BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051I04

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009605477.1|  PREDICTED: 40S ribosomal protein S11-like          289   7e-96   Nicotiana tomentosiformis
ref|XP_009610574.1|  PREDICTED: 40S ribosomal protein S11               287   4e-95   Nicotiana tomentosiformis
ref|XP_006450366.1|  hypothetical protein CICLE_v10009763mg             287   4e-95   Citrus clementina [clementine]
ref|XP_002526494.1|  40S ribosomal protein S11, putative                286   8e-95   Ricinus communis
ref|XP_009764798.1|  PREDICTED: 40S ribosomal protein S11               286   1e-94   Nicotiana sylvestris
gb|KDP30187.1|  hypothetical protein JCGZ_16969                         285   1e-94   Jatropha curcas
ref|XP_009611608.1|  PREDICTED: 40S ribosomal protein S11-like          285   2e-94   Nicotiana tomentosiformis
gb|KJB27059.1|  hypothetical protein B456_004G275200                    285   2e-94   Gossypium raimondii
ref|XP_002532505.1|  40S ribosomal protein S11, putative                285   2e-94   Ricinus communis
gb|KJB64607.1|  hypothetical protein B456_010G056800                    285   2e-94   Gossypium raimondii
ref|XP_011032811.1|  PREDICTED: 40S ribosomal protein S11               285   3e-94   Populus euphratica
ref|XP_007052409.1|  Ribosomal protein S11-beta isoform 2               284   6e-94   
gb|KDP33551.1|  hypothetical protein JCGZ_07122                         284   7e-94   Jatropha curcas
ref|XP_007013672.1|  Ribosomal protein S11-beta                         283   8e-94   
ref|XP_006375200.1|  40S ribosomal protein S11                          283   1e-93   Populus trichocarpa [western balsam poplar]
ref|XP_002325170.1|  40S ribosomal protein S11-2                        283   1e-93   Populus trichocarpa [western balsam poplar]
ref|XP_008800685.1|  PREDICTED: 40S ribosomal protein S11-like          283   1e-93   Phoenix dactylifera
gb|KJB23700.1|  hypothetical protein B456_004G110600                    283   2e-93   Gossypium raimondii
ref|XP_007155106.1|  hypothetical protein PHAVU_003G173800g             282   3e-93   Phaseolus vulgaris [French bean]
ref|XP_004241368.1|  PREDICTED: 40S ribosomal protein S11-like          282   3e-93   Solanum lycopersicum
ref|XP_003549708.1|  PREDICTED: 40S ribosomal protein S11-like          282   4e-93   Glycine max [soybeans]
emb|CDP18807.1|  unnamed protein product                                281   7e-93   Coffea canephora [robusta coffee]
ref|NP_001236968.1|  40S ribosomal protein S11                          281   1e-92   Glycine max [soybeans]
ref|XP_008809330.1|  PREDICTED: 40S ribosomal protein S11               280   1e-92   Phoenix dactylifera
ref|XP_007146683.1|  hypothetical protein PHAVU_006G060600g             280   1e-92   Phaseolus vulgaris [French bean]
ref|XP_002880547.1|  ribosomal protein S11-beta                         280   1e-92   Arabidopsis lyrata subsp. lyrata
gb|KJB22832.1|  hypothetical protein B456_004G068000                    280   1e-92   Gossypium raimondii
sp|Q9M5M1.1|RS11_EUPES  RecName: Full=40S ribosomal protein S11         280   2e-92   Euphorbia esula [wolf's milk]
ref|XP_003629390.1|  40S ribosomal protein S11                          280   2e-92   Medicago truncatula
ref|XP_007159633.1|  hypothetical protein PHAVU_002G254000g             280   2e-92   Phaseolus vulgaris [French bean]
ref|XP_011017934.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    280   3e-92   Populus euphratica
gb|KHG26586.1|  40S ribosomal S11                                       280   3e-92   Gossypium arboreum [tree cotton]
ref|XP_006296532.1|  hypothetical protein CARUB_v10025724mg             280   3e-92   Capsella rubella
ref|XP_010432945.1|  PREDICTED: 40S ribosomal protein S11-3-like        280   3e-92   Camelina sativa [gold-of-pleasure]
ref|XP_007052408.1|  Ribosomal protein S11-beta isoform 1               280   3e-92   
ref|XP_002301243.1|  40S ribosomal protein S11                          279   5e-92   Populus trichocarpa [western balsam poplar]
ref|XP_010665687.1|  PREDICTED: 40S ribosomal protein S11               279   7e-92   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB27060.1|  hypothetical protein B456_004G275200                    279   7e-92   Gossypium raimondii
dbj|BAK05865.1|  predicted protein                                      278   9e-92   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB83250.1|  hypothetical protein B456_013G237400                    278   1e-91   Gossypium raimondii
ref|XP_004138716.1|  PREDICTED: 40S ribosomal protein S11-3-like ...    278   1e-91   Cucumis sativus [cucumbers]
gb|KDP28900.1|  hypothetical protein JCGZ_14671                         278   1e-91   Jatropha curcas
ref|XP_006284663.1|  hypothetical protein CARUB_v10005922mg             278   2e-91   Capsella rubella
ref|XP_006659214.1|  PREDICTED: 40S ribosomal protein S11-like          277   2e-91   Oryza brachyantha
ref|XP_008445242.1|  PREDICTED: 40S ribosomal protein S11               277   2e-91   Cucumis melo [Oriental melon]
ref|XP_009407362.1|  PREDICTED: 40S ribosomal protein S11               277   3e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010914246.1|  PREDICTED: 40S ribosomal protein S11-like          277   3e-91   Elaeis guineensis
emb|CAK22271.1|  40S ribosomal protein S11                              277   3e-91   Oxybasis rubra [pigweed]
ref|XP_010904991.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    277   3e-91   Elaeis guineensis
ref|XP_011089115.1|  PREDICTED: 40S ribosomal protein S11-like          277   3e-91   Sesamum indicum [beniseed]
ref|XP_011081506.1|  PREDICTED: 40S ribosomal protein S11               277   3e-91   Sesamum indicum [beniseed]
ref|XP_007223638.1|  hypothetical protein PRUPE_ppa012659mg             277   3e-91   Prunus persica
gb|KFK41361.1|  hypothetical protein AALP_AA2G120000                    277   4e-91   Arabis alpina [alpine rockcress]
ref|XP_009355796.1|  PREDICTED: 40S ribosomal protein S11               277   4e-91   Pyrus x bretschneideri [bai li]
ref|XP_008378412.1|  PREDICTED: 40S ribosomal protein S11               277   4e-91   Malus domestica [apple tree]
ref|XP_011077210.1|  PREDICTED: 40S ribosomal protein S11-like          276   4e-91   Sesamum indicum [beniseed]
ref|XP_010557632.1|  PREDICTED: 40S ribosomal protein S11               276   4e-91   Tarenaya hassleriana [spider flower]
ref|XP_010542070.1|  PREDICTED: 40S ribosomal protein S11-like          276   5e-91   Tarenaya hassleriana [spider flower]
gb|AFK49430.1|  unknown                                                 276   7e-91   Lotus japonicus
ref|XP_010493497.1|  PREDICTED: 40S ribosomal protein S11-3             276   8e-91   Camelina sativa [gold-of-pleasure]
ref|XP_006404202.1|  hypothetical protein EUTSA_v10010781mg             276   1e-90   Eutrema salsugineum [saltwater cress]
ref|NP_001238157.1|  uncharacterized protein LOC100500186               275   1e-90   Glycine max [soybeans]
ref|XP_010533097.1|  PREDICTED: 40S ribosomal protein S11-like          275   1e-90   Tarenaya hassleriana [spider flower]
ref|XP_008776674.1|  PREDICTED: 40S ribosomal protein S11-like          275   1e-90   Phoenix dactylifera
ref|XP_011089695.1|  PREDICTED: 40S ribosomal protein S11               275   1e-90   Sesamum indicum [beniseed]
ref|XP_002874145.1|  ribosomal protein S11-beta                         275   1e-90   Arabidopsis lyrata subsp. lyrata
ref|XP_006288822.1|  hypothetical protein CARUB_v10002158mg             275   1e-90   Capsella rubella
ref|NP_001236713.1|  uncharacterized protein LOC100500094               275   2e-90   Glycine max [soybeans]
ref|XP_010927344.1|  PREDICTED: 40S ribosomal protein S11-like          275   2e-90   Elaeis guineensis
ref|XP_010421183.1|  PREDICTED: 40S ribosomal protein S11-3-like        275   2e-90   Camelina sativa [gold-of-pleasure]
ref|XP_002869362.1|  40S ribosomal protein S11                          275   2e-90   
gb|AAA32866.1|  ribosomal protein S11 (probable start codon at bp...    275   2e-90   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ94606.1|  predicted protein                                      275   3e-90   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004492502.1|  PREDICTED: 40S ribosomal protein S11-like          275   3e-90   Cicer arietinum [garbanzo]
