNPAWL  534



>ref|XP_011044320.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=538

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRTYVHER+YDEF+EKAKARA+RRVVGD
Sbjct  311  PFIVCEDADVDKAVELAHHALFFNQGQCCCAGSRTYVHERVYDEFIEKAKARALRRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKGYFIQPT+FS+V++DM
Sbjct  371  PFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKGYFIQPTVFSNVQDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK++DEVI+R+N+T YGLAAG++T ++D ANTL+R LR GTVW+
Sbjct  431  LIAQDEIFGPVQSILKFKNVDEVIRRSNSTRYGLAAGIFTRNLDTANTLSRALRVGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKA+VTPLKNPAW+
Sbjct  491  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAIVTPLKNPAWL  538



>ref|XP_011044321.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   417 bits (1071),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQ CCAGSRTYVHER+YDEF+EKAKARA+RRVVGD
Sbjct  312  PFIVCEDADVDKAVELAHHALFFNQGQSCCAGSRTYVHERVYDEFIEKAKARALRRVVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKGYFIQPT+FS+V++DM
Sbjct  372  PFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKGYFIQPTVFSNVQDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK+IDEVI+R+NNT YGLAAG++T ++D ANTL+R LR GTVW+
Sbjct  432  LIAQDEIFGPVQSILKFKNIDEVIRRSNNTRYGLAAGIFTKNVDTANTLSRALRVGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  492  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  539



>gb|EYU42550.1| hypothetical protein MIMGU_mgv1a004919mg [Erythranthe guttata]
Length=504

 Score =   415 bits (1067),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+CDDA++D AVE AHFALFFNQGQCCCAGSRTYVHERIYDEFV+KAKARA+ R VGD
Sbjct  277  PFIVCDDADVDHAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFVDKAKARALGRTVGD  336

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID +QFEKVLRYI+SG +S ATLECGGDR GSKGYF+QPT+FS+VK+DM
Sbjct  337  PFKNGIEQGPQIDLKQFEKVLRYIKSGIDSDATLECGGDRFGSKGYFVQPTVFSNVKDDM  396

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+D+VIKRAN T YGLAAGV+T++IDKANT++RGL+AGTVWI
Sbjct  397  LIAQDEIFGPVQSILKFKDVDKVIKRANATRYGLAAGVFTTNIDKANTISRGLKAGTVWI  456

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA IPFGGYKMSGIGREKGVYSLNNYLQVK+V++PLKNPAW+
Sbjct  457  NCYDIFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKSVISPLKNPAWL  504



>gb|KDP31120.1| hypothetical protein JCGZ_11496 [Jatropha curcas]
Length=541

 Score =   416 bits (1070),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+RRVVGD
Sbjct  314  PFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAVRRVVGD  373

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQF+KVLRYI+SG ES   LECGG+R+GSKGYFIQPT+FS+V+EDM
Sbjct  374  PFKKGVEQGPQIDDEQFQKVLRYIKSGIESNGKLECGGERLGSKGYFIQPTVFSNVQEDM  433

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEVI+RAN++ YGLAAGV+T +ID ANTL+R LRAGTVW+
Sbjct  434  LIAKDEIFGPVQSILKFKDVDEVIRRANSSRYGLAAGVFTKNIDTANTLSRALRAGTVWV  493

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  494  NCFDVFDAAIPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLKNPAWL  541



>gb|KEH35050.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=542

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHERIYDEF+EKAKA A+RRVVGD
Sbjct  315  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFLEKAKAAALRRVVGD  374

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQ+DS+QFEK+L+YI+SG ES ATLECGGDRIG+KG+F+QPT+FS+V++DM
Sbjct  375  PFKKGVEQGPQVDSQQFEKILKYIKSGVESNATLECGGDRIGTKGFFVQPTVFSNVQDDM  434

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ +LKFKD DEVI+RANNT YGLAAGV+T+++D ANTL RGL+AGTVWI
Sbjct  435  SIAKDEIFGPVQTILKFKDTDEVIRRANNTRYGLAAGVFTNNLDTANTLMRGLKAGTVWI  494

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  495  NCFDVFDAAIPFGGYKMSGVGREKGIYSLHNYLQVKAVVTPLKNPAWL  542



>ref|XP_010546022.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Tarenaya hassleriana]
Length=539

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+RR VGD
Sbjct  312  PFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALRRAVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQ+DSEQFEKV+RYIRSG ES A LECGG+RIG+KGYFIQPT+FS+VKEDM
Sbjct  372  PFKKGIEQGPQVDSEQFEKVMRYIRSGLESDAVLECGGERIGNKGYFIQPTVFSNVKEDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEVI+RANNT YGLAAGV+T  ++ AN + R LRAGTVW+
Sbjct  432  LIARDEIFGPVQSILKFKDLDEVIQRANNTRYGLAAGVFTRSLETANRMTRALRAGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV PLKNPAWI
Sbjct  492  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVAPLKNPAWI  539



>ref|XP_010037573.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW49300.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
 gb|KCW49301.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
Length=542

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFA+FFNQGQCCCAGSRTYVHERIYDEF+EKAKARAM+RVVGD
Sbjct  315  PFIICEDADIDEAVEAAHFAIFFNQGQCCCAGSRTYVHERIYDEFLEKAKARAMKRVVGD  374

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQFEK+LRYI+ G ES ATLECGG+R GSKG+FIQPT+FS+VK+DM
Sbjct  375  PFKKGVEQGPQIDVEQFEKILRYIKLGVESNATLECGGERFGSKGFFIQPTVFSNVKDDM  434

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQDEIFGPVQ +LKFKD+DEV++RAN T YGLAAGVYT +ID ANTL R LRAGTVW+
Sbjct  435  TIAQDEIFGPVQSILKFKDLDEVVRRANATAYGLAAGVYTKNIDTANTLTRALRAGTVWV  494

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSGIGREKG+Y LN+YLQVKAVVTPLKNPAW+
Sbjct  495  NCYDVFDAAIPFGGYKMSGIGREKGIYGLNSYLQVKAVVTPLKNPAWL  542



>ref|XP_010101190.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB87864.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=546

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA+ R VGD
Sbjct  319  PFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAVNRSVGD  378

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQF K+L+YIRSG +S ATLECGGDRIGSKGYFIQPT+FS+V++DM
Sbjct  379  PFKKGVEQGPQIDSEQFRKILKYIRSGIDSNATLECGGDRIGSKGYFIQPTVFSNVQDDM  438

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK+IDEVIKRAN T YGLAAGV+T +ID ANTL R L+AGTVW+
Sbjct  439  LIAQDEIFGPVQSILKFKEIDEVIKRANATRYGLAAGVFTKNIDTANTLTRALKAGTVWV  498

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKGVYSLNNYLQVKAVVT LKNPAW+
Sbjct  499  NCFDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTRLKNPAWL  546



>ref|XP_008360830.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like, 
partial [Malus domestica]
Length=253

 Score =   405 bits (1040),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -3

Query  795  FIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDP  616
            FIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGDP
Sbjct  27   FIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRVVGDP  86

Query  615  FKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMV  436
            FKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFIQPT+FS+VK+DM+
Sbjct  87   FKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKGYFIQPTVFSNVKDDML  146

Query  435  IAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWIN  256
            IA+DEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +ID AN L R LRAGTVW+N
Sbjct  147  IAKDEIFGPVQSILKFKELDEVVRRANXTRYGLAAGVFTKNIDTANYLTRALRAGTVWVN  206

Query  255  CYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            C+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  207  CFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  253



>ref|XP_008453101.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis melo]
Length=554

 Score =   415 bits (1066),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+Y+EFVEK+KARA RRVVGD
Sbjct  327  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYEEFVEKSKARAQRRVVGD  386

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQFEKVLRYI+SG ES ATLECGG R+GSKGYFI+PT+FS+VK+DM
Sbjct  387  PFKKGVEQGPQIDLEQFEKVLRYIKSGIESNATLECGGGRLGSKGYFIEPTVFSNVKDDM  446

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+GV+TS+ID ANTL RGLR GTVW+
Sbjct  447  LIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGVFTSNIDTANTLTRGLRTGTVWV  506

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  507  NCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNPAWL  554



>ref|XP_010028184.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW83434.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=534

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKAKARA++R VGD
Sbjct  307  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARALKRSVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF+KVLRYIR+G +S ATLECGGDR+GSKG+F+QPT+FS+V++DM
Sbjct  367  PFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKGFFVQPTVFSNVQDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEV++RAN+T YGLAAGV+T DID AN L+R LR GTVWI
Sbjct  427  LIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDVANALSRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  534



>gb|KHN18468.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=542

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRVVGD
Sbjct  315  PFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRVVGD  374

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+GSKG+F+QPT+FS+V++DM
Sbjct  375  PFKKGVEQGPQIDVEQFEKVLRYIRSGIESHATLECGGDRLGSKGFFVQPTVFSNVQDDM  434

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++  ANTL R LRAGTVWI
Sbjct  435  LIAQDEIFGPVQSILKFKDIDEVIRRANKTRYGLAAGVFTKNVSTANTLMRALRAGTVWI  494

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+P+KNPAW+
Sbjct  495  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPVKNPAWL  542



>ref|XP_004138115.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
 gb|KGN63591.1| hypothetical protein Csa_1G005520 [Cucumis sativus]
Length=548

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEK+KARA RRVVGD
Sbjct  321  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKSKARAQRRVVGD  380

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYI+SG ES ATLECGG R+GSKGYFI+PT+FS+VK+DM
Sbjct  381  PFKKGVEQGPQIDSDQFEKVLRYIKSGIESNATLECGGGRLGSKGYFIEPTVFSNVKDDM  440

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+G++TS+ID ANTL RGLR GTVW+
Sbjct  441  LIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGIFTSNIDTANTLIRGLRTGTVWV  500

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  501  NCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNPAWL  548



>ref|XP_004508854.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=423

 Score =   409 bits (1050),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRVVGD
Sbjct  196  PFIVCEDADVDKAVEIAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKERALRRVVGD  255

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQFEKVLRYIRSG +S ATLECGG+R GSKG+FIQPT+FS+V++DM
Sbjct  256  PFKKGVEQGPQIDSEQFEKVLRYIRSGIDSNATLECGGERFGSKGFFIQPTVFSNVQDDM  315

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAGV+T ++  ANTL R LRAGTVWI
Sbjct  316  LIAKDEIFGPVQSILKFKEIDEVIRRANATRYGLAAGVFTKNLSTANTLMRALRAGTVWI  375

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PLKNPAW+
Sbjct  376  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLKNPAWL  423



>ref|XP_004298932.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=532

 Score =   412 bits (1058),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA++R VGD
Sbjct  305  PFIICKDADIDHAVELAHFALFFNQGQCCCAGSRTFVHEHVYDEFLEKAKARALKRTVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDSEQF+KVL+YI+SG ES ATLECGG+R GSKGYFIQPT+FS+V++DM
Sbjct  365  PFKKGIEQGPQIDSEQFQKVLKYIKSGVESDATLECGGERFGSKGYFIQPTVFSNVQDDM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK+IDEV++RAN+T +GLAAGV+T +ID ANTL R LRAGTVW+
Sbjct  425  LIAQDEIFGPVQSILKFKEIDEVVRRANSTRFGLAAGVFTKNIDTANTLTRALRAGTVWV  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  485  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  532



>ref|XP_008374451.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Malus domestica]
Length=539

 Score =   411 bits (1057),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+I+ AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  312  PFIICEDADINHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRVVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEKVLRYIRSG +S ATLECGG+R+GSKGYFIQPT+FS+V++DM
Sbjct  372  PFKKGVEQGPQIDNEQFEKVLRYIRSGIDSNATLECGGERLGSKGYFIQPTVFSNVEDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +I+ AN L R LRAGTVW+
Sbjct  432  LIAQDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNINTANYLTRALRAGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  492  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  539



>ref|XP_008367527.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Malus domestica]
Length=541

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  314  PFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRVVGD  373

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFIQPT+FS+VK+DM
Sbjct  374  PFKKGVEQGPQIDNEQFEKVLRYIRAGIDSBATLECGGGRLGSKGYFIQPTVFSNVKDDM  433

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +ID AN L R LRAGTVW+
Sbjct  434  LIAKDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNIDTANYLTRALRAGTVWV  493

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  494  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  541



>ref|XP_007155411.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27405.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=536

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRVVGD
Sbjct  309  PFIVFEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRVVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQFEKVL YIRSG ES ATLECGG+R+GSKG+FIQPT+FS+V++DM
Sbjct  369  PFKKGVEQGPQIDGEQFEKVLSYIRSGIESNATLECGGNRLGSKGFFIQPTVFSNVQDDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            VIAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++D AN L R LRAGTVWI
Sbjct  429  VIAQDEIFGPVQSILKFKDIDEVIQRANRTRYGLAAGVFTKNVDTANRLMRALRAGTVWI  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  489  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWI  536



>ref|XP_007155410.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27404.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=535

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRVVGD
Sbjct  308  PFIVFEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQFEKVL YIRSG ES ATLECGG+R+GSKG+FIQPT+FS+V++DM
Sbjct  368  PFKKGVEQGPQIDGEQFEKVLSYIRSGIESNATLECGGNRLGSKGFFIQPTVFSNVQDDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            VIAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++D AN L R LRAGTVWI
Sbjct  428  VIAQDEIFGPVQSILKFKDIDEVIQRANRTRYGLAAGVFTKNVDTANRLMRALRAGTVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAWI
Sbjct  488  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWI  535



>gb|AFK44278.1| unknown [Medicago truncatula]
Length=378

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EK+K RA+RRVVGD
Sbjct  151  PFIVCEDADIDKAVEIAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKSKERALRRVVGD  210

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG+F+QPT+FS+V++DM
Sbjct  211  PFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKGFFVQPTVFSNVQDDM  270

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  ANTL R LRAGTVWI
Sbjct  271  LIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVSTANTLMRALRAGTVWI  330

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NPAW+
Sbjct  331  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNPAWL  378



>gb|AAO72532.1| aldehyde dehydrogenase 1 precursor [Lotus corniculatus]
Length=542

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRVVGD
Sbjct  315  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRVVGD  374

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG+++QPT+FS+V++DM
Sbjct  375  PFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKGFYVQPTVFSNVQDDM  434

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  ANTL R LRAGTVWI
Sbjct  435  LIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLATANTLMRALRAGTVWI  494

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  495  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  542



>ref|XP_008239742.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Prunus mume]
Length=537

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  310  PFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFI+PT+FS+VK+DM
Sbjct  370  PFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKGYFIEPTVFSNVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEV++RAN T YGLAAGV+T +ID AN L R LRAGTVW+
Sbjct  430  LIAKDEIFGPVQSILKFKDLDEVVRRANATRYGLAAGVFTRNIDTANYLTRALRAGTVWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  490  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL  537



>ref|XP_007210569.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
 gb|EMJ11768.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
Length=543

 Score =   410 bits (1053),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  316  PFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAVKRVVGD  375

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKGYFI+PT+FS+VK+DM
Sbjct  376  PFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKGYFIEPTVFSNVKDDM  435

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEV++RAN T YGLAAGV+T +ID AN   R LRAGTVW+
Sbjct  436  LIAKDEIFGPVQSILKFKDLDEVVRRANATRYGLAAGVFTRNIDTANYFTRALRAGTVWV  495

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNPAW+
Sbjct  496  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL  543



>ref|XP_004508853.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=536

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRVVGD
Sbjct  309  PFIVCEDADVDKAVEIAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKERALRRVVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQFEKVLRYIRSG +S ATLECGG+R GSKG+FIQPT+FS+V++DM
Sbjct  369  PFKKGVEQGPQIDSEQFEKVLRYIRSGIDSNATLECGGERFGSKGFFIQPTVFSNVQDDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAGV+T ++  ANTL R LRAGTVWI
Sbjct  429  LIAKDEIFGPVQSILKFKEIDEVIRRANATRYGLAAGVFTKNLSTANTLMRALRAGTVWI  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PLKNPAW+
Sbjct  489  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLKNPAWL  536



>ref|XP_011028588.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEF+EKAKARA+RRVVGD
Sbjct  312  PFIVCEDADVDKAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFIEKAKARALRRVVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQFEKVLRYI+SG ES ATLECGG R GSKGYFIQPT+FS+V++DM
Sbjct  372  PFKKGVEQGPQIDSEQFEKVLRYIKSGVESNATLECGGQRFGSKGYFIQPTVFSNVQDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAG +T ++D ANTL+R LR G+VW+
Sbjct  432  LIAKDEIFGPVQSILKFKNIDEVIQRANTTRYGLAAGSFTKNVDTANTLSRALRVGSVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IP GGYKMSGIGR KG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  492  NCFDVFDAAIPLGGYKMSGIGRGKGIYSLHNYLQVKAVVTPLKNPAWL  539



>ref|XP_006439785.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53025.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=478

 Score =   407 bits (1046),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEFVEKAKARAMRR+VGD
Sbjct  251  PFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRIVGD  310

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+G++GYF+QPT+FSDVK+DM
Sbjct  311  PFKSGVEQGPQIDPEQFEKVLRYIRSGIESNATLECGGDRLGNRGYFVQPTVFSDVKDDM  370

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D ANT+ R LRAGTVWI
Sbjct  371  LIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMMRALRAGTVWI  430

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNPAW+
Sbjct  431  NCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL  478



>gb|EPS72259.1| hypothetical protein M569_02499, partial [Genlisea aurea]
Length=291

 Score =   400 bits (1027),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARAM+R VGD
Sbjct  64   PFIVCEDADIDLAVELAHFALFFNQGQCCCAGSRTFVHESIYHEFVEKAKARAMKRTVGD  123

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK+G+EQGPQID EQF+K+LRYIRSG E+ A LECGG+ +GSKGY+IQPT+FS+V++DM
Sbjct  124  PFKRGIEQGPQIDDEQFQKILRYIRSGTETKAVLECGGESLGSKGYYIQPTVFSNVEDDM  183

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +L+FK+IDEVIKRAN T YGLAAGV+T +ID ANTL RGLRAGTVW+
Sbjct  184  LIAKDEIFGPVQSILRFKNIDEVIKRANATRYGLAAGVFTRNIDTANTLTRGLRAGTVWV  243

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSGIGREKG++SLNNYLQVK++++PL NPAW+
Sbjct  244  NCYDVFDAAIPFGGYKMSGIGREKGIHSLNNYLQVKSIISPLSNPAWL  291



>ref|XP_006439784.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53024.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=538

 Score =   409 bits (1050),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEFVEKAKARAMRR+VGD
Sbjct  311  PFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRIVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+G++GYF+QPT+FSDVK+DM
Sbjct  371  PFKSGVEQGPQIDPEQFEKVLRYIRSGIESNATLECGGDRLGNRGYFVQPTVFSDVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D ANT+ R LRAGTVWI
Sbjct  431  LIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMMRALRAGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNPAW+
Sbjct  491  NCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL  538