ref|XP_006394638.1|  hypothetical protein EUTSA_v10005057mg             275   3e-90   Eutrema salsugineum [saltwater cress]
ref|XP_009130101.1|  PREDICTED: 40S ribosomal protein S11-3             275   3e-90   Brassica rapa
ref|XP_010941685.1|  PREDICTED: 40S ribosomal protein S11-like          275   3e-90   Elaeis guineensis
gb|KFK34189.1|  hypothetical protein AALP_AA5G112300                    274   4e-90   Arabis alpina [alpine rockcress]
gb|EEC83094.1|  hypothetical protein OsI_28229                          274   4e-90   Oryza sativa Indica Group [Indian rice]
ref|XP_006291971.1|  hypothetical protein CARUB_v10018158mg             274   5e-90   Capsella rubella
emb|CDX80385.1|  BnaC07g30590D                                          282   5e-90   
gb|KDO61813.1|  hypothetical protein CISIN_1g031480mg                   273   6e-90   Citrus sinensis [apfelsine]
ref|NP_197763.1|  40S ribosomal protein S11-3                           274   6e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392143.1|  PREDICTED: 40S ribosomal protein S11-like          273   7e-90   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29657.1|  hypothetical protein AALP_AA7G161800                    273   7e-90   Arabis alpina [alpine rockcress]
ref|XP_002877637.1|  EMB1080                                            273   9e-90   Arabidopsis lyrata subsp. lyrata
ref|XP_009141711.1|  PREDICTED: 40S ribosomal protein S11-3-like        273   9e-90   Brassica rapa
ref|XP_009150903.1|  PREDICTED: 40S ribosomal protein S11-3-like        273   1e-89   Brassica rapa
ref|XP_004252282.1|  PREDICTED: 40S ribosomal protein S11               273   1e-89   Solanum lycopersicum
ref|XP_007202693.1|  hypothetical protein PRUPE_ppa012656mg             273   1e-89   Prunus persica
ref|XP_003609505.1|  40S ribosomal protein S11                          273   1e-89   Medicago truncatula
gb|AFK38811.1|  unknown                                                 272   2e-89   Lotus japonicus
ref|XP_004287236.1|  PREDICTED: 40S ribosomal protein S11-like          272   3e-89   Fragaria vesca subsp. vesca
ref|XP_009151636.1|  PREDICTED: 40S ribosomal protein S11-3             272   3e-89   Brassica rapa
gb|KFK27670.1|  hypothetical protein AALP_AA8G413500                    272   3e-89   Arabis alpina [alpine rockcress]
ref|NP_190462.1|  40S ribosomal protein S11-1                           272   3e-89   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194809.1|  40S ribosomal protein S11-2                           272   3e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002454168.1|  hypothetical protein SORBIDRAFT_04g025870          271   4e-89   
ref|XP_004288615.1|  PREDICTED: 40S ribosomal protein S11               271   6e-89   Fragaria vesca subsp. vesca
ref|XP_010240412.1|  PREDICTED: 40S ribosomal protein S11               271   6e-89   Brachypodium distachyon [annual false brome]
ref|XP_009149784.1|  PREDICTED: 40S ribosomal protein S11-3-like ...    271   7e-89   Brassica rapa
emb|CDX88047.1|  BnaA06g26380D                                          273   7e-89   
ref|XP_008447825.1|  PREDICTED: 40S ribosomal protein S11-like          271   7e-89   Cucumis melo [Oriental melon]
ref|XP_004953088.1|  PREDICTED: 40S ribosomal protein S11-like is...    271   7e-89   Setaria italica
ref|XP_006361121.1|  PREDICTED: 40S ribosomal protein S11-like          271   7e-89   Solanum tuberosum [potatoes]
ref|XP_008813136.1|  PREDICTED: 40S ribosomal protein S11-like          271   8e-89   Phoenix dactylifera
emb|CDY64632.1|  BnaCnng44460D                                          273   8e-89   Brassica napus [oilseed rape]
gb|AFX66997.1|  40s ribosomal protein S11                               270   1e-88   Solanum tuberosum [potatoes]
ref|XP_009398660.1|  PREDICTED: 40S ribosomal protein S11-like          270   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001053235.1|  Os04g0502300                                       270   2e-88   
emb|CDY05882.1|  BnaC08g20590D                                          270   2e-88   
ref|XP_004144894.1|  PREDICTED: 40S ribosomal protein S11-3-like        270   2e-88   
ref|XP_009358523.1|  PREDICTED: 40S ribosomal protein S11-like          270   2e-88   Pyrus x bretschneideri [bai li]
pdb|3J60|L  Chain L, Localization Of The Small Subunit Ribosomal ...    269   3e-88   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009405706.1|  PREDICTED: 40S ribosomal protein S11-like          269   3e-88   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16867.1|  BnaA09g05150D                                          269   4e-88   Brassica napus [oilseed rape]
gb|ACG35231.1|  40S ribosomal protein S11                               268   7e-88   Zea mays [maize]
ref|NP_001146950.1|  40S ribosomal protein S11                          268   1e-87   
emb|CDY44261.1|  BnaC02g41560D                                          268   1e-87   Brassica napus [oilseed rape]
ref|XP_006586636.1|  PREDICTED: uncharacterized protein LOC100500...    268   1e-87   
ref|XP_008336943.1|  PREDICTED: 40S ribosomal protein S11-like          268   1e-87   
ref|XP_009410372.1|  PREDICTED: 40S ribosomal protein S11-like          267   2e-87   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89702.1|  predicted protein                                      267   2e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008219543.1|  PREDICTED: 40S ribosomal protein S11               265   2e-86   Prunus mume [ume]
ref|XP_004953087.1|  PREDICTED: 40S ribosomal protein S11-like is...    265   2e-86   
ref|XP_003575346.1|  PREDICTED: 40S ribosomal protein S11-like          265   2e-86   Brachypodium distachyon [annual false brome]
gb|EMS61594.1|  40S ribosomal protein S11                               265   2e-86   Triticum urartu
gb|AFK46727.1|  unknown                                                 263   5e-86   Lotus japonicus
gb|AAA32867.1|  ribosomal protein S11                                   264   5e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349147.1|  PREDICTED: 40S ribosomal protein S11-like          264   5e-86   
ref|XP_003573544.1|  PREDICTED: 40S ribosomal protein S11-like is...    263   6e-86   Brachypodium distachyon [annual false brome]
gb|EAY94752.1|  hypothetical protein OsI_16531                          263   7e-86   Oryza sativa Indica Group [Indian rice]
gb|ABK22030.1|  unknown                                                 262   2e-85   Picea sitchensis
ref|XP_007011791.1|  Ribosomal protein S11-beta                         263   2e-85   
ref|XP_006652811.1|  PREDICTED: 40S ribosomal protein S11-like          262   3e-85   Oryza brachyantha
ref|XP_003589042.1|  40S ribosomal protein S11                          261   5e-85   Medicago truncatula
ref|NP_001060007.1|  Os07g0565000                                       261   5e-85   
ref|XP_004976788.1|  PREDICTED: 40S ribosomal protein S11-like          261   6e-85   Setaria italica
ref|XP_010687771.1|  PREDICTED: 40S ribosomal protein S11-3             260   9e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009362323.1|  PREDICTED: 40S ribosomal protein S11-like          261   2e-84   
ref|XP_010234462.1|  PREDICTED: 40S ribosomal protein S11-like is...    260   2e-84   
tpg|DAA37074.1|  TPA: 40S ribosomal protein S11                         273   2e-84   
ref|NP_001105562.1|  40S ribosomal protein S11                          259   2e-84   Zea mays [maize]
ref|XP_009149783.1|  PREDICTED: 40S ribosomal protein S11-3-like ...    257   3e-83   Brassica rapa
gb|EMT05895.1|  40S ribosomal protein S11                               257   4e-83   
ref|XP_010245616.1|  PREDICTED: 40S ribosomal protein S11-like          255   2e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010266772.1|  PREDICTED: 40S ribosomal protein S11               254   2e-82   Nelumbo nucifera [Indian lotus]
ref|XP_002267523.1|  PREDICTED: 40S ribosomal protein S11               254   2e-82   Vitis vinifera
ref|XP_006856463.1|  hypothetical protein AMTR_s00046p00028310          256   2e-82   
ref|XP_002285422.1|  PREDICTED: 40S ribosomal protein S11               254   4e-82   Vitis vinifera
gb|EMT19025.1|  40S ribosomal protein S11                               255   6e-82   
dbj|BAC22544.1|  putative 40S ribosomal protein S11                     253   1e-81   Oryza sativa Japonica Group [Japonica rice]
gb|KCW50239.1|  hypothetical protein EUGRSUZ_J00035                     253   3e-81   Eucalyptus grandis [rose gum]
ref|XP_006852797.1|  hypothetical protein AMTR_s00033p00158320          251   5e-81   Amborella trichopoda
gb|AAA34006.1|  ribosomal protein S11                                   250   5e-81   Glycine max [soybeans]
gb|EYU32366.1|  hypothetical protein MIMGU_mgv1a015357mg                249   4e-80   Erythranthe guttata [common monkey flower]
gb|EEE68230.1|  hypothetical protein OsJ_26414                          260   5e-80   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37073.1|  TPA: hypothetical protein ZEAMMB73_529952              260   1e-79   
ref|XP_001761870.1|  predicted protein                                  246   3e-79   
emb|CAE05213.3|  OSJNBa0070C17.20                                       246   7e-79   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20229.1|  hypothetical protein MIMGU_mgv1a015021mg                246   9e-79   Erythranthe guttata [common monkey flower]
ref|XP_001756109.1|  predicted protein                                  245   9e-79   
ref|XP_010048926.1|  PREDICTED: 40S ribosomal protein S11-like          245   1e-78   Eucalyptus grandis [rose gum]
ref|XP_010030990.1|  PREDICTED: 40S ribosomal protein S11               244   2e-78   Eucalyptus grandis [rose gum]
ref|XP_008242908.1|  PREDICTED: 40S ribosomal protein S11-like          244   2e-78   Prunus mume [ume]
ref|XP_009338409.1|  PREDICTED: 40S ribosomal protein S11-like          240   9e-77   Pyrus x bretschneideri [bai li]
ref|XP_002982779.1|  hypothetical protein SELMODRAFT_268639             237   2e-75   Selaginella moellendorffii
gb|KDO61816.1|  hypothetical protein CISIN_1g031480mg                   234   1e-74   Citrus sinensis [apfelsine]
gb|KHG16468.1|  40S ribosomal S11                                       232   6e-74   Gossypium arboreum [tree cotton]
gb|AEI83509.1|  40S ribosomal protein S11                               230   4e-73   Wolffia arrhiza
ref|XP_010904992.1|  PREDICTED: 40S ribosomal protein S11 isoform X2    229   6e-73   Elaeis guineensis
ref|XP_004138715.1|  PREDICTED: 40S ribosomal protein S11-3-like ...    226   2e-71   
emb|CDX96205.1|  BnaC02g14460D                                          223   4e-70   
ref|XP_005643310.1|  ribosomal protein S11 component of cytosolic...    221   3e-69   Coccomyxa subellipsoidea C-169
ref|XP_002501446.1|  ribosomal protein                                  219   2e-68   Micromonas commoda
ref|XP_001418420.1|  Ribosomal protein S11, component of cytosoli...    219   2e-68   Ostreococcus lucimarinus CCE9901
gb|KDO61815.1|  hypothetical protein CISIN_1g031480mg                   218   2e-68   Citrus sinensis [apfelsine]
ref|XP_006450367.1|  hypothetical protein CICLE_v10009763mg             217   2e-68   
ref|XP_010417155.1|  PREDICTED: 40S ribosomal protein S11-1-like ...    218   3e-68   Camelina sativa [gold-of-pleasure]
gb|KJB23701.1|  hypothetical protein B456_004G110600                    215   1e-67   Gossypium raimondii
emb|CEF98300.1|  Ribosomal protein S17                                  215   5e-67   Ostreococcus tauri
ref|XP_001702980.1|  ribosomal protein S11, component of cytosoli...    215   5e-67   Chlamydomonas reinhardtii
ref|XP_002947898.1|  component of cytosolic 80S ribosome and 40S ...    215   7e-67   Volvox carteri f. nagariensis
ref|XP_005842843.1|  hypothetical protein CHLNCDRAFT_37706              214   1e-66   Chlorella variabilis
ref|XP_003059480.1|  predicted protein                                  213   3e-66   Micromonas pusilla CCMP1545
sp|P42756.1|RS11_DUNTE  RecName: Full=40S ribosomal protein S11         210   4e-65   Dunaliella tertiolecta
gb|ABD64589.1|  40S ribosomal protein S11                               210   4e-65   Chlamydomonas sp. ICE-L
ref|XP_002841871.1|  40S ribosomal protein S11                          210   5e-65   Tuber melanosporum Mel28
ref|XP_006573320.1|  PREDICTED: 40S ribosomal protein S11-like          208   1e-64   
ref|XP_011399858.1|  40S ribosomal protein S11                          207   5e-64   Auxenochlorella protothecoides
gb|EMF17289.1|  40S ribosomal protein S11                               207   1e-63   Sphaerulina musiva SO2202
gb|KFY68897.1|  hypothetical protein V496_00720                         206   1e-63   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KFY96632.1|  hypothetical protein V500_02366                         206   2e-63   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|ESX00172.1|  40S ribosomal protein S11-A                             206   2e-63   Ogataea parapolymorpha DL-1
gb|ELR05457.1|  40S ribosomal protein S11                               206   2e-63   Pseudogymnoascus destructans 20631-21
gb|EHK40336.1|  hypothetical protein TRIATDRAFT_302714                  206   2e-63   Trichoderma atroviride IMI 206040
gb|KFY00910.1|  hypothetical protein O988_03033                         206   2e-63   Pseudogymnoascus sp. VKM F-3808
gb|KFY15274.1|  hypothetical protein V492_02114                         209   2e-63   Pseudogymnoascus sp. VKM F-4246
gb|KFZ16779.1|  hypothetical protein V502_04895                         206   2e-63   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
emb|CCQ18653.1|  40S ribosomal protein S11                              206   3e-63   Sycon ciliatum
emb|CCT63377.1|  probable 40s ribosomal protein s11.e, cytosolic        206   3e-63   Fusarium fujikuroi IMI 58289
gb|EMT61393.1|  40S ribosomal protein S11-B                             206   4e-63   Fusarium oxysporum f. sp. cubense race 4
gb|KFY31291.1|  hypothetical protein V493_01246                         205   5e-63   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_006696347.1|  40S ribosomal protein S11-like protein             205   6e-63   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KEZ42227.1|  hypothetical protein SAPIO_CDS6080                      205   6e-63   Scedosporium apiospermum
ref|XP_002901699.1|  40S ribosomal protein S11                          204   7e-63   Phytophthora infestans T30-4
emb|CCA19404.1|  40S ribosomal protein S11 putative                     204   7e-63   Albugo laibachii Nc14
gb|EYB33503.1|  hypothetical protein FG05_00671                         205   8e-63   Fusarium graminearum
gb|EHK25200.1|  hypothetical protein TRIVIDRAFT_79227                   204   8e-63   Trichoderma virens Gv29-8
ref|XP_001560156.1|  40S ribosomal protein S11                          204   8e-63   Botrytis cinerea B05.10
gb|KHN96715.1|  40S ribosomal protein S11                               205   9e-63   Metarhizium album ARSEF 1941
ref|XP_008610788.1|  40S ribosomal protein S11                          204   1e-62   Saprolegnia diclina VS20
gb|KFG78441.1|  40S ribosomal protein S11                               204   1e-62   Metarhizium anisopliae
ref|XP_003382520.1|  PREDICTED: 40S ribosomal protein S11-like          204   1e-62   Amphimedon queenslandica
ref|XP_006966565.1|  hypothetical protein TRIREDRAFT_122587             204   1e-62   Trichoderma reesei QM6a
emb|CCI40506.1|  unnamed protein product                                204   1e-62   Albugo candida
ref|XP_003659345.1|  hypothetical protein MYCTH_2088473                 204   1e-62   Thermothelomyces thermophila ATCC 42464
ref|XP_009252037.1|  hypothetical protein FPSE_00642                    205   1e-62   Fusarium pseudograminearum CS3096
gb|EXV02037.1|  40S ribosomal protein S17                               204   1e-62   Metarhizium robertsii
ref|XP_011316367.1|  40S ribosomal protein S11                          204   1e-62   Fusarium graminearum PH-1
ref|XP_003716203.1|  40S ribosomal protein S11                          204   2e-62   Magnaporthe oryzae 70-15
gb|KHJ35420.1|  putative 40s ribosomal protein s11                      204   2e-62   Erysiphe necator
ref|XP_002791628.1|  40S ribosomal protein S11                          204   2e-62   Paracoccidioides lutzii Pb01
gb|KIE01292.1|  Ribosomal protein S17                                   204   2e-62   Metarhizium majus ARSEF 297
gb|KID89820.1|  Ribosomal protein S17                                   204   2e-62   Metarhizium guizhouense ARSEF 977
gb|EPE10077.1|  40s ribosomal protein s11                               203   2e-62   Ophiostoma piceae UAMH 11346