>gb|AEV54528.1| aldehyde dehydrogenase ALDH2B4_V3 [Vitis vinifera]
Length=524

 Score =   408 bits (1048),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  297  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  356

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  357  PFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  416

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  417  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  476

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  477  NCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  524



>gb|AEV54527.1| aldehyde dehydrogenase ALDH2B4_V2 [Vitis vinifera]
Length=477

 Score =   406 bits (1044),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  250  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  309

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  310  PFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  369

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  370  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  429

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  430  NCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  477



>ref|XP_002283132.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI15054.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  311  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  371  PFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  431  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  491  NCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  538



>emb|CAN63005.1| hypothetical protein VITISV_013710 [Vitis vinifera]
Length=538

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  311  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  371  PFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  431  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNPAW+
Sbjct  491  NCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL  538



>ref|XP_007044551.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
 gb|EOY00383.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
Length=538

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/228 (82%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D A E AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA+ R VGD
Sbjct  311  PFIVCKDADVDEAAELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARALNRTVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQFEK+LRYIRSG ESGATLE GG+RIGSKGY+IQPT+FS+VKEDM
Sbjct  371  PFKAGIEQGPQIDSEQFEKILRYIRSGIESGATLETGGERIGSKGYYIQPTVFSNVKEDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKDI EVI+RAN+T YGLAAGV+T DID ANT+ R L+ GTVWI
Sbjct  431  LIAQDEIFGPVQSILKFKDIKEVIRRANSTSYGLAAGVFTKDIDTANTVTRALKVGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG+ SL+NYLQVKAVVTPLKNPAW+
Sbjct  491  NCYDVFDAAIPFGGYKMSGQGREKGIQSLSNYLQVKAVVTPLKNPAWM  538



>gb|KDP26565.1| hypothetical protein JCGZ_17723 [Jatropha curcas]
Length=537

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHERIYDEF+EKAKARA++RVVGD
Sbjct  310  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTYVHERIYDEFIEKAKARAIKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ G+EQGPQ+DSEQFEK+LRYIRSG ESGATLE GGDR G+KGY+IQPT+FS+VK+DM
Sbjct  370  PFRGGIEQGPQVDSEQFEKILRYIRSGIESGATLEAGGDRFGTKGYYIQPTVFSNVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+ EVI RAN+T YGLAAGV+T +ID AN L R LR GTVWI
Sbjct  430  LIAKDEIFGPVQSILKFKDLGEVIHRANSTRYGLAAGVFTQNIDTANILTRALRVGTVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct  490  NCFDVFDAAIPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLKNPAWL  537



>ref|XP_003527026.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN19318.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=540

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE IYDEF+EKAKARA++RVVGD
Sbjct  313  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHEHIYDEFLEKAKARALKRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQF+KVLRYI+SG ES ATLECGGD+IGSKG+F+QPT+FS+V++DM
Sbjct  373  PFKKGVEQGPQIDVEQFQKVLRYIKSGIESKATLECGGDQIGSKGFFVQPTVFSNVQDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDIDEVI+R+N THYGLAAGV+T ++  ANTL R LR GTVWI
Sbjct  433  LIAKDEIFGPVQTILKFKDIDEVIRRSNATHYGLAAGVFTKNVHTANTLMRALRVGTVWI  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVV+P+K PAW+
Sbjct  493  NCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVSPVKKPAWL  540



>gb|EYU31278.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
 gb|EYU31279.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
Length=533

 Score =   406 bits (1044),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++R VGD
Sbjct  306  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALQRAVGD  365

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQFEK+L+YIRSG ESGATLE GGDR+G+KGY++QPT+FS+VK+DM
Sbjct  366  PFKSGMEQGPQIDSEQFEKILKYIRSGTESGATLETGGDRLGTKGYYVQPTVFSNVKDDM  425

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKF ++++VIKRANNT YGLAAGV+TS++D ANTL R LRAGTVWI
Sbjct  426  LIAKDEIFGPVQTILKFNELNDVIKRANNTRYGLAAGVFTSNLDTANTLTRALRAGTVWI  485

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  486  NCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKNPAWL  533



>ref|XP_003608978.1| Mitochondrial aldehyde dehydrogenase [Medicago truncatula]
Length=544

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EK+K RA+RRVVGD
Sbjct  317  PFIVCEDADIDKAVEIAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKSKERALRRVVGD  376

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG+F+QPT+FS+V++DM
Sbjct  377  PFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKGFFVQPTVFSNVQDDM  436

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  ANTL R LRAGTVWI
Sbjct  437  LIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVSTANTLMRALRAGTVWI  496

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NPAW+
Sbjct  497  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNPAWL  544



>ref|XP_006476755.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Citrus sinensis]
Length=538

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D+AVE AHFALF+NQGQCCCAGSRTYVHER+YDEFVEKAKARAMRR+VGD
Sbjct  311  PFIIFDDADVDQAVELAHFALFYNQGQCCCAGSRTYVHERVYDEFVEKAKARAMRRIVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID EQF+KVLRYIRSG ES ATLECGGDR+G++GYF+QPT+FSDV +DM
Sbjct  371  PFKNGVEQGPQIDPEQFQKVLRYIRSGIESNATLECGGDRLGNRGYFVQPTVFSDVTDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D ANT+ R LRAGTVWI
Sbjct  431  LIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADTANTMMRALRAGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNPAW+
Sbjct  491  NCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNPAWL  538



>ref|XP_009150211.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Brassica rapa]
Length=538

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DANI++AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  311  PFIVFEDANINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QFEKV+RYIRSG ES ATLECGGD+IG+KGYFIQPT+FS+VK+DM
Sbjct  371  PFKKGIEQGPQIDSKQFEKVMRYIRSGVESNATLECGGDQIGNKGYFIQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVI+RAN T YGLAAGV+T+ +D AN ++R L+AGTVW+
Sbjct  431  LIAQDEIFGPVQSILKFRDVDEVIRRANETRYGLAAGVFTNSLDTANRVSRALKAGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L NPAWI
Sbjct  491  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNNPAWI  538



>emb|CDY36910.1| BnaA06g16950D [Brassica napus]
Length=539

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  312  PFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGG ++G KGYFIQPT+FS+VK+DM
Sbjct  372  PFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGGQVGDKGYFIQPTVFSNVKDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  432  LIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  492  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  539



>gb|AAZ79358.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=524

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  297  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  356

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  357  PFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  416

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  417  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  476

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NPAW+
Sbjct  477  NCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNPAWL  524



>gb|AAZ79356.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=477

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  250  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  309

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  310  PFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  369

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  370  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  429

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NPAW+
Sbjct  430  NCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNPAWL  477



>ref|XP_011086550.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Sesamum indicum]
Length=532

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHF+LFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++R VGD
Sbjct  305  PFIVCEDADIDQAVELAHFSLFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRAVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ G+EQGPQIDSEQFEK+L+YIR G+ESGAT+E GGDR GSKGY+IQPT+FS+VK+DM
Sbjct  365  PFRAGMEQGPQIDSEQFEKILKYIRWGRESGATVEAGGDRFGSKGYYIQPTVFSNVKDDM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA DEIFGPVQ +LK+K++DEVI+RANNT YGLAAGV+T ++D ANTL R LRAGTVWI
Sbjct  425  RIATDEIFGPVQTILKYKELDEVIRRANNTRYGLAAGVFTHNLDTANTLMRALRAGTVWI  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSGIGREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  485  NCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPLKNPAWL  532



>ref|XP_010682578.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=550

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA++RVVGD
Sbjct  323  PFIVCKDADIDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARAIQRVVGD  382

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+K +EQGPQIDSEQFEKV++YI+SG ESGA LE GG+R+GSKG++IQPT+FS+V EDM
Sbjct  383  PFRKDIEQGPQIDSEQFEKVMQYIKSGIESGAKLETGGERLGSKGFYIQPTVFSNVNEDM  442

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ + KFKD+ EV +RANNTHYGLAAGV+T DID ANTLAR LR GTVW+
Sbjct  443  LIAQDEIFGPVQSIFKFKDLQEVARRANNTHYGLAAGVFTQDIDTANTLARALRVGTVWV  502

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG+Y L NYLQVK+VVTPLKNPAW+
Sbjct  503  NCYDVFDAAIPFGGYKMSGQGREKGIYCLMNYLQVKSVVTPLKNPAWL  550



>gb|AAZ79355.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=537

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARA+ R VGD
Sbjct  310  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKGYF+QPT+FS+V++DM
Sbjct  370  PFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKGYFVQPTVFSNVQDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  430  LIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINTANTLTRALRVGTVWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NPAW+
Sbjct  490  NCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNPAWL  537



>ref|XP_009149853.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Brassica rapa]
Length=539

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  312  PFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGG ++G +GYFIQPT+FS+VK+DM
Sbjct  372  PFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGGQVGDRGYFIQPTVFSNVKDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  432  LIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  492  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  539



>gb|AFK41217.1| unknown [Lotus japonicus]
Length=543

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT++HER+YDEF+EK+K RA+R VVGD
Sbjct  316  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFIHERVYDEFLEKSKKRALRCVVGD  375

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG+++QPT+FS+V++DM
Sbjct  376  PFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKGFYVQPTVFSNVQDDM  435

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  ANTL R LRAGTVWI
Sbjct  436  LIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLATANTLMRALRAGTVWI  495

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  496  NCFDVFDAAIPFGGYKMSGIGREKGIYSLLNYLQVKAVVTPLKNPAWL  543



>ref|XP_010678738.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=534

 Score =   404 bits (1037),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKA  RA RR VGD
Sbjct  307  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKATQRAKRRTVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID+EQFEKVLRYI+SG ES A LECGG R GS+G FIQPT+FS+V++DM
Sbjct  367  PFKSGIEQGPQIDTEQFEKVLRYIKSGSESNAKLECGGQRFGSRGLFIQPTVFSNVQDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK++D+V+ RAN T YGLAAGV+T++++ ANTL+R LRAGTVW+
Sbjct  427  LIAQDEIFGPVQSILKFKELDDVVHRANTTQYGLAAGVFTNNLNTANTLSRALRAGTVWV  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKGVYSL+NYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVTPLKNPAWL  534



>emb|CDY44985.1| BnaCnng12150D [Brassica napus]
Length=538

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  311  PFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQ+DS+QFEKV++YIRSG ES ATLECGG ++G +GYFIQPT+FS+VK+DM
Sbjct  371  PFKKGIEQGPQVDSKQFEKVMKYIRSGVESNATLECGGGQVGDRGYFIQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  431  LIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  491  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  538



>gb|ACM89738.1| mitochondrial benzaldehyde dehydrogenase [Antirrhinum majus]
Length=534

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA++R VGD
Sbjct  307  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARALKRTVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+D++QFEK+L+YIRSG ESGATLE GGDR+G+KGY+IQPT+FSDVK+DM
Sbjct  367  PFKAGMEQGPQVDADQFEKILKYIRSGAESGATLETGGDRLGTKGYYIQPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK++DEVI+RANN+ YGLAAGV+T ++D ANT+ R LRAGTVWI
Sbjct  427  LIAKDEIFGPVQTILKFKELDEVIRRANNSSYGLAAGVFTQNLDTANTMMRALRAGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  487  NCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKNPAWL  534



>ref|XP_011071828.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Sesamum indicum]
Length=536

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+IDRAVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA RR VGD
Sbjct  309  PFIVFEDADIDRAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAARRTVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QF+KVLRYIRSG +  A LECGG+R+GSKG++IQPT+FS+V+++M
Sbjct  369  PFKKGIEQGPQIDSDQFDKVLRYIRSGIDGNAKLECGGERVGSKGFYIQPTVFSNVEDNM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEVIKRAN T YGLAAGV+T +ID ANT++RGLRAGTVW+
Sbjct  429  LIAQDEIFGPVQSILKFKDVDEVIKRANATRYGLAAGVFTKNIDIANTVSRGLRAGTVWV  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL NYLQVKAV++PL NPAW+
Sbjct  489  NCFDVFDAAIPFGGYKMSGIGREKGIYSLKNYLQVKAVISPLTNPAWL  536



>ref|XP_009761724.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=540

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGD
Sbjct  313  PFIICEDADIDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEK+L+YI SG ESGATLE GG+++GSKG+++QPT+FS+V+++M
Sbjct  373  PFKKGVEQGPQIDTEQFEKILKYIESGIESGATLESGGEKLGSKGFYVQPTVFSNVQDNM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD++EVI+RAN+THYGLAAGV+T +ID ANT++R LR GTVW+
Sbjct  433  LIAKDEIFGPVQSLLKFKDLEEVIRRANSTHYGLAAGVFTQNIDVANTISRALRVGTVWV  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+++FDA IPFGGYKMSG GREKGVYSLNNYLQVKAVVTPLKNPAW+
Sbjct  493  NCFNIFDAAIPFGGYKMSGHGREKGVYSLNNYLQVKAVVTPLKNPAWM  540



>ref|XP_010682575.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE +YDEFVEKAK RA  R VGD
Sbjct  307  PFIICEDADIDEAVETAHFALFFNQGQCCCAGSRTFVHENVYDEFVEKAKLRAANRSVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK+G+EQGPQID EQF K+LRYI+SG ESGATLE GGD+IGSKGY+I+PT+FS+V +DM
Sbjct  367  PFKQGIEQGPQIDPEQFNKILRYIKSGVESGATLETGGDKIGSKGYYIKPTVFSNVTDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFK IDEVI+RAN + YGLAAGV+T +ID ANT++R L+AGTVWI
Sbjct  427  LIAQDEIFGPVQSILKFKSIDEVIRRANASDYGLAAGVFTKNIDTANTISRALKAGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSGIGREKGVYSLNNYLQVKA+VTPLKNPAW+
Sbjct  487  NCYDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAIVTPLKNPAWL  534



>gb|KFK44454.1| hypothetical protein AALP_AA1G258900 [Arabis alpina]
Length=524

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA+ R VGD
Sbjct  297  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARAINRSVGD  356

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+L+YI+ G +SGATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  357  PFKSGIEQGPQVDSEQFKKILKYIKHGVDSGATLQAGGDRLGSKGYYIQPTVFSDVKDDM  416

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D AN L+R LR GTVWI
Sbjct  417  LIAQDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTANRLSRALRVGTVWI  476

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDV D TIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNPAW+
Sbjct  477  NCYDVLDITIPFGGYKMSGIGREKGIYSLSNYLQVKAVVTALKNPAWL  524



>ref|XP_010682577.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFV KAKARAM+RVVGD
Sbjct  308  PFIVCKDADIDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVAKAKARAMQRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+K +EQGPQIDSEQFEKV+RYIRSG E+GA LE GG++ GSKGY+IQPT+FS+V EDM
Sbjct  368  PFRKDIEQGPQIDSEQFEKVMRYIRSGIENGAKLETGGEQFGSKGYYIQPTVFSNVNEDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ + KFKD++EV++RANNT YGLAAGV+T DID ANTL+R LR GTVW+
Sbjct  428  LIAQDEIFGPVQSIFKFKDLEEVVRRANNTRYGLAAGVFTQDIDTANTLSRALRVGTVWV  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSG GREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  488  NCFDIFDAGIPFGGYKMSGQGREKGIYSLMNYLQVKAVVTPLKNPAWL  535



>emb|CDX91724.1| BnaC08g06430D [Brassica napus]
Length=537

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R VGD
Sbjct  310  PFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAINRAVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKGY+IQPT+FSDVK+DM
Sbjct  370  PFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQPTVFSDVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  430  LIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  490  NCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSIKNPAWL  537



>ref|XP_006404308.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
 dbj|BAJ34644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45761.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
Length=538

 Score =   402 bits (1032),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+I++AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  311  PFIVFEDADINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG EQGPQID +QFEKV++YIRSG ES ATLECGGD+ G KGYFIQPT+FS+VK+DM
Sbjct  371  PFKKGTEQGPQIDLKQFEKVMKYIRSGVESNATLECGGDQFGKKGYFIQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  431  LIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAWI
Sbjct  491  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI  538



>emb|CDY57318.1| BnaA08g20300D [Brassica napus]
Length=537

 Score =   401 bits (1031),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R VGD
Sbjct  310  PFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAINRAVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKGY+IQPT+FSDVK+DM
Sbjct  370  PFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQPTVFSDVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  430  LIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  490  NCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  537



>emb|CDY21806.1| BnaA06g20750D [Brassica napus]
Length=496

 Score =   400 bits (1027),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DANI++AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  269  PFIVFEDANINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  328

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS QFEKV+RYIRSG ES ATLECGG +IG+KGYFIQPT+FS+VK+ M
Sbjct  329  PFKKGIEQGPQIDSRQFEKVMRYIRSGVESNATLECGGHQIGNKGYFIQPTVFSNVKDYM  388

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  389  LIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGTVWV  448

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L NPAWI
Sbjct  449  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNNPAWI  496



>gb|EPS72983.1| mitochondrial benzaldehyde dehydrogenase, partial [Genlisea aurea]
Length=512

 Score =   400 bits (1028),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAK RA++R VGD
Sbjct  285  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKVRALKRTVGD  344

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID +QF K+L YIRSG+ESGA LE GG+R G KGY+IQPT+FSDVK+DM
Sbjct  345  PFKSGIEQGPQIDQDQFNKILHYIRSGQESGARLETGGERFGEKGYYIQPTVFSDVKDDM  404

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ VLKFK++DEVIKRAN T YGLAAGV+T +ID ANTL R LRAGTVWI
Sbjct  405  LIAQDEIFGPVQSVLKFKELDEVIKRANRTRYGLAAGVFTHNIDTANTLTRALRAGTVWI  464

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVTP+KNPAW+
Sbjct  465  NCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPIKNPAWL  512



>gb|KJB50198.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=492

 Score =   399 bits (1026),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEF+EKAKARA++R VGD
Sbjct  265  PFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRSVGD  324

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG+KG++IQPT+FS+VKEDM
Sbjct  325  PFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGNKGFYIQPTVFSNVKEDM  384

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDI+E I+RAN T YGLAAGV+T DID ANTL R L+ GTVWI
Sbjct  385  LIAKDEIFGPVQSILKFKDINEAIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGTVWI  444

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+PAWI
Sbjct  445  NCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI  492



>ref|XP_009115500.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=536

 Score =   401 bits (1030),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  309  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIKRAVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+L++I+ G ESGATL+ GGDR GSKGY+IQPT+FSDVK+DM
Sbjct  369  PFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKGYYIQPTVFSDVKDDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  429  LIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  489  NCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  536



>gb|KHG27537.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEF+EKAKARA++R VGD
Sbjct  304  PFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRSVGD  363

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG KG++IQPT+FS+VKEDM
Sbjct  364  PFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGDKGFYIQPTVFSNVKEDM  423

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T DID ANTL R L+ GTVWI
Sbjct  424  LIAKDEIFGPVQSILKFKDINEVIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGTVWI  483

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+PAWI
Sbjct  484  NCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI  531