ref|XP_007797900.1|  putative 40s ribosomal protein s11 protein         203   2e-62   
ref|XP_007920165.1|  hypothetical protein MYCFIDRAFT_55564              203   2e-62   Pseudocercospora fijiensis CIRAD86
ref|XP_002491500.1|  40S ribosomal protein S11                          203   2e-62   Komagataella phaffii GS115
gb|EPQ62013.1|  Protein component of the small (40S) ribosomal su...    203   2e-62   Blumeria graminis f. sp. tritici 96224
ref|XP_007292620.1|  40S ribosomal protein S11                          203   2e-62   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KIL84538.1|  40s ribosomal protein s11                               204   3e-62   Fusarium avenaceum
ref|XP_008860970.1|  archaeal ribosomal protein S17P                    203   3e-62   Aphanomyces invadans
emb|CEF72646.1|  unnamed protein product                                203   3e-62   
gb|EFW99488.1|  40S ribosomal protein s11                               203   3e-62   Grosmannia clavigera kw1407
ref|XP_964961.1|  40S ribosomal protein S11                             203   3e-62   Neurospora crassa OR74A
ref|XP_002542812.1|  40S ribosomal protein S11                          203   3e-62   Uncinocarpus reesii 1704
ref|XP_003652243.1|  40S ribosomal protein S11                          203   4e-62   Thielavia terrestris NRRL 8126
ref|XP_009830155.1|  archaeal ribosomal protein S17P                    203   4e-62   Aphanomyces astaci
ref|XP_002158762.1|  PREDICTED: 40S ribosomal protein S11-like          202   4e-62   Hydra vulgaris
ref|XP_009224414.1|  40S ribosomal protein S11                          203   4e-62   Gaeumannomyces tritici R3-111a-1
ref|XP_002620373.1|  40S ribosomal protein S11                          203   4e-62   Blastomyces gilchristii SLH14081
gb|EWG36522.1|  40S ribosomal protein S11                               203   4e-62   Fusarium verticillioides 7600
gb|KFY15673.1|  hypothetical protein V491_05601                         203   4e-62   Pseudogymnoascus sp. VKM F-3775
ref|XP_007276194.1|  40s ribosomal protein s11                          202   4e-62   
ref|XP_002483612.1|  40S ribosomal protein S11                          202   5e-62   Talaromyces stipitatus ATCC 10500
ref|XP_003170224.1|  40S ribosomal protein S11                          202   5e-62   Nannizzia gypsea CBS 118893
ref|XP_002849541.1|  40S ribosomal protein S11                          202   5e-62   Microsporum canis CBS 113480
ref|XP_007914554.1|  putative 40s ribosomal protein s11 protein         202   6e-62   Phaeoacremonium minimum UCRPA7
gb|ERT02285.1|  40S ribosomal protein S11                               202   6e-62   Sporothrix schenckii ATCC 58251
gb|KIH88584.1|  small subunit ribosomal protein S11e                    202   7e-62   Sporothrix brasiliensis 5110
ref|XP_003348336.1|  40S ribosomal protein S11                          202   7e-62   Sordaria macrospora k-hell
ref|XP_001240883.1|  40S ribosomal protein S11                          202   7e-62   Coccidioides immitis RS
ref|XP_001272771.1|  40S ribosomal protein S11                          202   8e-62   Aspergillus clavatus NRRL 1
ref|XP_007813619.1|  40S ribosomal protein S11                          204   8e-62   Metarhizium acridum CQMa 102
ref|XP_008595076.1|  40S ribosomal protein S11                          203   8e-62   Beauveria bassiana ARSEF 2860
gb|KIM97508.1|  hypothetical protein OIDMADRAFT_20590                   202   9e-62   Oidiodendron maius Zn
gb|AAX48887.1|  S11                                                     202   9e-62   Suberites domuncula
ref|XP_001537464.1|  40S ribosomal protein S11                          202   9e-62   Histoplasma capsulatum NAm1
emb|CEJ89080.1|  Putative 40S ribosomal protein S11                     202   1e-61   Torrubiella hemipterigena
ref|XP_001908839.1|  hypothetical protein                               202   1e-61   Podospora anserina S mat+
ref|XP_008723287.1|  40S ribosomal protein S11                          202   1e-61   Cladophialophora carrionii CBS 160.54
ref|XP_007753775.1|  40S ribosomal protein S11                          201   1e-61   Cladophialophora yegresii CBS 114405
ref|XP_010911231.1|  PREDICTED: 40S ribosomal protein S11-like          200   1e-61   
dbj|GAM38479.1|  40S ribosomal protein                                  201   2e-61   Talaromyces cellulolyticus
ref|XP_001589541.1|  40S ribosomal protein S11                          201   2e-61   Sclerotinia sclerotiorum 1980 UF-70
gb|KIX00453.1|  40S ribosomal protein S11                               201   2e-61   Rhinocladiella mackenziei CBS 650.93
ref|XP_008719121.1|  40S ribosomal protein S11                          201   2e-61   Cyphellophora europaea CBS 101466
gb|ESZ94422.1|  40S ribosomal protein S11                               201   2e-61   Sclerotinia borealis F-4128
gb|EIF46030.1|  40s ribosomal protein s11                               201   2e-61   Brettanomyces bruxellensis AWRI1499
gb|KDD74259.1|  hypothetical protein H632_c1451p1                       201   2e-61   Helicosporidium sp. ATCC 50920
ref|XP_662826.1|  hypothetical protein AN5222.2                         201   2e-61   Aspergillus nidulans FGSC A4
ref|XP_003233956.1|  40S ribosomal protein S11                          201   3e-61   Trichophyton rubrum CBS 118892
ref|XP_007597210.1|  ribosomal protein S17                              201   3e-61   
ref|XP_007840090.1|  40S ribosomal protein S11-B                        201   3e-61   Pestalotiopsis fici W106-1
ref|XP_001260046.1|  40S ribosomal protein S11                          201   3e-61   Aspergillus fischeri NRRL 181
gb|KIX93783.1|  40S ribosomal protein S11                               201   3e-61   Fonsecaea multimorphosa CBS 102226
gb|KIW98718.1|  40S ribosomal protein S11                               201   3e-61   Cladophialophora bantiana CBS 173.52
emb|CAA06411.1|  40S ribosomal protein S11                              201   3e-61   Cyanophora paradoxa
ref|XP_002150585.1|  40S ribosomal protein S11                          201   3e-61   
gb|KIV94214.1|  40S ribosomal protein S11                               200   4e-61   
gb|KIW17565.1|  40S ribosomal protein S11                               200   4e-61   
gb|KIW42686.1|  40S ribosomal protein S11                               200   4e-61   
gb|EFQ25346.1|  ribosomal protein S17                                   200   4e-61   
gb|KIW72189.1|  40S ribosomal protein S11                               200   4e-61   
ref|XP_009152832.1|  40S ribosomal protein S11                          200   4e-61   
ref|XP_008084795.1|  Nucleic acid-binding protein                       200   5e-61   
ref|XP_010099867.1|  40S ribosomal protein S11                          201   6e-61   
ref|XP_007735993.1|  40S ribosomal protein S11                          200   6e-61   
ref|XP_007739187.1|  40S ribosomal protein S11                          200   7e-61   
ref|XP_003005854.1|  40S ribosomal protein S11                          199   7e-61   
ref|XP_009648215.1|  40S ribosomal protein S11                          199   7e-61   
gb|KEQ70704.1|  putative 40S ribosomal protein S11-B                    199   7e-61   
gb|KEY65160.1|  hypothetical protein S7711_04250                        201   7e-61   
ref|XP_003053807.1|  40S ribosomal protein S11                          199   7e-61   
emb|CCF41628.1|  40S ribosomal protein S11                              199   8e-61   
gb|EGE06855.1|  40S ribosomal protein S11                               199   9e-61   
gb|KIW80430.1|  40S ribosomal protein S11                               199   9e-61   
ref|XP_007728122.1|  40S ribosomal protein S11                          199   1e-60   
gb|EQK97980.1|  Ribosomal protein S17                                   202   1e-60   
gb|EKG21256.1|  Ribosomal protein S17                                   199   1e-60   
emb|CCE33266.1|  probable 40s ribosomal protein s11.e, cytosolic        199   1e-60   
ref|XP_001383352.1|  40S ribosomal protein S11                          199   1e-60   
gb|KIW61958.1|  40S ribosomal protein S11                               199   1e-60   
gb|AGH70195.1|  40S ribosomal protein S11                               199   1e-60   
gb|KIW30255.1|  40S ribosomal protein S11                               199   1e-60   
gb|KEQ63360.1|  40S ribosomal protein S11                               199   1e-60   
ref|NP_001155823.1|  40S ribosomal protein S11                          198   2e-60   
gb|EZF24359.1|  40S ribosomal protein S11                               203   2e-60   
ref|XP_002373689.1|  40S ribosomal protein S11                          199   2e-60   
gb|ABM55589.1|  putative ribosomal protein S11                          198   2e-60   
emb|CDX91453.1|  BnaC04g06970D                                          201   2e-60   
ref|XP_001803831.1|  hypothetical protein SNOG_13626                    198   2e-60   
ref|XP_001030186.1|  ribosomal protein S17 containing protein           198   2e-60   
ref|XP_007716446.1|  hypothetical protein COCCADRAFT_29638              198   2e-60   
gb|EGU78363.1|  hypothetical protein FOXB_11114                         198   3e-60   
emb|CCX31886.1|  Similar to 40S ribosomal protein S11-A; acc. no....    198   3e-60   
ref|XP_001941535.1|  40S ribosomal protein S11                          198   3e-60   
ref|XP_007803015.1|  40S ribosomal protein S11                          198   3e-60   
gb|EPS30252.1|  hypothetical protein PDE_05203                          198   3e-60   
ref|XP_007579944.1|  putative 40s ribosomal protein s11 protein         198   3e-60   
dbj|GAD94975.1|  40S ribosomal protein S11                              198   3e-60   
ref|XP_007684806.1|  hypothetical protein COCMIDRAFT_2527               198   3e-60   
ref|XP_001391959.1|  40S ribosomal protein S11                          197   4e-60   
ref|XP_003302475.1|  40S ribosomal protein S11                          197   4e-60   
ref|XP_001639879.1|  predicted protein                                  197   4e-60   
emb|CDR41874.1|  CYFA0S08e01046g1_1                                     197   4e-60   
ref|XP_007699400.1|  hypothetical protein COCSADRAFT_170685             197   4e-60   
ref|XP_004032536.1|  hypothetical protein IMG5_120550                   197   4e-60   
ref|XP_004040146.1|  hypothetical protein IMG5_000700                   197   4e-60   
ref|XP_002115583.1|  expressed hypothetical protein                     197   4e-60   
ref|XP_011276817.1|  40S ribosomal protein S11                          197   5e-60   
gb|EWC44663.1|  40S ribosomal protein S11-B                             197   6e-60   
ref|XP_007777835.1|  40S ribosomal protein S11                          197   6e-60   
ref|XP_003853041.1|  40S ribosomal protein S11                          197   7e-60   
ref|XP_007678236.1|  hypothetical protein BAUCODRAFT_74231              197   7e-60   
gb|KEQ97871.1|  hypothetical protein AUEXF2481DRAFT_63329               197   7e-60   
ref|XP_011412459.1|  PREDICTED: 40S ribosomal protein S11-like          197   7e-60   
ref|XP_008028385.1|  hypothetical protein SETTUDRAFT_155266             197   8e-60   
ref|XP_003323062.2|  40S ribosomal protein S11                          197   9e-60   
ref|XP_003834224.1|  similar to 40S ribosomal protein S11               197   9e-60   
ref|XP_001212847.1|  40S ribosomal protein S11                          196   1e-59   
gb|EYU20230.1|  hypothetical protein MIMGU_mgv1a015021mg                195   1e-59   
gb|EMG47972.1|  Protein component of the small (40S) ribosomal su...    196   2e-59   
gb|KIW07379.1|  40S ribosomal protein S11                               196   2e-59   
gb|KEF63246.1|  40S ribosomal protein S11                               196   2e-59   
gb|KIV78116.1|  40S ribosomal protein S11                               196   2e-59   
ref|XP_011117184.1|  hypothetical protein AOL_s00004g232                196   2e-59   
ref|XP_004196145.1|  Piso0_005592                                       195   3e-59   
ref|XP_007408686.1|  hypothetical protein MELLADRAFT_35136              195   4e-59   
gb|EME48396.1|  hypothetical protein DOTSEDRAFT_39766                   195   4e-59   
ref|XP_004195051.1|  Piso0_005592                                       195   4e-59   
gb|AEB54646.1|  ribosomal protein S11                                   195   4e-59   
ref|XP_003148073.1|  40S ribosomal protein S11                          195   4e-59   
gb|ERG79209.1|  40s ribosomal protein s11                               195   5e-59   
emb|CDR37295.1|  RHTO0S02e13058g1_1                                     194   5e-59   
ref|XP_010991488.1|  PREDICTED: 40S ribosomal protein S11               195   6e-59   
ref|XP_008780472.1|  PREDICTED: 40S ribosomal protein S11-like          193   6e-59   
ref|XP_459891.2|  40S ribosomal protein S11                             194   6e-59   
ref|XP_002420385.1|  40S ribosomal protein S11                          194   9e-59   
gb|ABR27861.1|  40S ribosomal protein S11                               195   9e-59   
gb|EFO65054.1|  Ribosomal protein S11                                   196   9e-59   
ref|XP_007003936.1|  hypothetical protein TREMEDRAFT_38602              194   9e-59   
dbj|GAM84330.1|  hypothetical protein ANO11243_023240                   194   9e-59   
gb|ADV03049.1|  ribosomal protein S11                                   194   1e-58   
ref|XP_007941031.1|  PREDICTED: 40S ribosomal protein S11               194   1e-58   
gb|EES99335.1|  Ribosomal protein S11                                   195   1e-58   
ref|XP_011109774.1|  hypothetical protein H072_3813                     194   1e-58   
ref|XP_008470793.1|  PREDICTED: 40S ribosomal protein S11 isoform X2    193   1e-58   
ref|XP_001898199.1|  40S ribosomal protein S11                          194   2e-58   
ref|XP_001492034.1|  PREDICTED: 40S ribosomal protein S11               194   2e-58   
ref|XP_007375354.1|  hypothetical protein SPAPADRAFT_61162              193   2e-58   
ref|XP_003646733.1|  hypothetical protein Ecym_5139                     193   2e-58   
gb|ABZ04263.1|  ribosomal protein rps11                                 193   2e-58   
ref|XP_001363138.1|  PREDICTED: 40S ribosomal protein S11               193   2e-58   
ref|XP_007879931.1|  hypothetical protein PFL1_04217                    193   2e-58   
gb|ESU42993.1|  SSU ribosomal protein S17P                              196   2e-58   
ref|XP_005689754.1|  PREDICTED: 40S ribosomal protein S11-like          193   2e-58   
gb|KHN77184.1|  40S ribosomal protein S11                               193   2e-58   
gb|AAN05599.1|  ribosomal protein S11                                   193   2e-58   
ref|NP_001080676.1|  40S ribosomal protein S11                          193   2e-58   
ref|XP_011387322.1|  ribosomal 40S subunit protein S11                  193   2e-58   
gb|AII98113.1|  BLTX795                                                 193   3e-58   
ref|XP_001704539.1|  Ribosomal protein S11                              193   3e-58   
sp|P41115.1|RS11_XENLA  RecName: Full=40S ribosomal protein S11         193   3e-58   
ref|XP_003700346.1|  PREDICTED: 40S ribosomal protein S11-like          192   3e-58   
emb|CBQ70729.1|  probable RPS11B-ribosomal protein S11B                 193   3e-58   
ref|XP_008120642.1|  PREDICTED: 40S ribosomal protein S11               193   3e-58   
ref|NP_001019739.1|  40S ribosomal protein S11                          192   3e-58   
gb|AAX29372.1|  ribosomal protein S11                                   192   3e-58   
dbj|GAC96927.1|  40S ribosomal protein S11                              192   3e-58   
ref|NP_001006.1|  40S ribosomal protein S11                             192   3e-58   
ref|XP_002766754.1|  40S ribosomal protein S11, putative                192   3e-58   
emb|CDI52247.1|  probable RPS11B-ribosomal protein S11B                 192   4e-58   
gb|AII97645.1|  BLTX251                                                 192   4e-58   
ref|XP_011339198.1|  PREDICTED: 40S ribosomal protein S11               192   4e-58   
dbj|BAM17738.1|  ribosomal protein S11                                  192   4e-58   
gb|EFX82959.1|  hypothetical protein DAPPUDRAFT_230714                  192   5e-58   
ref|NP_001026004.1|  40S ribosomal protein S11                          192   5e-58   
ref|XP_006688012.1|  hypothetical protein CANTEDRAFT_125064             192   5e-58   
gb|ETS62508.1|  hypothetical protein PaG_03140                          192   5e-58   
gb|EST06106.1|  40S ribosomal protein S11                               192   5e-58   
ref|XP_005230846.1|  PREDICTED: 40S ribosomal protein S11-like          192   6e-58   
ref|NP_001279140.1|  ribosomal protein S11                              192   6e-58   