>ref|XP_010503421.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RVVGD
Sbjct  310  PFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QFEKV+ YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK++M
Sbjct  370  PFKKGIEQGPQIDSKQFEKVMNYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVKDNM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D AN ++RGL+AGTVW+
Sbjct  430  LIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRGLKAGTVWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  490  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_010552639.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=533

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  306  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIKRAVGD  365

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+L+YIRSG ESGATL+ GGD++GSKGY+IQPT+FSDVK++M
Sbjct  366  PFKAGIEQGPQVDSEQFQKILKYIRSGIESGATLQAGGDQLGSKGYYIQPTVFSDVKDEM  425

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DE I+RAN + YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  426  LIANDEIFGPVQSILKFKDLDEAIRRANKSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  485

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA++PFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NPAW+
Sbjct  486  NCFDVFDASVPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLTNPAWL  533



>ref|NP_564204.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
 sp|Q8S528.2|AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B7, mitochondrial; 
Short=ALDH2b; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59643.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM44960.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE30433.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
Length=534

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  307  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  367  PFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GTVWI
Sbjct  427  LIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  487  NCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL  534



>gb|KJB50197.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=531

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEF+EKAKARA++R VGD
Sbjct  304  PFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRSVGD  363

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG+KG++IQPT+FS+VKEDM
Sbjct  364  PFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGNKGFYIQPTVFSNVKEDM  423

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDI+E I+RAN T YGLAAGV+T DID ANTL R L+ GTVWI
Sbjct  424  LIAKDEIFGPVQSILKFKDINEAIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGTVWI  483

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+PAWI
Sbjct  484  NCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI  531



>ref|XP_010316283.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=528

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R+VGD
Sbjct  301  PFIICEDADVDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRIVGD  360

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQFEK+L+YI+SG ESGATLE GG+++GSKG+++QPT+FS+V+++M
Sbjct  361  PFKKGVEQGPQIDTEQFEKILKYIKSGTESGATLESGGEKLGSKGFYVQPTVFSNVQDNM  420

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD++EVI+RAN++HYGLAAGV+T +ID ANT++R LR GTVW+
Sbjct  421  LIARDEIFGPVQSLLKFKDVEEVIRRANSSHYGLAAGVFTQNIDAANTISRALRVGTVWV  480

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+++FDA IPFGGYKMSG GREKGVYSL+NYLQVKA+VTPLKNPAW+
Sbjct  481  NCFNIFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAIVTPLKNPAWL  528



>ref|XP_004155012.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=549

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 212/229 (93%), Gaps = 1/229 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALF-FNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVG  622
            PFI+C+DA++D+AVE AHFALF    GQCCCAGSRT+VHER+++EFVEK+KARA RRVVG
Sbjct  321  PFIVCEDADVDKAVELAHFALFSIRFGQCCCAGSRTFVHERVHEEFVEKSKARAQRRVVG  380

Query  621  DPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKED  442
            DPFKKGVEQGPQIDS+QFEKVLRYI+SG ES ATLECGG R+GSKGYFI+PT+FS+VK+D
Sbjct  381  DPFKKGVEQGPQIDSDQFEKVLRYIKSGIESNATLECGGGRLGSKGYFIEPTVFSNVKDD  440

Query  441  MVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVW  262
            M+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+G++TS+ID ANTL RGLR GTVW
Sbjct  441  MLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGIFTSNIDTANTLIRGLRTGTVW  500

Query  261  INCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            +NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  501  VNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNPAWL  549



>gb|AAC98035.1| Strong similarity to gb|Y09876 aldehyde dehydrogenase (NAD+) 
from Nicotiana tabacum and a member of the aldehyde dehydrogenase 
family PF|00171. ESTs gb|F15117, gb|R83958 and gb|586262 
come from this gene [Arabidopsis thaliana]
Length=519

 Score =   399 bits (1025),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  292  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGD  351

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  352  PFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDM  411

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GTVWI
Sbjct  412  LIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWI  471

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  472  NCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL  519



>ref|XP_010914166.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=571

 Score =   400 bits (1028),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA++D AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEKAKARA++RVVGD
Sbjct  344  PMIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVVGD  403

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K++RYIRSG +SGATL+ GGDR+GSKGYFIQPTIFSDVK+ M
Sbjct  404  PFRKGVEQGPQIDEEQFNKIMRYIRSGVDSGATLQAGGDRLGSKGYFIQPTIFSDVKDGM  463

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D ANTL R LRAGTVWI
Sbjct  464  PIAQEEIFGPVQSILKFNDLNEVIQRANTTRYGLAAGVFTNNLDTANTLTRALRAGTVWI  523

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  524  NCFDVFDAAIPFGGYKMSGHGREKGIDSLKNYLQVKAVVTPLKNPAWL  571



>ref|XP_003519638.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
Length=539

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++R VGD
Sbjct  312  PFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRAVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G++IQPT+FS+VK+DM
Sbjct  372  PFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQPTVFSNVKDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ ANTL R LRAGTVW+
Sbjct  432  LIAKEEIFGPVQSILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLTRALRAGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  492  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL  539



>gb|KHN00347.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=539

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++R VGD
Sbjct  312  PFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRAVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G++IQPT+FS+VK+DM
Sbjct  372  PFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQPTVFSNVKDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ ANTL R LRAGTVW+
Sbjct  432  LIAKEEIFGPVQSILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLTRALRAGTVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  492  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL  539



>ref|XP_009600000.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=544

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA+ID+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGD
Sbjct  317  PFIICEDADIDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGD  376

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID+EQ+EK+L+YI+SG ESGATLE GGD++GSKG+++QPT+FS+V+++M
Sbjct  377  PFKKGIEQGPQIDTEQYEKILKYIKSGIESGATLESGGDKLGSKGFYVQPTVFSNVQDNM  436

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD++EVI+RAN+THYGLAAGV+T +ID ANT+ R LR GTVW+
Sbjct  437  LIAKDEIFGPVQSLLKFKDLEEVIRRANSTHYGLAAGVFTRNIDVANTITRALRVGTVWV  496

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+++FDA IPFGGY+MSG GREKGVYSLNNYLQVKAVVT LKNPAW+
Sbjct  497  NCFNIFDAAIPFGGYRMSGHGREKGVYSLNNYLQVKAVVTSLKNPAWM  544



>ref|XP_002893307.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69566.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   399 bits (1024),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  307  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  367  PFKSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GTVWI
Sbjct  427  LIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  487  NCFDVLDASIPFGGYKMSGIGREKGLYSLNNYLQVKAVVTSLKNPAWL  534



>gb|AES91175.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=544

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ ++A+ID+ VE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EK+K RA+RRVVGD
Sbjct  317  PFIVFEEADIDKVVEIAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKSKERALRRVVGD  376

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG+F+QPT+FS+V++DM
Sbjct  377  PFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKGFFVQPTVFSNVQDDM  436

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  ANTL R LRAGTVWI
Sbjct  437  LIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVSTANTLMRALRAGTVWI  496

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NPAW+
Sbjct  497  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNPAWL  544



>ref|XP_010515110.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Camelina sativa]
Length=537

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RVVGD
Sbjct  310  PFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QFEKV+ YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK++M
Sbjct  370  PFKKGIEQGPQIDSKQFEKVMNYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVKDNM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  430  LIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGTVWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  490  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_003517756.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN12100.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=538

 Score =   398 bits (1023),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++R VGD
Sbjct  311  PFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARALKRAVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G++IQPT+FS+VK+DM
Sbjct  371  PFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYIQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ ANTL R LR GTVWI
Sbjct  431  LIAKEEIFGPVQTILKFKDLDDVIQRANNTHYGLAAGVFTKNINTANTLTRALRVGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  491  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNPAWL  538



>ref|XP_006290873.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
 gb|EOA23771.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
Length=537

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RVVGD
Sbjct  310  PFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK++M
Sbjct  370  PFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVKDNM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGT+W+
Sbjct  430  LIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGTIWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  490  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>emb|CDY61548.1| BnaA09g29890D, partial [Brassica napus]
Length=555

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  328  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIKRAVGD  387

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+L++I+ G ESGATL+ GGDR GSKGY+IQPT+FSDVK+DM
Sbjct  388  PFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKGYYIQPTVFSDVKDDM  447

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  448  LIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  507

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  508  NCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  555



>ref|XP_006416054.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
 gb|ESQ34407.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
Length=541

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R VGD
Sbjct  314  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAINRTVGD  373

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+D EQF+K+L+YI+ G +SGATL+ GGD++GSKGY+IQPT+FSDVK+DM
Sbjct  374  PFKSGIEQGPQVDKEQFKKILKYIKYGVDSGATLQAGGDQLGSKGYYIQPTVFSDVKDDM  433

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEVI RAN + YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  434  LIAQDEIFGPVQTILKFKDLDEVIARANKSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  493

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  494  NCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTALKNPAWL  541



>gb|AFK40301.1| unknown [Medicago truncatula]
Length=328

 Score =   390 bits (1002),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R VGD
Sbjct  101  PFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRAVGD  160

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V++ M
Sbjct  161  PFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQDGM  220

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GTVW+
Sbjct  221  QIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDTANTLTRALKVGTVWV  280

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  281  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  328



>gb|KFK34098.1| hypothetical protein AALP_AA5G101700 [Arabis alpina]
Length=540

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RVVGD
Sbjct  313  PFIVFEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQID +QFEKV++YIRSG ES ATLECGGD+IG+KGYFIQPT+FS+VK+DM
Sbjct  373  PFKKGIEQGPQIDLKQFEKVMKYIRSGVESNATLECGGDQIGNKGYFIQPTVFSNVKDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  433  LIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGTVWV  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  493  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  540



>ref|XP_010426271.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE++YDEFVEK+KARA++RVVGD
Sbjct  310  PFIVFEDADIDKAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKSKARALKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKG+EQGPQIDS+QF+KV+ YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK++M
Sbjct  370  PFKKGIEQGPQIDSKQFKKVMNYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVKDNM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D AN ++R L+AGTVWI
Sbjct  430  LIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDTANRVSRALKAGTVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  490  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  537



>ref|XP_004238676.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=529

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++RVVGD
Sbjct  302  PFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRVVGD  361

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QF+K+++YIRSG +SGATLE GG++ G KGY+I+PT+FS+VK+DM
Sbjct  362  PFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKGYYIRPTVFSNVKDDM  421

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEV++RAN++ YGLAAGV++ +ID ANTLAR LR GTVWI
Sbjct  422  LIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDTANTLARALRVGTVWI  481

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  482  NCFDTFDATIPFGGYKMSGQGREKGEYGLKNYLQVKAVVTPLKNPAWL  529



>ref|XP_009612265.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=536

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++R VGD
Sbjct  309  PFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRTVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QF K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK+DM
Sbjct  369  PFKSGTEQGPQIDSKQFHKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVKDDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GTVW+
Sbjct  429  LIAQDEIFGPVQSILKFKDLDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGTVWV  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  489  NCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL  536



>ref|XP_006307216.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
 gb|EOA40114.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
Length=532

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGD
Sbjct  305  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAVKRAVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQF K+L+YI+ G ++GATL+ GGDR GSKGY+IQPT+FSDVK+DM
Sbjct  365  PFKSGIEQGPQIDSEQFNKILKYIKHGVDAGATLQAGGDRFGSKGYYIQPTVFSDVKDDM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D AN L R LR GTVWI
Sbjct  425  LIATDEIFGPVQTILKFKDLDEVIARANNSKYGLAAGVFTQNLDTANRLMRALRVGTVWI  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DATIPFGGYKMSGIGREKG+YSL++YLQVKAVVT LKNPAW+
Sbjct  485  NCFDVLDATIPFGGYKMSGIGREKGLYSLSHYLQVKAVVTSLKNPAWL  532



>ref|XP_010653335.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI32132.3| unnamed protein product [Vitis vinifera]
 gb|AFY12671.1| mitochondrial aldehyde dehydrogenase 2B8 [Vitis quinquangularis]
Length=538

 Score =   396 bits (1018),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DAN+D AVE AHFALFFNQGQCCCAGSRT+VHE IYDEFVEKAKARA+RR VGD
Sbjct  311  PFIVCEDANVDEAVELAHFALFFNQGQCCCAGSRTFVHESIYDEFVEKAKARALRRTVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+LRYIRSG E+GATLE GG+R G +G+FI+PT+FS+V++ M
Sbjct  371  PFKAGIEQGPQIDSDQFEKILRYIRSGVENGATLETGGERFGKEGFFIKPTVFSNVQDGM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+ EVI+RAN T YGLAAGV+T ++D ANTL R L+ GTVWI
Sbjct  431  LIAQDEIFGPVQSILKFKDLGEVIRRANATSYGLAAGVFTQNLDTANTLTRALKVGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSL NYLQVKAV+TPLKNPAW+
Sbjct  491  NCFDVFDAAIPFGGYKMSGHGREKGIYSLQNYLQVKAVITPLKNPAWL  538



>ref|XP_009759823.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=542

 Score =   396 bits (1018),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAKARA++R VGD
Sbjct  315  PFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKARALKRTVGD  374

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK+DM
Sbjct  375  PFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVKDDM  434

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GTVW+
Sbjct  435  LIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGTVWV  494

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  495  NCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL  542



>ref|XP_009110081.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=537

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSR +V ER+YDEFVEKAKARA+ R VGD
Sbjct  310  PFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRPFVQERVYDEFVEKAKARAINRAVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKGY+IQPT+FSDVK+DM
Sbjct  370  PFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQPTVFSDVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  430  LIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRALRVGSVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  490  NCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSIKNPAWL  537



>emb|CAA71003.1| aldehyde dehydrogenase (NAD+) [Nicotiana tabacum]
Length=542

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAKARA++R VGD
Sbjct  315  PFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKARALKRTVGD  374

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK+DM
Sbjct  375  PFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVKDDM  434

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GTVW+
Sbjct  435  LIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGTVWV  494

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  495  NCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL  542



>ref|XP_010251301.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=534

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEF+EKAKARAM+RVVGD
Sbjct  307  PFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHENVYDEFIEKAKARAMKRVVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID+EQ EKVL+YIR+G E GATLE GG+R G+KGYFIQPT+FS+V++ M
Sbjct  367  PFKKGVEQGPQIDAEQLEKVLKYIRAGIECGATLETGGERFGTKGYFIQPTVFSNVEDGM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA DEIFGPVQ +LKFKD+D+VI+RAN + YGLAAGV+T +I+ ANTL R LR GTVWI
Sbjct  427  PIATDEIFGPVQSILKFKDLDDVIRRANKSRYGLAAGVFTKNIETANTLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVV+PLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGQGREKGIYSLSNYLQVKAVVSPLKNPAWL  534



>ref|XP_003532011.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN10599.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE +Y+EFV+KAKARA+RRVVGD
Sbjct  309  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHENVYEEFVQKAKARALRRVVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+LRYIRSG ESGATLE GGD++G+KG++IQPT+FS+VK+ M
Sbjct  369  PFKGGIEQGPQIDSDQFEKILRYIRSGVESGATLETGGDKLGNKGFYIQPTVFSNVKDGM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+ EV++RANNT YGLAAGV+T ++D ANTL R LR GTVWI
Sbjct  429  LIAKDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTKNMDTANTLTRALRVGTVWI  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  489  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNPLKNPAWL  536



>ref|XP_002877590.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53849.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEK+KARA++RVVGD
Sbjct  310  PFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KG+EQGPQIDS+QFEKV++YIRSG ES ATLECGGD+IG KGYFIQPT+FS+VK+DM
Sbjct  370  PFRKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T  +D AN ++R L+AGTVW+
Sbjct  430  LIAQDEIFGPVQSILKFSDVDEVIKRANETRYGLAAGVFTKSLDTANRVSRALKAGTVWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQ+KAVVT L  PAWI
Sbjct  490  NCFDVFDAAIPFGGYKMSGNGREKGIYSLSNYLQIKAVVTALNKPAWI  537



>ref|XP_010044646.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW86738.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IY+EFVEKAKARA  R VGD
Sbjct  317  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESIYEEFVEKAKARATVRSVGD  376

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQF+K+LRYIRSG E GATLE GG+R G+KG++IQPT+FS+VK+DM
Sbjct  377  PFKSGIEQGPQIDSEQFQKILRYIRSGVEGGATLETGGERFGTKGHYIQPTVFSNVKDDM  436

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GTVW+
Sbjct  437  LIAKDEIFGPVQTILKFKDLKEVIQRANNSRYGLAAGVFTQNIDTANTLTRALKVGTVWV  496

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKGVYSL+NYLQVKAVVT LKNPAW+
Sbjct  497  NCFDVFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAVVTSLKNPAWL  544



>ref|XP_008781996.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Phoenix dactylifera]
Length=543

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA++D AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA++RVVGD
Sbjct  316  PMIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARALKRVVGD  375

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID +QF K+LRYI+SG +SGATL+ GGDR+GSKGYFIQPTIFSDVK+ M
Sbjct  376  PFRKGVEQGPQIDEDQFNKILRYIKSGIDSGATLQAGGDRLGSKGYFIQPTIFSDVKDGM  435

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D ANTL R LRAGTVWI
Sbjct  436  QIAQEEIFGPVQSILKFSDLNEVIRRANTTRYGLAAGVFTNNLDTANTLTRALRAGTVWI  495

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  496  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNPAWL  543



>emb|CDY47634.1| BnaC05g18900D [Brassica napus]
Length=544

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 210/236 (89%), Gaps = 8/236 (3%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQ--------GQCCCAGSRTYVHERIYDEFVEKAKAR  643
            PFI+C+DA++D+AVE AHFALFFNQ        GQCCCAGSRT+VHER+YDEFVEKAKAR
Sbjct  309  PFIVCEDADVDQAVELAHFALFFNQATSLRKTSGQCCCAGSRTFVHERVYDEFVEKAKAR  368

Query  642  AMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTI  463
            A++R VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G ESGATL+ GGDR GSKGY+IQPT+
Sbjct  369  AIKRAVGDPFKSGIEQGPQVDSEQFKKILKYIKHGVESGATLQAGGDRFGSKGYYIQPTV  428

Query  462  FSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARG  283
            FSDVK+DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D AN L R 
Sbjct  429  FSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTHNLDTANRLMRA  488

Query  282  LRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNPAW+
Sbjct  489  LRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL  544



>ref|XP_010551563.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=540

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++R VGD
Sbjct  313  PFIVCEDADVDKAVELAHLAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARAIKRAVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+LRYIRSG E+GATL+ GGD++GSKGY+IQPT+FSDVK++M
Sbjct  373  PFKAGIEQGPQVDSEQFKKILRYIRSGIENGATLQAGGDQLGSKGYYIQPTVFSDVKDEM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            VIA++EIFGPVQ +LKFKD++EVI RAN + YGLAAGV+T ++D AN L R LR G+VWI
Sbjct  433  VIAKEEIFGPVQSILKFKDLEEVIARANKSCYGLAAGVFTQNLDTANRLMRALRVGSVWI  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA +PFGGYKMSGIGREKG+YSLNNYLQVKAVVTPL NPAW+
Sbjct  493  NCFDVFDAAVPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLTNPAWL  540



>ref|NP_190383.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
 sp|Q9SU63.1|AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B4, mitochondrial; 
Short=ALDH2a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG42016.1|AF327426_1 putative (NAD+) aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAK15569.1|AF349522_1 putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAK49627.1|AF372911_1 AT3g48000/T17F15_130 [Arabidopsis thaliana]
 emb|CAB41139.1| aldehyde dehydrogenase (NAD+)-like protein [Arabidopsis thaliana]
 dbj|BAA96792.1| aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAL91287.1| AT3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AAM27003.1| aldehyde dehydrogenase ALDH2a [Arabidopsis thaliana]
 gb|AAN31892.1| putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAP21179.1| At3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AEE78355.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
Length=538

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEK+KARA++RVVGD
Sbjct  311  PFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KG+EQGPQID +QFEKV++YI+SG ES ATLECGGD+IG KGYFIQPT+FS+VK+DM
Sbjct  371  PFRKGIEQGPQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T ++D AN ++R L+AGTVW+
Sbjct  431  LIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVSRALKAGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct  491  NCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI  538



>ref|XP_010913576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA++D AVE AH ALFFNQGQCCCAGSRT+VHE++YDEFVEKAKARA++RVVGD
Sbjct  316  PMIIMDDADVDHAVELAHMALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKARALKRVVGD  375

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K++RYI+SG +SGATL+ GGDR+GSKGYFIQPTIFSDVK+ M
Sbjct  376  PFRKGVEQGPQIDEEQFNKIMRYIKSGVDSGATLQAGGDRLGSKGYFIQPTIFSDVKDGM  435

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D ANTL R LRAGTVWI
Sbjct  436  PIAQEEIFGPVQSILKFSDLNEVIQRANTTRYGLAAGVFTNNLDTANTLMRALRAGTVWI  495

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPLKNPAW+
Sbjct  496  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLKNPAWL  543



>emb|CDP00179.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D AVE AHFALFFNQGQCCCAGSRTYVHER+YDEFVEKA ARA++R VGD
Sbjct  311  PFIVCEDADVDNAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKATARALKRSVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF++ +EQGPQ+DSEQFEK+LRYIR+G +SGATLE GGDR+G KGY+I+PT+FS+V++DM
Sbjct  371  PFRQEIEQGPQVDSEQFEKILRYIRAGVDSGATLETGGDRLGEKGYYIKPTVFSNVQDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T ++D ANTL R LRAGTVWI
Sbjct  431  PIAKEEIFGPVQTILKYKDLDEVIRRANSTRYGLAAGVFTQNLDTANTLMRALRAGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  491  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  538



>ref|XP_003552014.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN39739.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   394 bits (1011),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE +YDEFVEKAKARA++RVVGD
Sbjct  309  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFVEKAKARALKRVVGD  368

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+LRYIRSG ESGATLE GGD++G+KG++IQPT+FS+VK+ M
Sbjct  369  PFKGGIEQGPQIDSDQFEKILRYIRSGVESGATLETGGDKLGNKGFYIQPTVFSNVKDGM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+ EV++RANNT YGLAAGV+T+++D A TL R LR GTVWI
Sbjct  429  LIARDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTTNMDTAYTLTRALRVGTVWI  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  489  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNPLKNPAWL  536



>ref|XP_006355977.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=529

 Score =   393 bits (1010),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ +DA+ID AVE AHFALFFNQGQCCCAGSRTYVHE++YDEF+EKAKARA++RVVGD
Sbjct  302  PFIVYEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKARALKRVVGD  361

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QF+K+++YIRSG +SGATLE GG++ G KGY+I+PT+FS+VK+DM
Sbjct  362  PFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKGYYIKPTVFSNVKDDM  421

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEV++RAN++ YGLAAGV++ +ID ANTLAR LR GTVWI
Sbjct  422  LIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDTANTLARALRVGTVWI  481

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDATIPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  482  NCFDTFDATIPFGGYKMSGQGREKGEYGLRNYLQVKAVVTPLKNPAWL  529



>ref|XP_007157468.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
 gb|ESW29462.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
Length=538

 Score =   394 bits (1011),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKA+ARA++R VGD
Sbjct  311  PFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKARARALKRAVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G+++QPT+FS+VK+DM
Sbjct  371  PFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYVQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++ IFGPVQ +LKFK++DEVI RANNTHYGLAAGV+T +I+ ANTL R L+ GTVW+
Sbjct  431  LIAKETIFGPVQSILKFKELDEVIHRANNTHYGLAAGVFTKNINTANTLTRALKVGTVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  491  NCFDVFDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTSLKNPAWL  538



>gb|KCW56066.1| hypothetical protein EUGRSUZ_I01821 [Eucalyptus grandis]
Length=423

 Score =   389 bits (1000),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RVVGD
Sbjct  196  PFIVCKDAEIDKAVELAHFALFFNQGQCCNAGSRTFVHESVYDEFVEKARARAMKRVVGD  255

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQ+D +QFEK+  YI+SG ESGATLECGG+R GSKG+FIQPT+FS+V++DM
Sbjct  256  PFKPGVEQGPQVDIKQFEKIHTYIKSGIESGATLECGGERYGSKGFFIQPTVFSNVQDDM  315

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR LRAG+VWI
Sbjct  316  LIAKDEIFGPVQTISKFKDLDEVIRRANKSPYGLAAGVFTQNIDTANTLARALRAGSVWI  375

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY V DA IPFGGYKMSGIGREKGVYSL+NYLQVKAVV PLKNPAW+
Sbjct  376  NCYHVVDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVNPLKNPAWL  423



>gb|AAL99612.1|AF348416_1 mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana]
Length=534

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = -3

Query  789  ICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFK  610
            +C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGDPFK
Sbjct  310  VCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGDPFK  369

Query  609  KGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIA  430
             G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM+IA
Sbjct  370  SGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDMLIA  429

Query  429  QDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCY  250
             DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GTVWINC+
Sbjct  430  TDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWINCF  489

Query  249  DVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  490  DVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL  534



>gb|KCW86739.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IY+EFVEKAKARA  R VGD
Sbjct  317  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESIYEEFVEKAKARATVRSVGD  376

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ++SEQF+K+LRYIRSG E GATLE GG+R G+KG++IQPT+FS+VK+DM
Sbjct  377  PFKSGIEQGPQVNSEQFQKILRYIRSGVEGGATLETGGERFGTKGHYIQPTVFSNVKDDM  436

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GTVW+
Sbjct  437  LIAKDEIFGPVQTILKFKDLKEVIQRANNSRYGLAAGVFTQNIDTANTLTRALKVGTVWV  496

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKGVYSL+NYLQVKAVVT LKNPAW+
Sbjct  497  NCFDVFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAVVTSLKNPAWL  544



>gb|AAL77005.1| aldehyde dehydrogenase [Allium cepa]
Length=230

 Score =   381 bits (979),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA+ID+AVE AHFALFFNQGQCCCA S T+VHE+IYDEFVEKAKARAMRRVVGD
Sbjct  3    PMIILDDADIDQAVELAHFALFFNQGQCCCACSPTFVHEKIYDEFVEKAKARAMRRVVGD  62

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQF K+LRYI+ G + GA+L  GG+RIGSKGY+IQPTIFSDVK+DM
Sbjct  63   PFKKGVEQGPQIDDEQFNKILRYIKLGVDGGASLVTGGERIGSKGYYIQPTIFSDVKDDM  122

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            VIA++EIFGPVQ +LKF D++EVI+RAN + YGLAAGV+TS+IDKANTL R LR GTVW+
Sbjct  123  VIAKEEIFGPVQSILKFNDLNEVIRRANASRYGLAAGVFTSNIDKANTLTRALRVGTVWV  182

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL  YLQ KAVVTPLKNPAW+
Sbjct  183  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKGYLQTKAVVTPLKNPAWL  230



>ref|XP_007153639.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
 gb|ESW25633.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
Length=535

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA++RVVGD
Sbjct  308  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARALKRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQFEK+LRY+R G ESGATLE GGDR+G KGY+IQPT+FS+VK+DM
Sbjct  368  PFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKGYYIQPTVFSNVKDDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA DEIFGPVQ +LKFKD+ EV++RANN+ YGLAAGV+T +ID AN L R LR GTVWI
Sbjct  428  RIATDEIFGPVQSILKFKDLGEVVQRANNSRYGLAAGVFTKNIDTANILTRALRVGTVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV  LKNPAW+
Sbjct  488  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNPAWL  535



>gb|AGV54428.1| mitochondrial aldehyde dehydrogenase [Phaseolus vulgaris]
Length=535

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCCCAGSRTYVHE +YDEFVEKAKARA++RVVGD
Sbjct  308  PFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARALKRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDSEQFEK+LRY+R G ESGATLE GGDR+G KGY+IQPT+FS+VK+DM
Sbjct  368  PFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKGYYIQPTVFSNVKDDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA DEIFGPVQ +LKFKD+ EV++RANN+ YGLAAGV+T +ID AN L R LR GTVWI
Sbjct  428  RIATDEIFGPVQSILKFKDLGEVVQRANNSQYGLAAGVFTKNIDTANILTRALRVGTVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV  LKNPAW+
Sbjct  488  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNPAWL  535



>ref|XP_007031425.1| Aldehyde dehydrogenase 2B7 isoform 3 [Theobroma cacao]
 gb|EOY02351.1| Aldehyde dehydrogenase 2B7 isoform 3 [Theobroma cacao]
Length=414

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RVVGD
Sbjct  187  PFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRVVGD  246

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KG+EQGPQID EQF+K+L+YIRSG ESGATLE GG+++GS+GY+IQPT+FS+V++DM
Sbjct  247  PFQKGIEQGPQIDDEQFKKILKYIRSGIESGATLESGGEQLGSRGYYIQPTVFSNVQDDM  306

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD+DEVI+RAN T YGLAAGV+T +++ ANTL R LRAGTVWI
Sbjct  307  LIAKDEIFGPVQSISKFKDLDEVIQRANATSYGLAAGVFTQNLETANTLTRALRAGTVWI  366

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA IPFGG+KMSG GREKG+Y L++YLQVKAVVTPLK+PAW+
Sbjct  367  NCYDIFDAAIPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKHPAWL  414



>ref|XP_007036177.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
 gb|EOY20678.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
Length=567

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA+RRVVGD
Sbjct  313  PFIVCEDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAKARALRRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDSEQFEKVLRYIRSG ES ATLECGGDR+G KGYFIQPT+FS+V +DM
Sbjct  373  PFKKGVEQGPQIDSEQFEKVLRYIRSGIESNATLECGGDRLGKKGYFIQPTVFSNVTDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T +ID ANTL R LRAGTVW+
Sbjct  433  LIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDTANTLTRALRAGTVWV  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQV  154
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQ+
Sbjct  493  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQI  527



>gb|EYU22484.1| hypothetical protein MIMGU_mgv1a004342mg [Erythranthe guttata]
Length=532

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEKAK RA++R VGD
Sbjct  305  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKAKERALKRAVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID EQF+K+L+YI+SG ESGATLE GGDR G+KGY+IQPT+FS+VK+DM
Sbjct  365  PFKAGMEQGPQIDGEQFKKILKYIKSGVESGATLEAGGDRFGTKGYYIQPTVFSNVKDDM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ VLKFK++ EVI+RANN+ +GLAAGV+T ++D ANTL R LRAGTVWI
Sbjct  425  LIAKDEIFGPVQTVLKFKELGEVIRRANNSPFGLAAGVFTQNLDTANTLTRALRAGTVWI  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LK+PAW+
Sbjct  485  NCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKDPAWL  532



>ref|XP_010271955.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Nelumbo nucifera]
Length=534

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA+RRVVGD
Sbjct  307  PFIVCEDADIDSAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALRRVVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID++QF K+L YIRSG E+GATLE GG+R+GSKGYFI+PT+FS+V+++M
Sbjct  367  PFEKGVEQGPQIDADQFVKILNYIRSGTENGATLETGGERLGSKGYFIRPTVFSNVEDNM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKDI+EVI+R+N + +GLAAGV+T++++ ANTL R LR GTVWI
Sbjct  427  LIATDEIFGPVQSILKFKDINEVIRRSNKSRFGLAAGVFTNNLETANTLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVV+PLKN AW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGNGREKGIYSLDNYLQVKAVVSPLKNAAWL  534



>ref|XP_011463376.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=531

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA +RVVGD
Sbjct  304  PFIVCEDADVDKAVEMAHLALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAEKRVVGD  363

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YI  G + GATLE GG++ GSKGY+I+PT+FS+VK+DM
Sbjct  364  PFKGGTEQGPQIDSDQFEKILKYIDYGIKGGATLETGGEQFGSKGYYIKPTVFSNVKDDM  423

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ VLK+K++DEVIKRANNT YGLAAGV+T +ID ANTL R LR GTVWI
Sbjct  424  QIAKDEIFGPVQMVLKYKELDEVIKRANNTRYGLAAGVFTQNIDTANTLTRALRVGTVWI  483

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIP GGYKMSGIGREKG+Y L NYLQVKAVVTPLKNPAW+
Sbjct  484  NCFDVFDATIPIGGYKMSGIGREKGIYGLQNYLQVKAVVTPLKNPAWL  531



>ref|XP_010477682.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA+ R VGD
Sbjct  307  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIHRSVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  367  PFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQTGGDRLGSKGYYIQPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D AN L R LR GTVWI
Sbjct  427  LIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DATIPFGGYKMSG GREK +YSL++YLQVKAVVT LKNPAW+
Sbjct  487  NCFDVLDATIPFGGYKMSGTGREKSLYSLSHYLQVKAVVTSLKNPAWL  534



>ref|XP_004297641.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=535

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA +RVVGD
Sbjct  308  PFIVCEDADVDKAVEMAHLALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAEKRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YI  G + GATLE GG++ GSKGY+I+PT+FS+VK+DM
Sbjct  368  PFKGGTEQGPQIDSDQFEKILKYIDYGIKGGATLETGGEQFGSKGYYIKPTVFSNVKDDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ VLK+K++DEVIKRANNT YGLAAGV+T +ID ANTL R LR GTVWI
Sbjct  428  QIAKDEIFGPVQMVLKYKELDEVIKRANNTRYGLAAGVFTQNIDTANTLTRALRVGTVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIP GGYKMSGIGREKG+Y L NYLQVKAVVTPLKNPAW+
Sbjct  488  NCFDVFDATIPIGGYKMSGIGREKGIYGLQNYLQVKAVVTPLKNPAWL  535



>ref|XP_004297642.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=535

 Score =   391 bits (1005),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKA ARA +RVVGD
Sbjct  308  PFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKATARAEKRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+L+YI  G + GATLE GG+R GSKGY+I+PT+FS+VK+DM
Sbjct  368  PFKGGIEQGPQIDSDQFEKILKYIDYGIKGGATLETGGERFGSKGYYIKPTVFSNVKDDM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ VLK+K++DEVIKRANN+ YGLAAGV+T +ID ANTL R LR G+VWI
Sbjct  428  QIAKDEIFGPVQTVLKYKELDEVIKRANNSRYGLAAGVFTQNIDTANTLTRALRVGSVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA+IPFGGYKMSG GREKG+Y L NYLQVKAVVTPLKNPAW+
Sbjct  488  NCFDVFDASIPFGGYKMSGNGREKGIYGLQNYLQVKAVVTPLKNPAWL  535



>ref|XP_010100483.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB82617.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=537

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII  DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE IYDEFV KA ARA++R VGD
Sbjct  310  PFIIAADADVDQAVELAHFALFFNQGQCCCAGSRTFVHESIYDEFVSKATARAIKRTVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID EQF+KVL YI+SG ESGATLE GG+RIGS GYF++PT+FS+V +DM
Sbjct  370  PFKAGIEQGPQIDPEQFDKVLSYIKSGNESGATLETGGNRIGSTGYFVEPTVFSNVTDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T +ID ANTL R LR GTVW+
Sbjct  430  KIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDTANTLTRALRVGTVWV  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV PLKNPAW+
Sbjct  490  NCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVEPLKNPAWL  537



>dbj|BAB92019.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=547

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGD
Sbjct  320  PFIIMDDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGD  379

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K+LRYIRSG +SGA L  GGDR+G KGY+IQPTIFSDV++ M
Sbjct  380  PFRKGVEQGPQIDDEQFNKILRYIRSGVDSGANLVTGGDRLGEKGYYIQPTIFSDVQDGM  439

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGTVWI
Sbjct  440  KIAQEEIFGPVQSILKFKDLNEVIKRANASPYGLAAGVFTNSLDTANTLTRALRAGTVWI  499

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  500  NCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  547



>ref|XP_008221788.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Prunus mume]
Length=534

 Score =   391 bits (1004),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFN GQCCC+GSRT+VHER+YDEF+EKAKARA +R+VGD
Sbjct  307  PFIVCEDADVDKAVELAHFALFFNMGQCCCSGSRTFVHERVYDEFIEKAKARAEKRIVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQIDS+QFEK+LRYI  G +SGATLE GG R+G+KG++I+PT+FS+VK+DM
Sbjct  367  PFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKGFYIKPTVFSNVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQDEIFGPVQ +LK+KD+DEVI+RAN T YGLAAGV+T +ID ANTL R LR G+VWI
Sbjct  427  PIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDTANTLTRALRVGSVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+Y L+NYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_010477684.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   390 bits (1003),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -3

Query  795  FIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDP  616
            FI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFV KAKARA+ R VGDP
Sbjct  308  FIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVAKAKARAVNRSVGDP  367

Query  615  FKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMV  436
            FK G+EQGPQ+DSEQF K+L+YI+ G ESGATL+ GGDR+GSKGY+IQPT+FSDVK+DM+
Sbjct  368  FKSGIEQGPQVDSEQFNKILKYIKHGVESGATLQAGGDRLGSKGYYIQPTVFSDVKDDML  427

Query  435  IAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWIN  256
            IA DEIFGPVQ +LKFKD+DEVI RAN + YGLAAGV+T ++D AN L R LR GTVWIN
Sbjct  428  IATDEIFGPVQTILKFKDLDEVIARANKSMYGLAAGVFTQNLDTANRLMRALRVGTVWIN  487

Query  255  CYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            C+D+FDATIPFGGYKMSGIGREK +YSL++YLQVKAVVT LKNPAW+
Sbjct  488  CFDLFDATIPFGGYKMSGIGREKSLYSLSHYLQVKAVVTSLKNPAWL  534