gb|AFM87671.1|  40S ribosomal protein S11                               192   6e-58   
ref|XP_011053203.1|  PREDICTED: 40S ribosomal protein S11-like          192   6e-58   
emb|CCF54522.1|  probable RPS11B-ribosomal protein S11B                 192   6e-58   
gb|EJY85778.1|  40S ribosomal protein rpS11e                            192   7e-58   
ref|XP_011305230.1|  PREDICTED: 40S ribosomal protein S11               192   7e-58   
gb|KGO41315.1|  Nucleic acid-binding, OB-fold                           192   7e-58   
gb|ACY71278.1|  ribosomal protein S11                                   191   8e-58   
gb|ELK29561.1|  40S ribosomal protein S11                               192   8e-58   
gb|ESU37578.1|  SSU ribosomal protein S17P                              194   8e-58   
sp|Q9XSU4.2|RS11_CANFA  RecName: Full=40S ribosomal protein S11         191   9e-58   
gb|EKV08075.1|  40S ribosomal protein S11                               191   9e-58   
ref|XP_002552563.1|  40S ribosomal protein S11                          191   1e-57   
ref|NP_001005113.1|  ribosomal protein S11                              191   1e-57   
ref|XP_003395706.1|  PREDICTED: 40S ribosomal protein S11-like          191   1e-57   
gb|KGK36959.1|  hypothetical protein JL09_g3891                         191   1e-57   
gb|KFM09336.1|  40S ribosomal protein S11                               191   1e-57   
ref|XP_005996772.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    193   1e-57   
gb|ADV03029.1|  ribosomal protein S11                                   191   1e-57   
gb|AAO92287.1|  40S ribosomal protein S11                               191   1e-57   
gb|KGL93721.1|  40S ribosomal protein S11                               191   1e-57   
ref|XP_007558258.1|  PREDICTED: 40S ribosomal protein S11               192   1e-57   
gb|ABI52698.1|  40S ribosomal protein S11                               191   1e-57   
ref|NP_001232080.1|  putative ribosomal protein S11                     191   1e-57   
ref|XP_006262496.1|  PREDICTED: 40S ribosomal protein S11-like          191   1e-57   
gb|ABR23471.1|  40S ribosomal protein S11                               191   1e-57   
gb|AFM86650.1|  putative ribosomal protein S11                          191   1e-57   
ref|XP_005702733.1|  40S ribosomal protein S11e                         191   2e-57   
gb|KIK70963.1|  hypothetical protein GYMLUDRAFT_33052                   191   2e-57   
ref|XP_002562448.1|  Pc18g06210                                         191   2e-57   
ref|XP_003037299.1|  40S ribosomal protein S11                          191   2e-57   
ref|XP_006614024.1|  PREDICTED: 40S ribosomal protein S11-like is...    192   2e-57   
gb|ELK28586.1|  40S ribosomal protein S11                               194   2e-57   
ref|XP_003279788.1|  PREDICTED: 40S ribosomal protein S11-like is...    191   2e-57   
ref|XP_003696299.1|  PREDICTED: 40S ribosomal protein S11-like          191   2e-57   
gb|EPQ03678.1|  40S ribosomal protein S11                               190   2e-57   
ref|XP_005037104.1|  PREDICTED: 40S ribosomal protein S11-like is...    191   2e-57   
gb|ADT80670.1|  ribosomal protein S11 isoform 2                         190   2e-57   
gb|AGO10364.1|  AaceriABL091Cp                                          190   2e-57   
emb|CDM33409.1|  Ribosomal protein S17                                  191   3e-57   
gb|ADT80671.1|  ribosomal protein S11 isoform 1                         190   3e-57   
dbj|BAN20146.1|  ribosomal protein S11                                  190   3e-57   
ref|XP_008934728.1|  PREDICTED: 40S ribosomal protein S11               191   3e-57   
emb|CAJ17183.1|  ribosomal protein S11e                                 190   3e-57   
gb|KIY64191.1|  hypothetical protein CYLTODRAFT_381196                  190   3e-57   
gb|AAY66952.1|  40S ribosomal protein S11                               190   3e-57   
gb|KFQ26180.1|  40S ribosomal protein S11                               190   3e-57   
ref|XP_002750334.1|  PREDICTED: 40S ribosomal protein S11-like          190   3e-57   
gb|AEL28851.1|  ribosomal protein S11                                   190   3e-57   
ref|XP_008470786.1|  PREDICTED: 40S ribosomal protein S11 isoform X1    190   3e-57   
ref|XP_011498635.1|  PREDICTED: 40S ribosomal protein S11               190   4e-57   
ref|XP_451459.1|  40S ribosomal protein S11                             190   4e-57   
ref|XP_010791578.1|  PREDICTED: 40S ribosomal protein S11               190   4e-57   
ref|XP_006107850.1|  PREDICTED: 40S ribosomal protein S11               190   4e-57   
gb|EFB23939.1|  hypothetical protein PANDA_006272                       190   4e-57   
ref|NP_001106708.1|  ribosomal protein S11 isoform 1                    190   4e-57   
ref|XP_005859830.1|  PREDICTED: 40S ribosomal protein S11-like          191   4e-57   
gb|KIM21521.1|  hypothetical protein M408DRAFT_102891                   190   4e-57   
ref|XP_009332519.1|  PREDICTED: 40S ribosomal protein S11               191   4e-57   
gb|KDR16697.1|  40S ribosomal protein S11                               189   4e-57   
emb|CEI85848.1|  Putative RPYS18 protein                                189   5e-57   
ref|XP_010872877.1|  PREDICTED: 40S ribosomal protein S11               190   5e-57   
ref|XP_003867340.1|  hypothetical protein CORT_0B01840                  189   5e-57   
ref|XP_008208376.1|  PREDICTED: 40S ribosomal protein S11               189   5e-57   
ref|XP_001443900.1|  hypothetical protein                               190   5e-57   
ref|XP_005537659.1|  40S ribosomal protein S11                          190   5e-57   
gb|EYC29909.1|  hypothetical protein Y032_0005g2327                     190   5e-57   
dbj|BAB23843.1|  unnamed protein product                                190   5e-57   
ref|XP_001445466.1|  hypothetical protein                               189   5e-57   
gb|EPX73200.1|  40S ribosomal protein S11                               189   5e-57   
ref|XP_002171367.1|  40S ribosomal protein S11                          189   6e-57   
tpe|CAL69097.1|  TPA: putative 40S ribosomal protein S11 isoform 1      189   6e-57   
ref|XP_010411544.1|  PREDICTED: 40S ribosomal protein S11               189   7e-57   
ref|XP_002731417.1|  PREDICTED: 40S ribosomal protein S11-like          189   7e-57   
ref|NP_594003.1|  40S ribosomal protein S11                             189   7e-57   
ref|XP_003191621.1|  ribosomal protein S11                              189   7e-57   
gb|KGG51260.1|  hypothetical protein DI09_3p220                         189   7e-57   
ref|XP_009577263.1|  PREDICTED: 40S ribosomal protein S11               189   7e-57   
emb|CDW53800.1|  Ribosomal S17 domain containing protein                189   7e-57   
ref|XP_001431890.1|  hypothetical protein                               189   8e-57   
ref|XP_006110309.1|  PREDICTED: 40S ribosomal protein S11-like          192   8e-57   
ref|XP_739413.1|  40S ribosomal protein S11                             189   9e-57   
emb|CEG64053.1|  Putative RPYS18 protein                                189   9e-57   
gb|EPY50309.1|  40S ribosomal protein S11                               189   9e-57   
ref|XP_003957408.1|  hypothetical protein KAFR_0E01190                  189   9e-57   
ref|XP_001614536.1|  40S ribosomal protein S11                          189   9e-57   
gb|ABW90417.1|  putative ribosomal protein S11                          189   9e-57   
emb|CAJ17182.1|  ribosomal protein S11e                                 189   9e-57   
emb|CAH04326.1|  S11e ribosomal protein                                 189   1e-56   
ref|XP_004368153.1|  ribosomal protein S17, putative                    189   1e-56   
ref|XP_007360233.1|  hypothetical protein DICSQDRAFT_164575             189   1e-56   
ref|XP_001449806.1|  hypothetical protein                               189   1e-56   
gb|AAH58465.1|  Ribosomal protein S11                                   189   1e-56   
gb|KIH55043.1|  CDC50 family protein, LEM3 family                       189   1e-56   
ref|XP_009541115.1|  hypothetical protein HETIRDRAFT_406926             188   1e-56   
emb|CCE43943.1|  hypothetical protein CPAR2_501680                      189   1e-56   
ref|XP_002171780.1|  40S ribosomal protein S11                          188   1e-56   