>ref|XP_010029206.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RVVGD
Sbjct  305  PFIVCKDAEIDKAVELAHFALFFNQGQCCNAGSRTFVHESVYDEFVEKARARAMKRVVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQ+D +QFEK+  YI+SG ESGATLECGG+R GSKG+FIQPT+FS+V++DM
Sbjct  365  PFKPGVEQGPQVDIKQFEKIHTYIKSGIESGATLECGGERYGSKGFFIQPTVFSNVQDDM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR LRAG+VWI
Sbjct  425  LIAKDEIFGPVQTISKFKDLDEVIRRANKSPYGLAAGVFTQNIDTANTLARALRAGSVWI  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY V DA IPFGGYKMSGIGREKGVYSL+NYLQVKAVV PLKNPAW+
Sbjct  485  NCYHVVDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVNPLKNPAWL  532



>gb|KEH19981.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=509

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R VGD
Sbjct  282  PFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRAVGD  341

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V++ M
Sbjct  342  PFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQDGM  401

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GTVW+
Sbjct  402  QIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDTANTLTRALKVGTVWV  461

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  462  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  509



>emb|CBI32134.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DAN+D AVE AHF+LFFNQGQCCCAGS TYVHERIYDEFVEKAKARA++RVVGD
Sbjct  344  PFIVCEDANVDEAVELAHFSLFFNQGQCCCAGSHTYVHERIYDEFVEKAKARALKRVVGD  403

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDSE+FEK+LRYIRSG ++GATLE GG+R G+ GYFI+PT+FS+V++DM
Sbjct  404  PFKAGTEQGPQIDSEKFEKILRYIRSGVDNGATLETGGERFGTGGYFIKPTVFSNVQDDM  463

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            + AQDEIFGPVQ +LKFKD+DEVI+RAN ++ GLAAGV+T +ID ANTL R LR GTVWI
Sbjct  464  LKAQDEIFGPVQSILKFKDLDEVIRRANASNCGLAAGVFTQNIDTANTLTRALRVGTVWI  523

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+Y L NYLQVKAVV+PLKNPAW+
Sbjct  524  NCFDVFDAAIPFGGYKMSGNGREKGIYCLQNYLQVKAVVSPLKNPAWL  571


 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DAN+D AVE AHFALFFNQGQCC +GSRT+VHE +YDEFVEKAKARA+RR VGD
Sbjct  39   PFIVCEDANVDEAVEMAHFALFFNQGQCCASGSRTFVHESVYDEFVEKAKARALRRTVGD  98

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKED  442
            PFK G+EQGPQIDS+QFEK++RYIRSG ESGATLE GG+R G +   +    F+D+ ED
Sbjct  99   PFKAGIEQGPQIDSKQFEKIMRYIRSGVESGATLESGGERFGKERSRVMWR-FADLLED  156



>gb|KEH19980.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=541

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R VGD
Sbjct  314  PFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRAVGD  373

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V++ M
Sbjct  374  PFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQDGM  433

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID ANTL R L+ GTVW+
Sbjct  434  QIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDTANTLTRALKVGTVWV  493

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct  494  NCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL  541



>ref|XP_006844236.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
 gb|ERN05911.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
Length=501

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFIIC+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHERIYDEF+EKAKARAM+RVVGD
Sbjct  274  PFIICEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFLEKAKARAMKRVVGD  333

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID EQF K++ YI+SG +SGATLE GG+RIG+KGY+IQPTIFS+ K+ M
Sbjct  334  PFKKGVEQGPQIDLEQFNKIMGYIKSGVDSGATLELGGERIGTKGYYIQPTIFSNTKDSM  393

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA DEIFGPVQ V KFKD++EVI+RAN + YGLAAGV+T +ID ANTL+R LR GTVW+
Sbjct  394  PIATDEIFGPVQTVFKFKDLNEVIQRANASRYGLAAGVFTKNIDTANTLSRALRVGTVWV  453

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG+GREKG+ SL+NYLQVKAVV  L+NPAW+
Sbjct  454  NCFDVFDAAIPFGGYKMSGVGREKGIQSLSNYLQVKAVVQHLRNPAWL  501



>dbj|BAB62757.1| mitochondrial aldehyde dehydrogenase ALDH2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ90704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  322  PFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV++DM
Sbjct  382  PFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQDDM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT+W+
Sbjct  442  KIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGTIWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  502  NCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  549



>ref|XP_007031423.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
 gb|EOY02349.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
Length=511

 Score =   389 bits (998),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RVVGD
Sbjct  284  PFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRVVGD  343

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KG+EQGPQID EQF+K+L+YIRSG ESGATLE GG+++GS+GY+IQPT+FS+V++DM
Sbjct  344  PFQKGIEQGPQIDDEQFKKILKYIRSGIESGATLESGGEQLGSRGYYIQPTVFSNVQDDM  403

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD+DEVI+RAN T YGLAAGV+T +++ ANTL R LRAGTVWI
Sbjct  404  LIAKDEIFGPVQSISKFKDLDEVIQRANATSYGLAAGVFTQNLETANTLTRALRAGTVWI  463

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA IPFGG+KMSG GREKG+Y L++YLQVKAVVTPLK+PAW+
Sbjct  464  NCYDIFDAAIPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKHPAWL  511



>ref|XP_007221800.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
 gb|EMJ22999.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
Length=534

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFN GQCCC+GSRT+VHER+YDEF+EKA+ARA +R+VGD
Sbjct  307  PFIVCEDADVDKAVELAHFALFFNMGQCCCSGSRTFVHERVYDEFIEKARARAEKRIVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQIDS+QFEK+LRYI  G +SGATLE GG R+G+KG++I+PT+FS+VK+DM
Sbjct  367  PFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKGFYIKPTVFSNVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQDEIFGPVQ +LK+KD+DEVI+RAN T YGLAAGV+T +ID ANTL R LR G+VWI
Sbjct  427  PIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDTANTLTRALRVGSVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+Y L+NYLQVKA+VTPLKNPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAIVTPLKNPAWL  534



>gb|AFK40600.1| unknown [Medicago truncatula]
Length=392

 Score =   384 bits (986),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+++EFVEKAKARA++R VGD
Sbjct  165  PFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVHEEFVEKAKARALKRAVGD  224

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKGY+IQPT+FS+V++ M
Sbjct  225  PFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKGYYIQPTVFSNVQDGM  284

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKFKD+ EVI+RANN+ YG AAGV+  +ID ANTL R L+ GTVW+
Sbjct  285  QIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGFAAGVFPKNIDTANTLTRALKVGTVWV  344

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSG GRE+G YSL NYLQVKAVVTPLKNPAW+
Sbjct  345  NCFDTFDAAIPFGGYKMSGQGRERGEYSLKNYLQVKAVVTPLKNPAWL  392



>ref|XP_006356663.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=537

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IYDEFVEKAKARA++R VGD
Sbjct  310  PFIVCEDADVDQAVEFAHFALFFNQGQCCCAGSRTYVHESIYDEFVEKAKARALKRTVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ G EQGPQI SEQFEKVL+YIRSG ESGATLE GGDR+G++GY+I+PT+FS+VK+DM
Sbjct  370  PFESGNEQGPQISSEQFEKVLKYIRSGIESGATLETGGDRLGTRGYYIKPTVFSNVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD DEVI+RAN T YGLAAGV+T +ID ANT  R LR GT+WI
Sbjct  430  LIATDEIFGPVQSILKFKDHDEVIRRANATKYGLAAGVFTKNIDTANTFMRALRVGTIWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSG GREKG YSL  YLQVKAVVT LKNPAW+
Sbjct  490  NCFDIFDAAIPFGGYKMSGQGREKGEYSLKQYLQVKAVVTSLKNPAWL  537



>gb|KJB11464.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=414

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RVVGD
Sbjct  187  PFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRVVGD  246

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V++DM
Sbjct  247  PFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQDDM  306

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GTVWI
Sbjct  307  LIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGTVWI  366

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  367  NCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  414



>gb|KJB11463.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=423

 Score =   384 bits (987),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RVVGD
Sbjct  196  PFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRVVGD  255

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V++DM
Sbjct  256  PFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQDDM  315

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GTVWI
Sbjct  316  LIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGTVWI  375

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  376  NCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  423



>ref|NP_001105891.1| mitochondrial aldehyde dehydrogenase 2 [Zea mays]
 gb|AAG43988.1|AF215823_1 T cytoplasm male sterility restorer factor 2 [Zea mays]
 gb|AAC49371.1| RF2 [Zea mays]
 gb|ACG38026.1| aldehyde dehydrogenase [Zea mays]
 gb|ACN28554.1| unknown [Zea mays]
 gb|AFW86312.1| restorer of fertility2 [Zea mays]
Length=549

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGD
Sbjct  322  PFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV++ M
Sbjct  382  PFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQDGM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGTVW+
Sbjct  442  KIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  502  NCFDVFDAAIPFGGYKMSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>ref|XP_010265814.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=539

 Score =   388 bits (997),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEF+EK+KARAMRR+VGD
Sbjct  312  PFIVCEDADIDKAVELAHSAVFFNQGQCCCAGSRTFVHERVYDEFIEKSKARAMRRIVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID  QFEK+L  IRSG ESGATLE GG+R G+KGYFIQPT+FSDV++DM
Sbjct  372  PFKKGVEQGPQIDKAQFEKILSCIRSGIESGATLETGGERFGTKGYFIQPTVFSDVQDDM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA +EIFGPVQ +LKFKD+D+VI+RAN + YGLAAGV+T++I+ ANTL R LR GTVWI
Sbjct  432  AIATEEIFGPVQSILKFKDLDDVIQRANKSRYGLAAGVFTNNIETANTLMRSLRVGTVWI  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY VFDA IPFGGYKMSG GREKG Y LNNYLQVKAVV+PLKNPAW+
Sbjct  492  NCYFVFDAAIPFGGYKMSGKGREKGAYCLNNYLQVKAVVSPLKNPAWL  539



>gb|EMS51754.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Triticum 
urartu]
Length=550

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  323  PFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  382

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV++ M
Sbjct  383  PFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQDGM  442

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGTVW+
Sbjct  443  KIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGTVWV  502

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  503  NCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  550



>ref|XP_011071082.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Sesamum indicum]
Length=525

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFV KAK RAM+R VGD
Sbjct  298  PFIVCEDADVDKAVEVAHFALFFNQGQCCCAGSRTFVHEKVYDEFVAKAKERAMKRSVGD  357

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID+EQF K+L+YI+ GKE GATLE GGDR G+KGY+IQPT+FS+V++DM
Sbjct  358  PFKTGMEQGPQIDAEQFNKILKYIKYGKECGATLETGGDRFGTKGYYIQPTVFSNVQDDM  417

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ VLKFKD +EVI+RANN+ YGLAAG++T D+D ANTL R LR GTVW+
Sbjct  418  PIAKDEIFGPVQTVLKFKDNEEVIRRANNSPYGLAAGIFTQDLDTANTLTRALRVGTVWV  477

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNPAW+
Sbjct  478  NCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTSLKNPAWL  525



>gb|EMT04899.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=549

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  322  PFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV++ M
Sbjct  382  PFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQDGM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGTVW+
Sbjct  442  KIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  502  NCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  549



>ref|XP_002301540.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE80813.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
Length=540

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE +H A+FFNQGQCCCAGSRT+VHER+YDEFVEKAKARA +R VGD
Sbjct  313  PFIVCEDADVDQAVELSHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARANQRAVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK+G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ GY+IQPT+FSDV++DM
Sbjct  373  PFKEGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ + KFKD+DEVI+R+NN+ YGLAAG++T ++D ANTL+R L+ GTVWI
Sbjct  433  LIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDTANTLSRALKVGTVWI  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct  493  NCYDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTSLKNPAWL  540



>dbj|BAB92017.1| mitochondrial aldehyde dehydrogenase [Secale cereale]
Length=549

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  322  PFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV++ M
Sbjct  382  PFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQDGM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT+W+
Sbjct  442  KIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGTIWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  502  NCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL  549



>gb|ABK24267.1| unknown [Picea sitchensis]
Length=544

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE I+DEFVEKAKAR + RVVGD
Sbjct  317  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHESIHDEFVEKAKARCLSRVVGD  376

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K+LRYI++GKESGA L  GGD+IG+KG++I PTIFS+V++DM
Sbjct  377  PFRKGVEQGPQIDQEQFNKILRYIKAGKESGAKLVTGGDQIGTKGFYIMPTIFSEVQDDM  436

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA DEIFGPVQ ++KFK +DEVIKRAN + YGLAAGV+T +I+ ANTL R LR GTVW+
Sbjct  437  AIATDEIFGPVQSIIKFKTLDEVIKRANASRYGLAAGVFTQNIETANTLTRALRVGTVWV  496

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSG GREKG+YSL NYLQVKAVVTPLKNPAW+
Sbjct  497  NCFDIFDAGIPFGGYKMSGTGREKGIYSLQNYLQVKAVVTPLKNPAWL  544



>gb|AHM26656.1| aldehyde dehydrogenase 2-1 [Zea mays subsp. mays]
Length=549

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGD
Sbjct  322  PFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV++ M
Sbjct  382  PFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQDGM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGTVW+
Sbjct  442  KIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGY+MSGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  502  NCFDVFDAAIPFGGYRMSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>ref|XP_003542700.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Glycine max]
Length=540

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D AVE +HFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARA++RVVGD
Sbjct  313  PFIVCKDADVDAAVEASHFALFFNQGQCCCAGSRTFVHESIYGEFVEKAKARALKRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKGY+IQPT+FS+V+++M
Sbjct  373  PFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKGYYIQPTVFSNVQDNM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D ANTL R L+AGTVWI
Sbjct  433  LIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDTANTLMRALQAGTVWI  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  493  NCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  540



>ref|XP_006594290.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Glycine max]
Length=537

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D AVE +HFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARA++RVVGD
Sbjct  310  PFIVCKDADVDAAVEASHFALFFNQGQCCCAGSRTFVHESIYGEFVEKAKARALKRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKGY+IQPT+FS+V+++M
Sbjct  370  PFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKGYYIQPTVFSNVQDNM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D ANTL R L+AGTVWI
Sbjct  430  LIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDTANTLMRALQAGTVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  490  NCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  537



>ref|XP_004245256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=534

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRTYVHE IYDEFVEKAKARA++R VGD
Sbjct  307  PFIVCEDADVDQAVEFAHFALFFNQGQCCCAGSRTYVHESIYDEFVEKAKARALKRTVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQI SEQFEKVL+YIRSG ESGATLE GGDR+G++GY+I+PT+FS+VK+DM
Sbjct  367  PFDSSNEQGPQISSEQFEKVLKYIRSGIESGATLETGGDRLGTQGYYIKPTVFSNVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD DEVI+RAN T YGLAAGV+T +ID ANT  R LR GT+WI
Sbjct  427  LIATDEIFGPVQSILKFKDHDEVIRRANATKYGLAAGVFTKNIDTANTFMRALRVGTIWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSG GREKG YSL  YLQVKAVVT LKNPAW+
Sbjct  487  NCFDIFDAAIPFGGYKMSGQGREKGEYSLKQYLQVKAVVTSLKNPAWL  534



>ref|XP_010029207.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   385 bits (990),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RVVGD
Sbjct  305  PFIVCEDADIDKAVELAHFALFFNQGQCCVAGSRTFVHESVYDEFVEKARARAMKRVVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID +QFEK+  YI+SG ESGATLECGG++ GSKG+F+QPT+FS+V+++M
Sbjct  365  PFKPGVEQGPQIDIKQFEKIRTYIKSGIESGATLECGGEQYGSKGFFVQPTVFSNVQDNM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR L+AG+V I
Sbjct  425  LIAKDEIFGPVQTISKFKDLDEVIRRANKSRYGLAAGVFTQNIDTANTLARALQAGSVCI  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY VFDA IPFGGYKMSGIGREKGVY LNNYLQVKAVV PLKNPAW+
Sbjct  485  NCYHVFDAAIPFGGYKMSGIGREKGVYGLNNYLQVKAVVNPLKNPAWL  532



>gb|KCW56067.1| hypothetical protein EUGRSUZ_I01824, partial [Eucalyptus grandis]
Length=511

 Score =   385 bits (988),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA+ID+AVE AHFALFFNQGQCC AGSRT+VHE +YDEFVEKA+ARAM+RVVGD
Sbjct  284  PFIVCEDADIDKAVELAHFALFFNQGQCCVAGSRTFVHESVYDEFVEKARARAMKRVVGD  343

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID +QFEK+  YI+SG ESGATLECGG++ GSKG+F+QPT+FS+V+++M
Sbjct  344  PFKPGVEQGPQIDIKQFEKIRTYIKSGIESGATLECGGEQYGSKGFFVQPTVFSNVQDNM  403

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID ANTLAR L+AG+V I
Sbjct  404  LIAKDEIFGPVQTISKFKDLDEVIRRANKSRYGLAAGVFTQNIDTANTLARALQAGSVCI  463

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY VFDA IPFGGYKMSGIGREKGVY LNNYLQVKAVV PLKNPAW+
Sbjct  464  NCYHVFDAAIPFGGYKMSGIGREKGVYGLNNYLQVKAVVNPLKNPAWL  511



>ref|XP_006656871.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=549

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARAM+RVVGD
Sbjct  322  PFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARAMKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID +QF K+LRYI+ G ESGA L  GGDR+G KGY+IQPTIFSDVK++M
Sbjct  382  PFKNGVEQGPQIDDDQFNKILRYIKYGVESGANLVTGGDRLGDKGYYIQPTIFSDVKDNM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GTVW+
Sbjct  442  KIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTPLKN AW+
Sbjct  502  NCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPLKNAAWL  549



>gb|KDO82491.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=328

 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RVVGD
Sbjct  101  PFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRVVGD  160

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK+DM
Sbjct  161  PFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDM  220

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+VWI
Sbjct  221  LIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWI  280

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  281  NCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  328



>ref|XP_008389628.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Malus domestica]
Length=534

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAK RA RR+VGD
Sbjct  307  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKGRAERRLVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+L+YI  G ++GA LE GG+R+G+KG++I+PT+FSDVK+DM
Sbjct  367  PFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID ANTL R LR G+V+I
Sbjct  427  RIASEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGSVFI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA+IPFGGYKMSGIGREKG+Y L+NYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_004965205.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Setaria italica]
Length=549

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PF+I DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEK+KARA++RVVGD
Sbjct  322  PFVIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKSKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K+LRYIRSG +SGATL  GGDR+G KG++IQPTIFSDV++ M
Sbjct  382  PFRKGVEQGPQIDDEQFNKILRYIRSGVDSGATLVTGGDRLGDKGFYIQPTIFSDVQDGM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVI+RAN + YGLAAGV+T  +D ANTL R LR GTVW+
Sbjct  442  KIAQEEIFGPVQSILKFKDLNEVIERANASQYGLAAGVFTKSLDTANTLTRALRVGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  502  NCFDVFDAGIPFGGYKQSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>gb|AAK58370.1|AF269064_1 T-cytoplasm male sterility restorer factor 2 [Zea mays]
Length=549