>ref|XP_009605477.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana tomentosiformis]
 ref|XP_009788979.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana sylvestris]
Length=159

 Score =   289 bits (739),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  159



>ref|XP_009610574.1| PREDICTED: 40S ribosomal protein S11 [Nicotiana tomentosiformis]
Length=159

 Score =   287 bits (734),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREAVEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  159



>ref|XP_006450366.1| hypothetical protein CICLE_v10009763mg [Citrus clementina]
 ref|XP_006483413.1| PREDICTED: 40S ribosomal protein S11-like [Citrus sinensis]
 gb|ESR63606.1| hypothetical protein CICLE_v10009763mg [Citrus clementina]
 gb|KDO61814.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=159

 Score =   287 bits (734),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT M
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM  159



>ref|XP_002526494.1| 40S ribosomal protein S11, putative [Ricinus communis]
 gb|EEF35885.1| 40S ribosomal protein S11, putative [Ricinus communis]
Length=159

 Score =   286 bits (732),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT M
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM  159



>ref|XP_009764798.1| PREDICTED: 40S ribosomal protein S11 [Nicotiana sylvestris]
Length=159

 Score =   286 bits (731),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREAVEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRI+AGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  159



>gb|KDP30187.1| hypothetical protein JCGZ_16969 [Jatropha curcas]
Length=159

 Score =   285 bits (730),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMIRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  159



>ref|XP_009611608.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana tomentosiformis]
 ref|XP_009765521.1| PREDICTED: 40S ribosomal protein S11-like [Nicotiana sylvestris]
Length=159

 Score =   285 bits (730),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREA EG+YIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREAIEGSYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  159



>gb|KJB27059.1| hypothetical protein B456_004G275200 [Gossypium raimondii]
Length=159

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKGGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  159



>ref|XP_002532505.1| 40S ribosomal protein S11, putative [Ricinus communis]
 gb|EEF29881.1| 40S ribosomal protein S11, putative [Ricinus communis]
Length=159

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM R+IIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRSIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  159



>gb|KJB64607.1| hypothetical protein B456_010G056800 [Gossypium raimondii]
Length=159

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGIYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMIRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  159



>ref|XP_011032811.1| PREDICTED: 40S ribosomal protein S11 [Populus euphratica]
Length=159

 Score =   285 bits (728),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRIL+GTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILSGTCHSAKMNRTIIVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GDYVIIGQCRPLSKTVRFNVLKVIPAGS+GG KK FTGM
Sbjct  121  GDYVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKVFTGM  159



>ref|XP_007052409.1| Ribosomal protein S11-beta isoform 2 [Theobroma cacao]
 gb|EOX96566.1| Ribosomal protein S11-beta isoform 2 [Theobroma cacao]
Length=159

 Score =   284 bits (726),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAF GM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFAGM  159



>gb|KDP33551.1| hypothetical protein JCGZ_07122 [Jatropha curcas]
Length=159

 Score =   284 bits (726),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKLGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMMRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLK+IPAGS+GGGKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKLIPAGSSGGGKKAFTGL  159



>ref|XP_007013672.1| Ribosomal protein S11-beta [Theobroma cacao]
 gb|EOY31291.1| Ribosomal protein S11-beta [Theobroma cacao]
Length=159

 Score =   283 bits (725),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGI  159



>ref|XP_006375200.1| 40S ribosomal protein S11 [Populus trichocarpa]
 gb|ABK92709.1| unknown [Populus trichocarpa]
 gb|ERP52997.1| 40S ribosomal protein S11 [Populus trichocarpa]
Length=159

 Score =   283 bits (725),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRIL+GTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRV+E
Sbjct  61   FTGTVSIRGRILSGTCHSAKMNRTIIVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRVRE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GDYVIIGQCRPLSKTVRFNVLKVIPAGS+GG KK FTGM
Sbjct  121  GDYVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKVFTGM  159



>ref|XP_002325170.1| 40S ribosomal protein S11-2 [Populus trichocarpa]
 gb|EEF03735.1| 40S ribosomal protein S11-2 [Populus trichocarpa]
Length=159

 Score =   283 bits (724),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGL FKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLSFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AH+SPCFRV+E
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHWVKKYQRYEKRHSNIPAHVSPCFRVRE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSA GGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAAGGKKAFTGM  159



>ref|XP_008800685.1| PREDICTED: 40S ribosomal protein S11-like [Phoenix dactylifera]
Length=159

 Score =   283 bits (724),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFLSSKK  KGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLSSKKPSKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS GGGKKAFT +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKGGGKKAFTAI  159



>gb|KJB23700.1| hypothetical protein B456_004G110600 [Gossypium raimondii]
Length=159

 Score =   283 bits (723),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGPVSVRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  159



>ref|XP_007155106.1| hypothetical protein PHAVU_003G173800g [Phaseolus vulgaris]
 ref|XP_007155107.1| hypothetical protein PHAVU_003G173900g [Phaseolus vulgaris]
 gb|ESW27100.1| hypothetical protein PHAVU_003G173800g [Phaseolus vulgaris]
 gb|ESW27101.1| hypothetical protein PHAVU_003G173900g [Phaseolus vulgaris]
Length=159

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM  159



>ref|XP_004241368.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum]
 ref|XP_004241369.1| PREDICTED: 40S ribosomal protein S11-like [Solanum lycopersicum]
Length=159

 Score =   282 bits (721),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS G GKKAFTGM
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSGGVGKKAFTGM  159



>ref|XP_003549708.1| PREDICTED: 40S ribosomal protein S11-like [Glycine max]
 gb|KHN18603.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   282 bits (721),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI AHISP FRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM  159



>emb|CDP18807.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   281 bits (719),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRYWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG+VSIRGRI+AGTCHSAKM++TIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGSVSIRGRIIAGTCHSAKMDKTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKV+PAG++GGGKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVVPAGASGGGKKAFTGL  159



>ref|NP_001236968.1| 40S ribosomal protein S11 [Glycine max]
 sp|P17093.2|RS11_SOYBN RecName: Full=40S ribosomal protein S11 [Glycine max]
 gb|AAC14469.1| ribosomal protein S11 [Glycine max]
 gb|ACU13267.1| unknown [Glycine max]
 gb|KHN47133.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   281 bits (718),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLS+KKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSTKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI AHISP FRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM  159



>ref|XP_008809330.1| PREDICTED: 40S ribosomal protein S11 [Phoenix dactylifera]
Length=159

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKGGGKKAFAAV  159



>ref|XP_007146683.1| hypothetical protein PHAVU_006G060600g [Phaseolus vulgaris]
 gb|ESW18677.1| hypothetical protein PHAVU_006G060600g [Phaseolus vulgaris]
Length=159

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGL FKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLSFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM  159



>ref|XP_002880547.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010472410.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 gb|EFH56806.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAF+GM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFSGM  159



>gb|KJB22832.1| hypothetical protein B456_004G068000 [Gossypium raimondii]
Length=159

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKV PAGS+GGGKKAFT M
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVNPAGSSGGGKKAFTAM  159



>sp|Q9M5M1.1|RS11_EUPES RecName: Full=40S ribosomal protein S11 [Euphorbia esula]
 gb|AAF34771.1|AF227626_1 40S ribosomal protein S11 [Euphorbia esula]
Length=159

 Score =   280 bits (717),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL+SKKTGKGKRPGKGGNRFWKSIGLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLASKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIDGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGVKKAFTAI  159



>ref|XP_003629390.1| 40S ribosomal protein S11 [Medicago truncatula]
 gb|ACJ83891.1| unknown [Medicago truncatula]
 gb|AET03866.1| 40S ribosomal protein S11-1 [Medicago truncatula]
 gb|AFK33686.1| unknown [Medicago truncatula]
Length=160

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKS+GLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSVGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG S+G GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAGKKAFTGM  160



>ref|XP_007159633.1| hypothetical protein PHAVU_002G254000g [Phaseolus vulgaris]
 gb|ESW31627.1| hypothetical protein PHAVU_002G254000g [Phaseolus vulgaris]
Length=159

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKSIGL FKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLSFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ G KKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGI  159



>ref|XP_011017934.1| PREDICTED: 40S ribosomal protein S11 isoform X1 [Populus euphratica]
 ref|XP_011017935.1| PREDICTED: 40S ribosomal protein S11 isoform X2 [Populus euphratica]
Length=159

 Score =   280 bits (715),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGL FKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLSFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTC+SAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCNSAKMVRTIIVRRNYLHWVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSA GGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAAGGKKAFTGM  159



>gb|KHG26586.1| 40S ribosomal S11 [Gossypium arboreum]
Length=164

 Score =   280 bits (715),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 153/164 (93%), Gaps = 5/164 (3%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSS K GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSNKGGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR-----YEKRHSNIAAHISPC  256
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQR     YEKRHSNI AHISPC
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRHDSASYEKRHSNIPAHISPC  120

Query  255  FRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            FRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  FRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  164



>ref|XP_006296532.1| hypothetical protein CARUB_v10025724mg [Capsella rubella]
 ref|XP_010417154.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010429366.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X1 [Camelina 
sativa]
 gb|EOA29430.1| hypothetical protein CARUB_v10025724mg [Capsella rubella]
Length=159

 Score =   280 bits (715),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFTGV  159