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -3

Query  795  FIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDP  616
            FII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGDP
Sbjct  323  FIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGDP  382

Query  615  FKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMV  436
            F+KGVEQGPQID EQF+K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV++ M 
Sbjct  383  FRKGVEQGPQIDDEQFKKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQDGMK  442

Query  435  IAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWIN  256
            IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGTVW+N
Sbjct  443  IAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGTVWVN  502

Query  255  CYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            C+DVFDA IPFGGYKMSG+GREKGV SL NYLQVKAVVTP+KN AW+
Sbjct  503  CFDVFDAAIPFGGYKMSGMGREKGVDSLKNYLQVKAVVTPIKNAAWL  549



>gb|KHG06517.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RVVGD
Sbjct  304  PFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRVVGD  363

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V++DM
Sbjct  364  PFKMGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQDDM  423

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GTVWI
Sbjct  424  LIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGTVWI  483

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  484  NCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  531



>gb|KJB11461.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=530

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AH ALFFNQGQCCCAGSRT VHE +YDEFVEKAKARA++RVVGD
Sbjct  303  PFIVCKDADVDKAVELAHSALFFNQGQCCCAGSRTLVHESVYDEFVEKAKARALKRVVGD  362

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKGY+IQPT+FS+V++DM
Sbjct  363  PFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKGYYIQPTVFSNVQDDM  422

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ ANTL R LR GTVWI
Sbjct  423  LIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIETANTLTRALRVGTVWI  482

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNPAW+
Sbjct  483  NCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNPAWL  530



>ref|XP_010498885.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA  R VGD
Sbjct  307  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAANRAVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  367  PFKSGIEQGPQVDSEQFKKILKYIKHGVEAGATLQTGGDRLGSKGYYIQPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D AN L R LR GTVWI
Sbjct  427  LIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DATIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNPAW+
Sbjct  487  NCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNPAWL  534



>dbj|BAB92018.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=551

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PF++ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  324  PFVVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  383

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID +QF K+LRY++SG +SGATL  GGDR+GS+G++IQPT+F+D K+DM
Sbjct  384  PFRNGVEQGPQIDGDQFNKILRYVQSGVDSGATLVTGGDRVGSRGFYIQPTVFADAKDDM  443

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN THYGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  444  KIAREEIFGPVQTILKFSGMEEVIRRANATHYGLAAGVFTRSLDAANTLSRALRAGTVWV  503

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDATIPFGGYKMSG+GREKGVY+L NYLQ KAVVTP+K+PAW+
Sbjct  504  NCYDVFDATIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIKDPAWL  551



>ref|XP_003563967.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Brachypodium distachyon]
Length=548

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  321  PFIIMDDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  380

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQID EQF K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV++ M
Sbjct  381  PFRKGVEQGPQIDDEQFNKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQDGM  440

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++  ANTL R LRAGTVW+
Sbjct  441  KIAQEEIFGPVQSIFKFNDLNEVIKRANASRYGLAAGVFTNNLGTANTLTRALRAGTVWV  500

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQ KAVVTP+KN AW+
Sbjct  501  NCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQTKAVVTPIKNAAWL  548



>ref|XP_004509835.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=538

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHE +YDEFVEKAKARA++R VGD
Sbjct  311  PFIVCEDADVDQAVELAHSALFFNQGQCCCAGSRTFVHESVYDEFVEKAKARALKRAVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YI+SG E+GATLE GG+R+GSKG++IQPT+FS+V++D 
Sbjct  371  PFKSGTEQGPQIDSKQFEKILKYIKSGVENGATLETGGERLGSKGFYIQPTVFSNVQDDH  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ +LKFKD+ EVI+RANNT YGLAAG++T +ID ANTL R L+ G+VW+
Sbjct  431  LIAKEEIFGPVQSILKFKDLGEVIQRANNTEYGLAAGIFTKNIDTANTLTRALKVGSVWV  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+ DA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  491  NCFDILDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVIPLKNPAWL  538



>gb|KDO82489.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82490.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=378

 Score =   377 bits (967),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RVVGD
Sbjct  151  PFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRVVGD  210

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK+DM
Sbjct  211  PFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDM  270

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+VWI
Sbjct  271  LIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWI  330

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  331  NCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  378



>ref|XP_004509834.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=539

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AH ALFFNQGQCCCAGSRT+VHE +YDEFVEKAKARA++R VGD
Sbjct  312  PFIVCEDADVDQAVELAHSALFFNQGQCCCAGSRTFVHESVYDEFVEKAKARALKRAVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G EQGPQIDS+QFEK+L+YI+SG E+GATLE GG+R+GSKG++IQPT+FS+V++D 
Sbjct  372  PFKSGTEQGPQIDSKQFEKILKYIKSGVENGATLETGGERLGSKGFYIQPTVFSNVQDDH  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ +LKFKD+ EVI+RANNT YGLAAG++T +ID ANTL R L+ G+VW+
Sbjct  432  LIAKEEIFGPVQSILKFKDLGEVIQRANNTEYGLAAGIFTKNIDTANTLTRALKVGSVWV  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+ DA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNPAW+
Sbjct  492  NCFDILDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVIPLKNPAWL  539



>ref|XP_006647839.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=551

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGD
Sbjct  324  PFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALQRVVGD  383

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF++GVEQGPQID EQF+K+LRY++SG ESGATL  GGDR GS+G++IQPT+F+DV+++M
Sbjct  384  PFRRGVEQGPQIDGEQFKKILRYVKSGVESGATLVAGGDRAGSRGFYIQPTVFADVEDEM  443

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQDEIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GTVW+
Sbjct  444  TIAQDEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTRRLDAANTLARALRVGTVWV  503

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAVVTP+K+ AW+
Sbjct  504  NCYDVFDAAIPFGGYKMSGVGREKGFYSLRNYLQTKAVVTPVKDAAWL  551



>ref|XP_009363532.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EK+KARA RR+VGD
Sbjct  307  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKSKARAERRLVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+L+YI  G ++GA LE GG+R+G+KG++I+PT+FSDV++DM
Sbjct  367  PFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFSDVQDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID ANTL R LR G+V+I
Sbjct  427  RIACEEIFGPVQTILKYKDLNEVIQRANNSRYGLAAGVFTQNIDTANTLTRALRVGSVFI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA+IPFGGYKMSGIGREKG+Y L+NYLQVKAVVTPLKNPAW+
Sbjct  487  NCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_011003158.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Populus euphratica]
Length=540

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PF++C+DA++D+AVE +H A+FFNQGQCCCAGSRT+VHER+Y+EFVEKAKARA++R VGD
Sbjct  313  PFVVCEDADVDQAVELSHSAVFFNQGQCCCAGSRTFVHERVYNEFVEKAKARAIQRTVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF++G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ GY+IQPT+FSDV++DM
Sbjct  373  PFREGIEQGPQVDSDQFEKILRLIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ + KFKD+DEVI+R+NN+ YGLAAG++T ++D ANTL+R L+ GTVWI
Sbjct  433  LIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDTANTLSRALKVGTVWI  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVVT L NPAW+
Sbjct  493  NCYDVFDAGIPFGGYKMSGNGREKGIYSLSNYLQVKAVVTSLNNPAWL  540



>gb|KDO82486.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82487.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82488.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=423

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RVVGD
Sbjct  196  PFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRVVGD  255

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK+DM
Sbjct  256  PFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDM  315

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+VWI
Sbjct  316  LIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWI  375

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  376  NCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  423



>ref|NP_001057358.1| Os06g0270900 [Oryza sativa Japonica Group]
 dbj|BAB19052.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAD54414.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAF19272.1| Os06g0270900 [Oryza sativa Japonica Group]
 gb|EAZ36586.1| hypothetical protein OsJ_20928 [Oryza sativa Japonica Group]
 dbj|BAG93278.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99957.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98432.1| aldehyde dehydrogenase, partial [Oryza sativa]
Length=549

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RVVGD
Sbjct  322  PFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+++M
Sbjct  382  PFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQDNM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GTVW+
Sbjct  442  RIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  502  NCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  549



>gb|EAZ00462.1| hypothetical protein OsI_22484 [Oryza sativa Indica Group]
Length=549

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RVVGD
Sbjct  322  PFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+++M
Sbjct  382  PFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQDNM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GTVW+
Sbjct  442  RIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  502  NCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  549



>ref|XP_004139235.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=538

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE+++DEFVEKA+ RA  RVVGD
Sbjct  311  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARNRAANRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKGY++QPT+FS+VK+DM
Sbjct  371  PFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPTVFSNVKDDM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ AN L R LR G+VWI
Sbjct  431  KIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGSVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  491  NCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  538



>gb|AAF73828.1|AF162665_1 aldehyde dehydrogenase [Oryza sativa]
Length=549

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RVVGD
Sbjct  322  PFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRVVGD  381

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+++M
Sbjct  382  PFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQDNM  441

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GTVW+
Sbjct  442  RIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGTVWV  501

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct  502  NCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL  549



>ref|XP_004156463.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=540

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE+++DEFVEKA+ RA  RVVGD
Sbjct  313  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARNRAANRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKGY++QPT+FS+VK+DM
Sbjct  373  PFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPTVFSNVKDDM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ AN L R LR G+VWI
Sbjct  433  KIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGSVWI  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  493  NCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  540



>ref|XP_010460154.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Camelina sativa]
Length=534

 Score =   380 bits (977),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 207/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA  R VGD
Sbjct  307  PFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAANRAVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM
Sbjct  367  PFNSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQTGGDRLGSKGYYIQPTVFSDVKDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D AN L R LR GTVWI
Sbjct  427  LIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALRVGTVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DV DATIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNPAW+
Sbjct  487  NCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNPAWL  534



>ref|NP_001105576.1| aldehyde dehydrogenase2 [Zea mays]
 gb|AAL99613.1|AF348417_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
Length=550

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  323  PFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  382

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K++M
Sbjct  383  PFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPTVFADAKDEM  442

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  443  KIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGTVWV  502

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  503  NCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>gb|ACG32898.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  323  PFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  382

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K++M
Sbjct  383  PFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGERGFYIQPTVFADAKDEM  442

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  443  KIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGTVWV  502

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  503  NCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>gb|AAL99614.2|AF348418_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
 gb|AFW63789.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  323  PFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  382

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K++M
Sbjct  383  PFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPTVFADAKDEM  442

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  443  KIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGTVWV  502

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  503  NCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>gb|KHN47185.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=538

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 203/228 (89%), Gaps = 2/228 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D AVE +HFALFFNQGQCCCAGSRT+VHE IY EFVEKAKARA++RVVGD
Sbjct  313  PFIVCKDADVDAAVEASHFALFFNQGQCCCAGSRTFVHESIYGEFVEKAKARALKRVVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKGY+IQPT+FS+  ++M
Sbjct  373  PFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKGYYIQPTVFSN--DNM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D ANTL R L+AGTVWI
Sbjct  431  LIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDTANTLMRALQAGTVWI  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  491  NCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  538



>gb|KGN60807.1| hypothetical protein Csa_2G010420 [Cucumis sativus]
Length=592

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE+++DEFVEKA+ RA  RVVGD
Sbjct  365  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARNRAANRVVGD  424

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKGY++QPT+FS+VK+DM
Sbjct  425  PFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPTVFSNVKDDM  484

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ AN L R LR G+VWI
Sbjct  485  KIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGSVWI  544

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  545  NCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  592



>gb|AHM26657.1| aldehyde dehydrogenase 2-2 [Zea mays subsp. mays]
Length=550

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  323  PFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  382

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQP +F+D K++M
Sbjct  383  PFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPMVFADAKDEM  442

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  443  KIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGTVWV  502

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct  503  NCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL  550



>ref|XP_002274863.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Vitis vinifera]
 emb|CBI34947.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE +H ALF+NQGQ CC+GSRT+VHE IYDEF+EKAKARA++RVVGD
Sbjct  308  PFIVCEDADVDKAVELSHTALFYNQGQSCCSGSRTFVHESIYDEFIEKAKARALKRVVGD  367

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QF K+L YI+SG E+GATLE GG++  SKGY+IQPT+FS+V ++M
Sbjct  368  PFKKGVEQGPQIDSQQFNKILGYIKSGIEAGATLEAGGEKFSSKGYYIQPTVFSNVHDNM  427

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA++EIFGPVQ +LKFKD+DEVI+RAN THYGLAAG++T ++D ANTL R LR GTVWI
Sbjct  428  LIAKEEIFGPVQSILKFKDLDEVIRRANATHYGLAAGIFTQNLDTANTLTRALRVGTVWI  487

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+ VFDA IPFGG KMSG GREKG+Y L+NY+QVKAVVTPLKNPAW+
Sbjct  488  NCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPLKNPAWL  535



>gb|KDO82484.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=493

 Score =   377 bits (967),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RVVGD
Sbjct  266  PFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRVVGD  325

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK+DM
Sbjct  326  PFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDM  385

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+VWI
Sbjct  386  LIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWI  445

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  446  NCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  493



>ref|XP_008456004.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Cucumis melo]
Length=537

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKA+ RA  RVVGD
Sbjct  310  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKARNRAANRVVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF  G+EQGPQ+D EQF+K+L+YI+ G E GATLE GG+R GSKGY++QPT+FS+VK+DM
Sbjct  370  PFLGGIEQGPQVDGEQFKKILKYIKYGIEGGATLEAGGERFGSKGYYVQPTVFSNVKDDM  429

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LK+KD+DEVI+RAN + YGLAAGV+T +I+ AN L R LR G+VWI
Sbjct  430  KIAQEEIFGPVQTILKYKDMDEVIRRANASRYGLAAGVFTQNINTANRLTRSLRVGSVWI  489

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+D+FDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NPAW+
Sbjct  490  NCFDIFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL  537



>gb|KDO82485.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=546

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RVVGD
Sbjct  319  PFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRVVGD  378

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK+DM
Sbjct  379  PFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDM  438

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+VWI
Sbjct  439  LIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWI  498

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  499  NCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  546



>ref|XP_006438422.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
 ref|XP_006483828.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Citrus sinensis]
 gb|ESR51662.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
Length=546

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+A E AH+ALFFNQGQCCCAGSRT+VHE +YD+FVEKA A AM+RVVGD
Sbjct  319  PFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVYDQFVEKANALAMKRVVGD  378

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+KGY+I+PT+F+ VK+DM
Sbjct  379  PFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDM  438

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++D ANTL R LR G+VWI
Sbjct  439  LIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWI  498

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LKNPAW+
Sbjct  499  NCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALKNPAWL  546



>ref|XP_009391258.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  307  PMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRVVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV++ M
Sbjct  367  PFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQDGM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+VWI
Sbjct  427  KIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGSVWI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  487  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  534



>ref|XP_009391259.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  305  PMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRVVGD  364

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV++ M
Sbjct  365  PFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQDGM  424

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+VWI
Sbjct  425  KIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGSVWI  484

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  485  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  532



>dbj|BAD15920.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16359.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAG99615.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   372 bits (955),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RVVGD
Sbjct  194  PFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRVVGD  253

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+++M
Sbjct  254  PFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVEDEM  313

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GTVW+
Sbjct  314  KIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGTVWV  373

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct  374  NTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL  421



>ref|XP_009391257.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   375 bits (964),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  312  PMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRVVGD  371

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV++ M
Sbjct  372  PFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQDGM  431

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+VWI
Sbjct  432  KIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGSVWI  491

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  492  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  539



>ref|XP_004953799.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Setaria italica]
Length=548

 Score =   375 bits (964),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA +RVVGD
Sbjct  321  PFIVMDDADVDQAVELAHHAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARAQKRVVGD  380

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF+K+LRY++SG +SGATL  GGDR GS+G++IQPT+F+D K++M
Sbjct  381  PFRNGVEQGPQIDEEQFKKILRYVQSGVDSGATLVAGGDRAGSRGFYIQPTVFADAKDEM  440

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  441  KIAREEIFGPVQTILKFSGVEEVIRRANATQYGLAAGVFTRSLDAANTLSRALRAGTVWV  500

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG+GREKGVY+L NYLQ KAVVTP++N AW+
Sbjct  501  NCYDVFDAGIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIRNAAWL  548



>ref|XP_009391256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EKAKARA++RVVGD
Sbjct  314  PMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFIEKAKARAIKRVVGD  373

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KGY+IQPTIF+DV++ M
Sbjct  374  PFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKGYYIQPTIFTDVQDGM  433

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  ANTL R LR G+VWI
Sbjct  434  KIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHTANTLMRALRVGSVWI  493

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NPAW+
Sbjct  494  NCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNPAWL  541



>emb|CBI16844.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 196/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+C+DAN+D AVE AHFALFFNQ QCC A SRT+VHE IYDEFVEKAK RA+RR +G+
Sbjct  161  PVIVCEDANVDEAVELAHFALFFNQWQCCAACSRTFVHESIYDEFVEKAKTRALRRTIGN  220

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS+QFEK+LRYIRSG E+  TLE GG+R G++G+FI+PT+FS+V++ M
Sbjct  221  PFKAGIEQGPQIDSDQFEKILRYIRSGVENAGTLETGGERFGNEGFFIKPTVFSNVQDGM  280

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +IAQDEIFGPVQ +LKFKD+DEVI+RAN   YGLAAGV+T ++D  NTL R LR GTVW+
Sbjct  281  LIAQDEIFGPVQSILKFKDLDEVIRRANAASYGLAAGVFTQNLDTTNTLTRALRVGTVWV  340

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGY MSG GREKG+YSL NYLQVKAV+  LKNPAW+
Sbjct  341  NCFDVFDAAIPFGGYTMSGHGREKGMYSLQNYLQVKAVIASLKNPAWL  388



>ref|XP_002970420.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
 gb|EFJ28550.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
Length=488

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII  DA+ID+AVE +HFALFFNQGQCCCAGSRT+VHE IYDE++EKAKARA++RVVGD
Sbjct  261  PFIIMPDADIDQAVELSHFALFFNQGQCCCAGSRTFVHESIYDEYIEKAKARALKRVVGD  320

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQ+D  QFEK+L YI  G+  GA L  GG RIG+KGY+IQPTIFSDVK+DM
Sbjct  321  PFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGARIGNKGYYIQPTIFSDVKDDM  380

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             I++DEIFGPVQ V KF+ + E I+RANN+ YGLAAGV+T DID ANT +R LR G+VWI
Sbjct  381  AISRDEIFGPVQAVTKFRTVQEAIERANNSPYGLAAGVFTKDIDTANTFSRALRVGSVWI  440

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG Y L+NY QVKAVVTPLKNPAW+
Sbjct  441  NCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVTPLKNPAWL  488



>ref|XP_004953798.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Setaria italica]
Length=555

 Score =   374 bits (959),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA +RVVGD
Sbjct  328  PFIVMDDADVDQAVELAHHAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARAQKRVVGD  387

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF+K+LRY++SG +SGATL  GGDR GS+G++IQPT+F+D K++M
Sbjct  388  PFRNGVEQGPQIDEEQFKKILRYVQSGVDSGATLVAGGDRAGSRGFYIQPTVFADAKDEM  447

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGTVW+
Sbjct  448  KIAREEIFGPVQTILKFSGVEEVIRRANATQYGLAAGVFTRSLDAANTLSRALRAGTVWV  507

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG+GREKGVY+L NYLQ KAVVTP++N AW+
Sbjct  508  NCYDVFDAGIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIRNAAWL  555



>dbj|BAJ85552.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHE +YDEFVEK+KARA RRVVGD
Sbjct  196  PFIVMDDADVDQAVELAHRAIFFNQGQCCCAGSRTFVHESVYDEFVEKSKARAQRRVVGD  255

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID +QF+K+L Y++SG +SGATL  GGDR+GS+G+++QPT+F+DV+++M
Sbjct  256  PFKKGVEQGPQIDGQQFKKILGYVKSGVDSGATLVTGGDRLGSRGFYVQPTVFADVEDEM  315

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGP+Q +LKF+D+ EV++RAN T YGLAAGV+T  +D AN +AR LR GTVW+
Sbjct  316  KIAKEEIFGPIQSILKFRDVGEVVRRANPTQYGLAAGVFTGSLDTANAVARALRVGTVWV  375

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAVV PL++PAW+
Sbjct  376  NCYDVFDAAIPFGGYKMSGVGREKGPYSLGNYLQTKAVVAPLRDPAWL  423



>ref|XP_008793866.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=538

 Score =   373 bits (958),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RVVGD
Sbjct  311  PMIIMDDADVDQAVELAHSALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRVVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQ+D +QF+K++ YI+SG +SGATL  GGDRIG KG+++QPT+FSDVK++M
Sbjct  371  PFKNGVEQGPQVDEKQFKKIMHYIKSGIDSGATLVAGGDRIGDKGFYVQPTVFSDVKDEM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+++IFGPVQ +LKFKD+ EVI+RAN T YGLAAGV+T+D++ ANTL R LR GTVW 
Sbjct  431  AIAREDIFGPVQSILKFKDLHEVIQRANATEYGLAAGVFTNDMNTANTLMRALRVGTVWF  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+ VFDATIPFGGYKMSG GREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct  491  NCFHVFDATIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTSLKNPAWL  538



>ref|XP_009399660.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   373 bits (958),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -3

Query  765  RAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFKKGVEQGPQ  586
            +AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RVVGDPF+KGVEQGPQ
Sbjct  326  QAVEVAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRVVGDPFRKGVEQGPQ  385

Query  585  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  406
            ID EQF K+L YI+SG +SGATL  GGDRIGSKGY+IQPT+FSDV++ M IA++EIFGPV
Sbjct  386  IDEEQFSKILHYIKSGVDSGATLVTGGDRIGSKGYYIQPTVFSDVEDKMKIAKEEIFGPV  445

Query  405  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  226
            Q +LKFKD++EVI+RAN T YGLAAGV+T +++ ANT  R LRAGTVWINCYDVFDA IP
Sbjct  446  QTILKFKDVNEVIQRANTTRYGLAAGVFTHNLNTANTFMRALRAGTVWINCYDVFDAAIP  505

Query  225  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            FGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  506  FGGYKMSGNGREKGIDSLKNYLQVKAVVTPLKNPAWL  542



>gb|EEC73936.1| hypothetical protein OsI_08800 [Oryza sativa Indica Group]
Length=553

 Score =   373 bits (958),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RVVGD
Sbjct  326  PFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRVVGD  385

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+++M
Sbjct  386  PFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVEDEM  445

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GTVW+
Sbjct  446  KIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGTVWV  505

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct  506  NTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL  553



>ref|NP_001048010.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAA96793.1| mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa Japonica 
Group]
 dbj|BAD15919.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16358.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAF09924.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAH00573.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57740.1| hypothetical protein OsJ_08254 [Oryza sativa Japonica Group]
Length=553

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RVVGD
Sbjct  326  PFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRVVGD  385

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+++M
Sbjct  386  PFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVEDEM  445

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GTVW+
Sbjct  446  KIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGTVWV  505

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct  506  NTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL  553



>ref|XP_002978501.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
 gb|EFJ20487.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
Length=497

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFII  DA+ID+AVE +HFALFFNQGQCCCAGSRT+VHE IYDE++EKAKARA++RVVGD
Sbjct  270  PFIIMPDADIDQAVELSHFALFFNQGQCCCAGSRTFVHESIYDEYIEKAKARALKRVVGD  329

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQ+D  QFEK+L YI  G+  GA L  GG RIG+KGY+IQPTIFSDVK+DM
Sbjct  330  PFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGTRIGNKGYYIQPTIFSDVKDDM  389

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             I++DEIFGPVQ V KF+ + E I+RANNT YGLAAGV+T DID ANT +R LR G+VWI
Sbjct  390  AISRDEIFGPVQAVTKFRTVQEAIERANNTTYGLAAGVFTKDIDTANTFSRALRVGSVWI  449

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKG Y L+NY QVKAVVTPL+NPAW+
Sbjct  450  NCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVTPLRNPAWL  497



>ref|XP_010928601.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R+VGD
Sbjct  316  PMIIMDDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRIVGD  375

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF++GVEQGPQID +QF K+L YI+SG +SGATL  GGDR+GSKGYFIQPT+F+DVK++M
Sbjct  376  PFRQGVEQGPQIDEDQFRKILGYIKSGTDSGATLIAGGDRLGSKGYFIQPTVFADVKDEM  435

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LKF D++EVI+RAN +HYGLAAG++++++D  NTL R LRAG+V++
Sbjct  436  KIAREEIFGPVQSILKFSDLNEVIRRANASHYGLAAGIFSNNMDTVNTLMRALRAGSVFV  495

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDA IPFGGYKMSG GR+KG+ SL NY Q+KAVVT LKNPAW+
Sbjct  496  NCFDVFDAAIPFGGYKMSGHGRDKGMDSLKNYSQIKAVVTALKNPAWL  543



>ref|XP_010928603.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=538

 Score =   370 bits (950),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KA A++R+VGD
Sbjct  311  PMIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKAHALKRIVGD  370

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GV+QGPQ+D +Q  K++ YI SG  SGATL  GG+RIG+KG+++QPT+FSDVK++M
Sbjct  371  PFKNGVQQGPQVDEKQLNKIMHYIESGINSGATLVAGGNRIGNKGFYVQPTVFSDVKDEM  430

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+++IFGPVQ +LKFKD+DE+I+RAN T YGLAAGV+T++++ ANTL R LR GTVW 
Sbjct  431  AIAREDIFGPVQSILKFKDLDEIIRRANATEYGLAAGVFTNNMNTANTLMRALRVGTVWF  490

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+ VFD TIPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNPAW+
Sbjct  491  NCFHVFDPTIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNPAWL  538



>ref|XP_009363534.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EK+KARA RR+VGD
Sbjct  307  PFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKSKARAERRLVGD  366

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK G+EQGPQIDS QFEK+L+YI  G ++GA LE GG+R+G+KG++I+PT+FSDV++DM
Sbjct  367  PFKGGIEQGPQIDSVQFEKILKYIDYGVKAGAKLETGGERVGTKGFYIKPTVFSDVQDDM  426

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID ANTL R LR G+V+I
Sbjct  427  SIACEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGSVFI  486

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY VFDA+IPFGGYKMS  GREKG+  L+NYLQVKAVVTPLKNPAW+
Sbjct  487  NCYYVFDASIPFGGYKMSCCGREKGISGLSNYLQVKAVVTPLKNPAWL  534



>ref|XP_008793883.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=540

 Score =   367 bits (943),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II DDA++D+AVE AHFALFFNQGQCCC+GSRT+VHER+YDEFVEKAKARA++R+VGD
Sbjct  313  PMIIMDDADVDQAVELAHFALFFNQGQCCCSGSRTFVHERVYDEFVEKAKARALKRIVGD  372

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID +QF+K+L YI+SG +SGATL  GGDR GSKGYFIQPT+F+DVK+ M
Sbjct  373  PFKHGVEQGPQIDEKQFDKILGYIKSGIDSGATLIAGGDRFGSKGYFIQPTVFADVKDGM  432

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPVQ +LKF DI+EVI+RAN T YGLAAGV+++++D  +TL R LR G+V++
Sbjct  433  KIAQNEIFGPVQSILKFSDINEVIRRANATPYGLAAGVFSNNMDAVSTLMRALRVGSVFV  492

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC++V DA IPFGGYKMSG GR+KGV+SL NYLQ KAVVT LKNPAW+
Sbjct  493  NCFNVLDAAIPFGGYKMSGHGRDKGVHSLQNYLQTKAVVTALKNPAWL  540



>ref|XP_001785650.1| predicted protein [Physcomitrella patens]
 gb|EDQ49530.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 196/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P IIC+DAN+D AVE AHFALFFN GQCCCAGSRT+VHE IYDEFVEK+KARA++RVVGD
Sbjct  303  PMIICEDANVDEAVELAHFALFFNMGQCCCAGSRTFVHESIYDEFVEKSKARALKRVVGD  362

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+KGVEQGPQ+D +QF KVL Y+ SG E GA L  GG R+GSKGY+I+PTIF+DVKE M
Sbjct  363  PFRKGVEQGPQVDKDQFHKVLGYVESGMEQGANLITGGGRLGSKGYYIKPTIFTDVKEGM  422

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             I  +EIFGPVQ + KFK +DEV++RANNT YGLAAG+++++I+  NTL+R LRAGT+W+
Sbjct  423  KIFDEEIFGPVQSIAKFKTLDEVVQRANNTVYGLAAGIFSNNINTVNTLSRALRAGTIWV  482

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NC+DVFDATIPFGGYK SGIGREKG Y L +Y QVKAVVTPL NPAW+
Sbjct  483  NCFDVFDATIPFGGYKQSGIGREKGKYVLESYTQVKAVVTPLHNPAWL  530



>gb|KHN23562.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=510

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 206/236 (87%), Gaps = 8/236 (3%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D AVE AHFALFFNQGQCCCAGSRT+VHE IYDEFVEKAKARA++RVVGD
Sbjct  275  PFIVCEDADVDAAVEAAHFALFFNQGQCCCAGSRTFVHESIYDEFVEKAKARALKRVVGD  334

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK---  448
            PFK GVEQGPQIDS QFEK+++YIRSG E+GATLE GG RIGSKGY+IQPT+FS+V+   
Sbjct  335  PFKNGVEQGPQIDSAQFEKIMKYIRSGVENGATLESGGQRIGSKGYYIQPTVFSNVQARY  394

Query  447  -----EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARG  283
                 ++M+IA+DEI GPVQ +LKFKD++EVI+RAN T YGLA+GV+T ++D ANTL R 
Sbjct  395  LQLTMDNMLIAKDEILGPVQSILKFKDLEEVIRRANATSYGLASGVFTQNMDTANTLMRA  454

Query  282  LRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            LR GTVWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNPAW+
Sbjct  455  LRVGTVWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNPAWL  510



>gb|ABU96176.1| aldehyde dehydrogenase [Populus tremula x Populus alba]
Length=357

 Score =   350 bits (897),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE +H A+FFNQGQCCCA SRT+VHER+Y+EFVEKAKARA++R VGD
Sbjct  144  PFIVCEDADVDQAVELSHSAVFFNQGQCCCADSRTFVHERVYNEFVEKAKARAIQRTVGD  203

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF++G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ GY+IQPT+FSDV++DM
Sbjct  204  PFREGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQDDM  263

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            ++A++EIFGPVQ + KFKD+DEVI+R+N+T YGLAAG++T ++D ANTL+R L+ GTVWI
Sbjct  264  LVAKEEIFGPVQSIFKFKDLDEVIQRSNSTRYGLAAGIFTHNLDTANTLSRALKVGTVWI  323

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQ  157
            NCYDVFDA IPFGG KMSG GREKG+YSL NYLQ
Sbjct  324  NCYDVFDAAIPFGGSKMSGNGREKGIYSLRNYLQ  357



>gb|AEV40467.1| mitochondrial aldehyde dehydrogenase [Miscanthus sinensis]
Length=201

 Score =   340 bits (873),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  717  CCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSG  538
            CCCAGSRT+VHERIYDEFVEKAKARA++RVVGDPF+KGVEQGPQID EQF K+LRYIRSG
Sbjct  1    CCCAGSRTFVHERIYDEFVEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSG  60

Query  537  KESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRA  358
             +SGA L  GGDR+G KGY+IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRA
Sbjct  61   VDSGANLVTGGDRLGDKGYYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRA  120

Query  357  NNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVY  178
            N + YGLAAGV+T+ +D ANTL R LR GTVW+NC+D+FDA IPFGGYKMSGIGREKG+ 
Sbjct  121  NASQYGLAAGVFTNSLDTANTLTRALRVGTVWVNCFDIFDAAIPFGGYKMSGIGREKGID  180

Query  177  SLNNYLQVKAVVTPLKNPAWI  115
            SL NYLQVKAVVTP+KN AW+
Sbjct  181  SLKNYLQVKAVVTPIKNAAWL  201



>gb|EMT22926.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=678

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHE +YDEFVEK+KARA RRVVGD
Sbjct  318  PFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHESVYDEFVEKSKARAQRRVVGD  377

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQID +QF+K+L Y++SG +SGATL  GG+R+GS+G++IQPT+F+DV+++M
Sbjct  378  PFKKGVEQGPQIDGQQFKKILGYVKSGVDSGATLVTGGERVGSRGFYIQPTVFADVEDEM  437

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGP+Q +LKF+++ EV++RAN T YGLAAGV+T  +D AN +AR LR GTVW+
Sbjct  438  KIAQEEIFGPIQSILKFREVGEVVRRANATQYGLAAGVFTRSLDTANAVARALRVGTVWV  497

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV  145
            NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAV
Sbjct  498  NCYDVFDAAIPFGGYKMSGVGREKGAYSLGNYLQTKAV  535



>ref|XP_002961352.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
 gb|EFJ38891.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
Length=491

 Score =   348 bits (893),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA+ID+A+E +H ALFFNQGQ CCAGSRT+VHE +YDEFVEKAK +A  RV+GD
Sbjct  264  PFIVCGDADIDKALELSHLALFFNQGQTCCAGSRTFVHESVYDEFVEKAKKKAENRVLGD  323

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVE GPQ+D  QF KV++YI  GKE GATL  GG+R G KG++IQPT+F+DV + M
Sbjct  324  PFQSGVEHGPQVDISQFNKVMKYIGYGKEQGATLLTGGERHGDKGFYIQPTVFADVGDSM  383

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             I++DEIFGPVQC+ KFK ++EV++RANNT YGLAAGV+T  +D AN L+R L+ GTVW+
Sbjct  384  AISRDEIFGPVQCISKFKTLEEVVERANNTQYGLAAGVFTQSLDTANFLSRALKVGTVWV  443

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            N Y  FDA IPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  444  NTYYAFDAAIPFGGYKMSGFGREKGEYVLKNYLQVKAVVTPLKNPAWL  491



>ref|XP_002983210.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
 gb|EFJ15552.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
Length=483

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA+ID+A+E +H ALFFNQGQ CCAGSRT+VHE +YDEFV+KAK +A  RV+GD
Sbjct  256  PFIVCGDADIDKALELSHLALFFNQGQTCCAGSRTFVHESVYDEFVDKAKKKAENRVLGD  315

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GVE GPQ+D  QF KV++YI  GKE GATL  GG+R G KG++IQPT+F+DV + M
Sbjct  316  PFQSGVEHGPQVDISQFNKVMKYIGYGKEQGATLLTGGERHGDKGFYIQPTVFADVGDSM  375

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             I++DEIFGPVQC+ KFK ++EV++RANNT YGLAAGV+T  +D AN L+R L+ GTVW+
Sbjct  376  AISRDEIFGPVQCISKFKTLEEVVERANNTPYGLAAGVFTQSLDTANFLSRALKVGTVWV  435

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            N Y  FDA IPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNPAW+
Sbjct  436  NTYYAFDAAIPFGGYKMSGFGREKGEYVLKNYLQVKAVVTPLKNPAWL  483



>emb|CAN80790.1| hypothetical protein VITISV_020547 [Vitis vinifera]
Length=480

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 190/231 (82%), Gaps = 12/231 (5%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C+DA++D+AVE +H ALF+NQGQ CC+GSRT+VHE IYDEF+EKAKARA++RVVGD
Sbjct  259  PFIVCEDADVDKAVELSHTALFYNQGQSCCSGSRTFVHESIYDEFIEKAKARALKRVVGD  318

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFKKGVEQGPQIDS+QF K+L YI+SG E+GATLE GG++  SKGY+IQPT+FS+V    
Sbjct  319  PFKKGVEQGPQIDSQQFNKILGYIKSGIEAGATLEAGGEKFSSKGYYIQPTVFSNV----  374

Query  438  VIAQDEIFGPVQCVLKF---KDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT  268
                  IF P      F   +D+DEVI+RAN THYGLAAG++T ++D ANTL R LR GT
Sbjct  375  -----HIFPPFTXFYAFTNNRDLDEVIRRANATHYGLAAGIFTQNLDTANTLTRALRVGT  429

Query  267  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            VWINC+ VFDA IPFGG KMSG GREKG+Y L+NY+QVKAVVTPLKNPAW+
Sbjct  430  VWINCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPLKNPAWL  480



>ref|XP_007151102.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
 gb|ESW23096.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
Length=522

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 186/228 (82%), Gaps = 7/228 (3%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA+ID AVE AH ALFFNQGQCCCAGSRT+VHE IYDEFVEKAK RA++RVVGD
Sbjct  302  PFIVCKDADIDAAVEAAHSALFFNQGQCCCAGSRTFVHESIYDEFVEKAKTRAIKRVVGD  361

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQID  QF+K+L+YIRSG ESGATLE GG R+GSKGY+I+PT+FS+V    
Sbjct  362  PFKSGVEQGPQIDFTQFKKILKYIRSGIESGATLESGGQRVGSKGYYIEPTVFSNV----  417

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
               Q   F  +  +   KD++EVI+RAN T YGLAAGVYT +ID ANTL R LR GTVWI
Sbjct  418  ---QAWHFQLIMVLFLNKDLEEVIRRANATSYGLAAGVYTRNIDTANTLMRALRVGTVWI  474

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYD+FDA IPFGGYKMSG GR +G+YSL +YLQVKA VT LKNPAW+
Sbjct  475  NCYDIFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKACVTALKNPAWL  522



>gb|KJB31274.1| hypothetical protein B456_005G183300 [Gossypium raimondii]
Length=509

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 187/228 (82%), Gaps = 23/228 (10%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PFI+C DA++D+AVE AHFALFFNQ                        KARA++R VGD
Sbjct  305  PFIVCKDADVDKAVELAHFALFFNQ-----------------------RKARALKRSVGD  341

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PFK GVEQGPQIDSEQFEK+LRYIRSG ESGATL  GGDR+GSKG++IQPT+F++VKEDM
Sbjct  342  PFKAGVEQGPQIDSEQFEKILRYIRSGIESGATLITGGDRLGSKGFYIQPTVFTNVKEDM  401

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
            +I+QDEIFGPVQ +LKF+ +DEVI+RAN+T YGLAAGV+T+D+D ANTL+R L+ GTVWI
Sbjct  402  LISQDEIFGPVQSILKFRYMDEVIRRANSTRYGLAAGVFTNDLDTANTLSRALKVGTVWI  461

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCYDVFDA IPFGGYKMSG GREKGV+ L+NYLQVKA+V PLKNPAWI
Sbjct  462  NCYDVFDAAIPFGGYKMSGQGREKGVHCLSNYLQVKAIVAPLKNPAWI  509



>ref|XP_001690955.1| aldehyde dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP05401.1| aldehyde dehydrogenase [Chlamydomonas reinhardtii]
Length=536

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 180/227 (79%), Gaps = 1/227 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+C D ++D+AV DAH ALFFN GQCC AGSR YVHE +YDEFV K+   A  R VGD
Sbjct  310  PIIVCPDVDVDKAVADAHMALFFNHGQCCAAGSRVYVHEAVYDEFVRKSTEAAATRKVGD  369

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF   VEQGPQ+D +QF+K+L YI SGK  GA L  GG R G +GY+++PT+F+DVK+DM
Sbjct  370  PFSS-VEQGPQVDDDQFKKILSYIDSGKRQGAKLMTGGGRKGDRGYYVEPTVFADVKDDM  428

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ ++K+K +D+VI RANN+ YGLAAGV++++ID  NTL R L++GTVW+
Sbjct  429  KIAREEIFGPVQSIMKWKSLDDVIARANNSPYGLAAGVFSNNIDTVNTLTRALKSGTVWV  488

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW  118
            NCY+++D  +PFGGYK SGIGREKG Y+L+NY QVKAV  PL NPAW
Sbjct  489  NCYNLYDNAVPFGGYKESGIGREKGEYALSNYTQVKAVYQPLSNPAW  535



>emb|CAD10505.1| aldehyde dehydrogenase [Polytomella sp. Pringsheim 198.80]
Length=523

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 176/227 (78%), Gaps = 0/227 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+C D ++DRAV DAH ALFFN GQCC AGSR YVHE+IYDEFVEKA   A    VGD
Sbjct  296  PIIVCPDVDVDRAVADAHMALFFNHGQCCAAGSRVYVHEKIYDEFVEKATKAAANHSVGD  355

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    +QGPQ+D+ QF K+L Y+  GK  GA L  GG R+G+KGY++ PT+FS+V ++M
Sbjct  356  PFSGQYDQGPQVDNAQFSKILSYVEHGKAEGAKLNVGGCRVGNKGYYVAPTVFSNVTDNM  415

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPVQ +LK+   DEVI+RAN + YGLA+GV++ D+D  NTL RGL AGTVW+
Sbjct  416  KIAREEIFGPVQSILKYSTFDEVIRRANASDYGLASGVFSKDLDTVNTLVRGLHAGTVWV  475

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW  118
            NCY++FD+ +PFGG+K SGIGREKG Y+L+NY +VKAV  PL NPAW
Sbjct  476  NCYNLFDSAVPFGGFKTSGIGREKGEYALSNYTKVKAVYMPLVNPAW  522



>ref|XP_011483309.1| PREDICTED: aldehyde dehydrogenase, mitochondrial [Oryzias latipes]
Length=417

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 171/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+  DAN++ AVE +HFALFFNQGQCCCAGSRTYV   IYDEFVE++  RA RRVVGD
Sbjct  191  PNIVLSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGD  250

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+++M
Sbjct  251  PFDMKTEQGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNM  310

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  + KFK ++EV+ RAN++ YGLAA V+T DIDKAN ++ GLRAGTVWI
Sbjct  311  TIAREEIFGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGTVWI  370

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK SG+GRE G Y L NY +VK V    P KN
Sbjct  371  NCYDVFGAQAPFGGYKASGVGRELGQYGLENYTEVKTVTIKIPQKN  416



>ref|XP_003977205.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like [Takifugu 
rubripes]
Length=380

 Score =   307 bits (786),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DAN++ AVE +HFALFFNQGQCCCAGSRTYV E +Y+EF+E++  RA RR+VGD
Sbjct  119  PNIILSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQEDVYEEFLERSAERAKRRLVGD  178

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D EQF K+L YI +GK  GA L CGG    +KGYFIQPT+F DV+++M
Sbjct  179  PFDLKTEQGPQVDLEQFNKILGYISTGKREGAKLMCGGGVAANKGYFIQPTVFGDVQDNM  238

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV++RAN+T YGLAA V+T DIDKA+ ++ GLRAGTVWI
Sbjct  239  TIAREEIFGPVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKAHYISNGLRAGTVWI  298

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVK  151
            NCYDVF A  PFGGYK SGIGRE G Y L NY ++K
Sbjct  299  NCYDVFGAQAPFGGYKASGIGRELGEYGLTNYTRLK  334



>ref|WP_011612157.1| betaine-aldehyde dehydrogenase [Trichodesmium erythraeum]
 gb|ABG51795.1| aldehyde dehydrogenase (acceptor) [Trichodesmium erythraeum IMS101]
Length=490

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 176/222 (79%), Gaps = 0/222 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+  DA++D A+E +HFALFFNQGQCCCAGSR +V E+ YDEFV K+  RA  R+VGD
Sbjct  269  PNIVFADADMDAAIEGSHFALFFNQGQCCCAGSRLFVEEKCYDEFVNKSVERAKLRMVGD  328

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF + VEQGPQ+D EQF KV+ YI SG++ GA + CGG R+G +GYFI PT+F+DV+++M
Sbjct  329  PFTERVEQGPQVDEEQFNKVMSYIESGQQDGAQMLCGGSRVGDRGYFIAPTVFADVQDNM  388

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IAQ+EIFGPV  ++KFKDIDE+++RANN+ YGLAAGV+T D+ KA+TLA  LRAGTVW+
Sbjct  389  KIAQEEIFGPVMSIIKFKDIDELVERANNSMYGLAAGVWTQDVTKAHTLAHRLRAGTVWV  448

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL  133
            NCYDVFDA  PFGG+K SG+GRE G Y L  Y ++K V   +
Sbjct  449  NCYDVFDAAAPFGGFKQSGLGRELGEYGLQQYTEIKTVTMKM  490



>ref|XP_010783440.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like, partial 
[Notothenia coriiceps]
Length=284

 Score =   303 bits (775),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 171/223 (77%), Gaps = 2/223 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DAN++ AVE +HFALFFNQGQCCCAGSRTYV   IYDEFVE++  RA RRVVGD
Sbjct  26   PNIILSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGD  85

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D EQF K+L YI SGK  GA L CGG     +GY+IQPT+F DV+++M
Sbjct  86   PFDLKTEQGPQVDQEQFNKILGYISSGKREGAKLLCGGGVAADRGYYIQPTVFGDVQDNM  145

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV++RAN+T YGLAA V+T DIDKAN ++  LRAGTVWI
Sbjct  146  TIAREEIFGPVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKANYVSHSLRAGTVWI  205

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  130
            NCYDVF A  PFGGYK SG GRE G Y L NY +VK +  PL+
Sbjct  206  NCYDVFGAQAPFGGYKASGNGRELGEYGLENYTEVKTL--PLR  246



>ref|XP_004635979.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Octodon 
degus]
Length=384

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYEEFVERSVARAKARVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV++ M
Sbjct  218  PFDSRTEQGPQVDESQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T DIDKAN L++ L+AGTVW+
Sbjct  278  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDIDKANYLSQALQAGTVWV  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_005080706.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Mesocricetus 
auratus]
Length=384

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M
Sbjct  218  PFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWI
Sbjct  278  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWI  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKN  383



>ref|XP_005472420.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Oreochromis 
niloticus]
Length=471

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RVVGD
Sbjct  245  PNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRVVGD  304

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+++M
Sbjct  305  PFDLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQDNM  364

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGTVWI
Sbjct  365  TIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGTVWI  424

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V    P KN
Sbjct  425  NCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVTIKVPQKN  470



>ref|XP_004571367.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like isoform 
X1 [Maylandia zebra]
Length=556

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 172/220 (78%), Gaps = 0/220 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RVVGD
Sbjct  321  PNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRVVGD  380

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+++M
Sbjct  381  PFNLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQDNM  440

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGTVWI
Sbjct  441  TIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGTVWI  500

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT  139
            NCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V+T
Sbjct  501  NCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVIT  540



>ref|XP_009296559.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like, partial 
[Danio rerio]
Length=384

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 171/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DAN++ AVE +H ALFFNQGQCCCAG+RT+V E IYDEFVE++  RA  R+VGD
Sbjct  158  PNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGD  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ++ +QF+KVL YI SGK  GA L CGG     +GYFIQPT+F DVK+DM
Sbjct  218  PFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EVI+RAN++ YGLA  V+T DIDKAN ++ GLRAGTVWI
Sbjct  278  TIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWI  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCY+VF    PFGGYK SGIGRE G Y L NY +VK V    P KN
Sbjct  338  NCYNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKN  383



>ref|XP_003965899.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like [Takifugu 
rubripes]
Length=518

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 175/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DAN++ AVE +HFALFFNQGQCCCAGSRTYV E +Y+EF+E++  RA RR+VGD
Sbjct  292  PNIILSDANMEDAVEQSHFALFFNQGQCCCAGSRTYVQEDVYEEFLERSAERAKRRLVGD  351

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D EQF K+L YI +GK  GA L CGG    +KGYFIQPT+F DV+++M
Sbjct  352  PFDLKTEQGPQVDLEQFNKILGYISTGKREGAKLMCGGGVAANKGYFIQPTVFGDVQDNM  411

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV++RAN+T YGLAA V+T DIDKA+ ++ GLRAGTVWI
Sbjct  412  TIAREEIFGPVMQILKFKSLEEVVERANDTKYGLAAAVFTKDIDKAHYISNGLRAGTVWI  471

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK SGIGRE G Y L NY +VK V    P KN
Sbjct  472  NCYDVFGAQAPFGGYKASGIGRELGEYGLTNYTEVKTVTIRVPQKN  517



>ref|XP_003446212.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X1 [Oreochromis 
niloticus]
Length=518

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RVVGD
Sbjct  292  PNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRVVGD  351

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+++M
Sbjct  352  PFDLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQDNM  411

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGTVWI
Sbjct  412  TIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGTVWI  471

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V    P KN
Sbjct  472  NCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVTIKVPQKN  517



>ref|XP_004595352.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Ochotona 
princeps]
Length=384

 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYNEFVERSVARAKSRVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SGK+ GA L CGG     +GYFIQPT+F DV++ M
Sbjct  218  PFDSRTEQGPQVDETQFKKILGYIKSGKQEGAKLLCGGGAAADRGYFIQPTVFGDVQDSM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+
Sbjct  278  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWV  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_005642984.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE18440.1| aldehyde dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=565

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            PF++C DA++D AVE AH ALFFN GQCC AGSRT+VHE IYDEFV++A  RA  + VGD
Sbjct  336  PFVVCPDADLDAAVECAHQALFFNMGQCCTAGSRTFVHESIYDEFVKRAVKRAAEKAVGD  395

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF +  EQGPQ+  EQFEK+L YI  G++ GA LE GG RIG KGY+++PT+FS+V ++M
Sbjct  396  PFDESTEQGPQVSKEQFEKILSYIDKGQQEGAKLEYGGKRIGDKGYYVEPTVFSNVTDEM  455

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA+DEIFGPVQ +LK+  I EV++RAN T YGLAAGV+T +++ A TL+RGL+AGT+W+
Sbjct  456  SIAKDEIFGPVQSILKWSTIGEVLERANATEYGLAAGVFTQNLNWATTLSRGLKAGTIWV  515

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  124
            N ++ FDA +PFGGYK+SGIGRE G  +L++Y Q K+V  PL+ P
Sbjct  516  NTWNTFDAGVPFGGYKLSGIGREHGEAALSHYTQTKSVYQPLEEP  560



>gb|ABR16485.1| unknown [Picea sitchensis]
Length=500

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P I+ DDA++D+AV  AH A++ N GQ C AGSR +V E IYDEFV+KA ARA ++VVGD
Sbjct  273  PLIVMDDADVDKAVNIAHLAVYTNMGQVCLAGSRVFVQEGIYDEFVKKAVARAKQQVVGD  332

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF+ GV+ GPQID  QFEK+L+YI+ GK  GA L  GG+ +G+KG++I+PTIFSDV++DM
Sbjct  333  PFQPGVQHGPQIDKMQFEKILKYIQYGKRDGANLVLGGNSLGNKGFYIEPTIFSDVEDDM  392

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGP+  +LKFK I+EVI+R N T YGL AG+ T DID AN LAR LR GTVWI
Sbjct  393  QIAKEEIFGPIMSILKFKTIEEVIERGNKTIYGLGAGIITKDIDIANRLARSLRVGTVWI  452

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  115
            NCY V  A +P GGYKMSGIGRE G Y L NYLQVK V++PL++  W+
Sbjct  453  NCYLVVGADVPLGGYKMSGIGREYGSYGLTNYLQVKCVISPLQHSPWL  500



>gb|AAK57732.1| aldehyde dehydrogenase [Rattus norvegicus]
Length=443

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+
Sbjct  217  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGN  276

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M
Sbjct  277  PFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGM  336

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWI
Sbjct  337  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWI  396

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  397  NCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN  442



>ref|XP_007058380.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Chelonia 
mydas]
Length=384

 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRTYV E +Y EFVE++  RA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTYVQEDVYHEFVERSIERAKSRVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D EQF+K+L YI +GK+ GA L CGG+    +GYFIQPTIF DV+++M
Sbjct  218  PFDSQTEQGPQVDEEQFKKILGYISTGKQEGAKLLCGGNPAADRGYFIQPTIFGDVQDNM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA +EIFGPV  +LKFK I+EVI+RANN+ YGLAA V+T D+DKAN +++ LRAGTVWI
Sbjct  278  TIATEEIFGPVMQILKFKTIEEVIERANNSKYGLAAAVFTKDLDKANYVSQALRAGTVWI  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK SG GRE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQAPFGGYKASGNGRELGEYGLEAYTEVKTVTIKVPQKN  383



>ref|XP_006178148.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Camelus 
ferus]
Length=377

 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IY EFVE++ ARA  RVVG+
Sbjct  151  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEFVERSVARARSRVVGN  210

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+KVL YI+SGKE GA L CGG     +GYFIQPT+F DV++ M
Sbjct  211  PFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGM  270

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+
Sbjct  271  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWV  330

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK+SG GRE G Y L  Y +VK V    P KN
Sbjct  331  NCYDVFGAQSPFGGYKLSGNGRELGEYGLQAYTEVKTVTVKVPQKN  376



>ref|XP_003462991.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform 2 [Cavia 
porcellus]
Length=474

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RVVG+
Sbjct  248  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQESVYEEFVERSIARAKARVVGN  307

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV++ M
Sbjct  308  PFDSRTEQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGM  367

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANNT YGLAA V+T D+DKAN L++ L+AGTVW+
Sbjct  368  TIAKEEIFGPVMQILKFKTIEEVVGRANNTKYGLAAAVFTKDLDKANYLSQALQAGTVWV  427

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  428  NCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN  473



>ref|XP_005752934.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like isoform 
X2 [Pundamilia nyererei]
 ref|XP_005946398.1| PREDICTED: aldehyde dehydrogenase, mitochondrial-like isoform 
X2 [Haplochromis burtoni]
Length=500

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 170/219 (78%), Gaps = 0/219 (0%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA+++ AVE +HFALFFNQGQCCCAGSRTYV   +YDEFVE++  RA +RVVGD
Sbjct  274  PNIILSDADMEYAVEQSHFALFFNQGQCCCAGSRTYVQADVYDEFVERSVERAKKRVVGD  333

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQID EQF K+L YI SGK  GA L CGG     +GYFIQPT+F DV+++M
Sbjct  334  PFNLKTEQGPQIDQEQFNKILGYISSGKREGAKLMCGGGIAADRGYFIQPTVFGDVQDNM  393

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK ++EV+ RAN+T YGLAA V+T DIDKAN ++ GLRAGTVWI
Sbjct  394  TIAREEIFGPVMQILKFKTLEEVVTRANDTKYGLAAAVFTKDIDKANYVSSGLRAGTVWI  453

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV  142
            NCYDVF A  PFGGYK SG+GRE G Y L+NY +VK V 
Sbjct  454  NCYDVFGAQAPFGGYKASGVGRELGQYGLDNYTEVKTVT  492



>ref|XP_006178149.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Camelus 
ferus]
Length=384

 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IY EFVE++ ARA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEFVERSVARARSRVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+KVL YI+SGKE GA L CGG     +GYFIQPT+F DV++ M
Sbjct  218  PFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+
Sbjct  278  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWV  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYK+SG GRE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQSPFGGYKLSGNGRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_007529029.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X3 [Erinaceus 
europaeus]
Length=384

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYNEFVERSVARAKSRVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF KVL YI+SGKE GA L CGG     +GYFIQPT+F DVK+ M
Sbjct  218  PFDSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVKDGM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV++RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+
Sbjct  278  TIAKEEIFGPVMQILKFKTIEEVVERANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWV  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG  RE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQSPFGGYKMSGNCRELGEYGLQAYTEVKTVTVKVPQKN  383



>ref|XP_005080705.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Mesocricetus 
auratus]
Length=472

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+
Sbjct  246  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGN  305

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M
Sbjct  306  PFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGM  365

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWI
Sbjct  366  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWI  425

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  426  NCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKN  471



>ref|XP_004635978.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Octodon 
degus]
Length=474

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++ ARA  RVVG+
Sbjct  248  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYEEFVERSVARAKARVVGN  307

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV++ M
Sbjct  308  PFDSRTEQGPQVDESQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGM  367

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T DIDKAN L++ L+AGTVW+
Sbjct  368  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDIDKANYLSQALQAGTVWV  427

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  428  NCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKN  473



>ref|XP_004691129.1| PREDICTED: aldehyde dehydrogenase, mitochondrial isoform X2 [Condylura 
cristata]
Length=384

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = -3

Query  798  PFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGD  619
            P II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +Y+EFVE++  RA  RVVG+
Sbjct  158  PNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYNEFVERSVTRARSRVVGN  217

Query  618  PFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDM  439
            PF    EQGPQ+D  QF+K+L YI+SGKE GA L CGG     +GYFIQPT+F DV++ M
Sbjct  218  PFDSRTEQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGM  277

Query  438  VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI  259
             IA++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+
Sbjct  278  TIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWV  337

Query  258  NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN  127
            NCYDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct  338  NCYDVFGAQTPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKVPQKN  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195