>ref|XP_010432945.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 ref|XP_010438132.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 ref|XP_010447671.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
Length=159

 Score =   280 bits (715),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFTGM  159



>ref|XP_007052408.1| Ribosomal protein S11-beta isoform 1 [Theobroma cacao]
 gb|EOX96565.1| Ribosomal protein S11-beta isoform 1 [Theobroma cacao]
Length=186

 Score =   280 bits (717),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTG  127
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAF G
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFAG  158



>ref|XP_002301243.1| 40S ribosomal protein S11 [Populus trichocarpa]
 ref|XP_011017414.1| PREDICTED: 40S ribosomal protein S11 [Populus euphratica]
 gb|ABK93959.1| unknown [Populus trichocarpa]
 gb|ABK94519.1| unknown [Populus trichocarpa]
 gb|EEE80516.1| 40S ribosomal protein S11 [Populus trichocarpa]
Length=159

 Score =   279 bits (714),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPRVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFR++E
Sbjct  61   FTGTVSVRGRILAGTCHSAKMNRTIIVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRIRE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT M
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM  159



>ref|XP_010665687.1| PREDICTED: 40S ribosomal protein S11 [Beta vulgaris subsp. vulgaris]
Length=159

 Score =   279 bits (713),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP +FLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKLFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG+VSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGSVSIRGRILAGTCHSAKMQRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRP+SKTVRFNVLKVIPAG+A GGKKAFTGM
Sbjct  121  GDHVIIGQCRPISKTVRFNVLKVIPAGAATGGKKAFTGM  159



>gb|KJB27060.1| hypothetical protein B456_004G275200 [Gossypium raimondii]
Length=161

 Score =   279 bits (713),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 153/161 (95%), Gaps = 2/161 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGV--FLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKK  427
            MAEQTEKAFLKQP V  F SSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKK
Sbjct  1    MAEQTEKAFLKQPKVVLFFSSKKGGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKK  60

Query  426  CPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRV  247
            CPFTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRV
Sbjct  61   CPFTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRV  120

Query  246  KEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            KEGD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  KEGDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  161



>dbj|BAK05865.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   278 bits (712),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTV+IRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVAIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD+VIIGQCRPLSKTVRFNVLKV+PAG+ GGGKKAF
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVVPAGTTGGGKKAF  156



>gb|KJB83250.1| hypothetical protein B456_013G237400 [Gossypium raimondii]
Length=159

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+ KGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSSKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            F GTVSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FAGTVSIRGRILAGTCHSAKMIRTIIVRRNYLHYIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  159



>ref|XP_004138716.1| PREDICTED: 40S ribosomal protein S11-3-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159259.1| PREDICTED: 40S ribosomal protein S11-3-like isoform 2 [Cucumis 
sativus]
 gb|KGN62969.1| hypothetical protein Csa_2G382430 [Cucumis sativus]
Length=159

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHI+PCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNIPAHIAPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ GGKKAF G+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAGGKKAFAGI  159



>gb|KDP28900.1| hypothetical protein JCGZ_14671 [Jatropha curcas]
Length=159

 Score =   278 bits (710),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA  GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAGGGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAI  159



>ref|XP_006284663.1| hypothetical protein CARUB_v10005922mg [Capsella rubella]
 gb|EOA17561.1| hypothetical protein CARUB_v10005922mg [Capsella rubella]
Length=159

 Score =   278 bits (710),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAF GM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFAGM  159



>ref|XP_006659214.1| PREDICTED: 40S ribosomal protein S11-like [Oryza brachyantha]
Length=159

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL  KK+GKGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS GGGKKAFT
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSTGGGKKAFT  157



>ref|XP_008445242.1| PREDICTED: 40S ribosomal protein S11 [Cucumis melo]
Length=159

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHI+PCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNIPAHIAPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+ GGKKAF G+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSTGGKKAFAGI  159



>ref|XP_009407362.1| PREDICTED: 40S ribosomal protein S11 [Musa acuminata subsp. malaccensis]
Length=159

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL  KK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCPKKPGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPL+KTV FNVLKVIPAGS GGGKKAFT +
Sbjct  121  GDHVIIGQCRPLAKTVTFNVLKVIPAGSTGGGKKAFTAV  159



>ref|XP_010914246.1| PREDICTED: 40S ribosomal protein S11-like [Elaeis guineensis]
Length=159

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+V+KYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVRKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKGGGKKAFAAV  159



>emb|CAK22271.1| 40S ribosomal protein S11 [Oxybasis rubra]
Length=159

 Score =   277 bits (709),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSS K+GKGKRPGKGGNRFWK+IGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSNKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMQRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRP+SKTVRFNVLKVIPAG+A GGKKAFTG+
Sbjct  121  GDHVIIGQCRPISKTVRFNVLKVIPAGAASGGKKAFTGL  159



>ref|XP_010904991.1| PREDICTED: 40S ribosomal protein S11 isoform X1 [Elaeis guineensis]
Length=160

 Score =   277 bits (708),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD+VIIGQCRPL+KTVRFNVLKVIPAGS +GGGKKAF+ +
Sbjct  121  GDHVIIGQCRPLAKTVRFNVLKVIPAGSKSGGGKKAFSAI  160



>ref|XP_011089115.1| PREDICTED: 40S ribosomal protein S11-like [Sesamum indicum]
Length=159

 Score =   277 bits (708),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG+VS+RGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGSVSVRGRILAGTCHSAKMMRTIIVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+G GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGRGKKAFTGM  159



>ref|XP_011081506.1| PREDICTED: 40S ribosomal protein S11 [Sesamum indicum]
Length=159

 Score =   277 bits (708),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKAPGKGGNRYWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG+VSIRGRILAGTCHSAKM RTI+VRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGSVSIRGRILAGTCHSAKMMRTIVVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+G GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGRGKKAFTGM  159



>ref|XP_007223638.1| hypothetical protein PRUPE_ppa012659mg [Prunus persica]
 gb|EMJ24837.1| hypothetical protein PRUPE_ppa012659mg [Prunus persica]
Length=159

 Score =   277 bits (708),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGR+L+GTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRVLSGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GDYVIIGQCRPLSKTVRFNVLKV PAGS+G GKKAFTG+
Sbjct  121  GDYVIIGQCRPLSKTVRFNVLKVTPAGSSGAGKKAFTGI  159



>gb|KFK41361.1| hypothetical protein AALP_AA2G120000 [Arabis alpina]
Length=159

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFTGV  159



>ref|XP_009355796.1| PREDICTED: 40S ribosomal protein S11 [Pyrus x bretschneideri]
Length=159

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGK+PGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKKPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GDYVIIGQCRPLSKTVRFNVLKV PAGS+G GKKAFTG+
Sbjct  121  GDYVIIGQCRPLSKTVRFNVLKVTPAGSSGTGKKAFTGI  159



>ref|XP_008378412.1| PREDICTED: 40S ribosomal protein S11 [Malus domestica]
 ref|XP_008394149.1| PREDICTED: 40S ribosomal protein S11 [Malus domestica]
Length=159

 Score =   277 bits (708),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GDYVIIGQCRPLSKTVRFNVLKV PAGS+G GKKAFTG+
Sbjct  121  GDYVIIGQCRPLSKTVRFNVLKVTPAGSSGTGKKAFTGI  159



>ref|XP_011077210.1| PREDICTED: 40S ribosomal protein S11-like [Sesamum indicum]
Length=159

 Score =   276 bits (707),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKAPGKGGNRYWKSIGLGFKTPREAVEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGDVSIRGRILAGTCHSAKMVRTIIVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+G GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGRGKKAFTGM  159



>ref|XP_010557632.1| PREDICTED: 40S ribosomal protein S11 [Tarenaya hassleriana]
Length=159

 Score =   276 bits (707),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKKTGKGKRPGKGGNRFWK+IGLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTFIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFV+KYQRYEKRHSNI AH+SP FRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVRKYQRYEKRHSNIPAHVSPSFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSA GGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAAGGKKAFTGM  159



>ref|XP_010542070.1| PREDICTED: 40S ribosomal protein S11-like [Tarenaya hassleriana]
Length=159

 Score =   276 bits (707),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKKTGKGKRPGKGGNRFWK++GLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPRVFLCSKKTGKGKRPGKGGNRFWKNVGLGFKTPREAIEGTFIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLHFV+KYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGPVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVRKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGSA GGKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSAAGGKKAFTGM  159



>gb|AFK49430.1| unknown [Lotus japonicus]
Length=159

 Score =   276 bits (706),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRP+SKTVRFNVLKVIPAGS+ G KKAFTG+
Sbjct  121  GDHVIIGQCRPISKTVRFNVLKVIPAGSSSGVKKAFTGV  159



>ref|XP_010493497.1| PREDICTED: 40S ribosomal protein S11-3 [Camelina sativa]
Length=159

 Score =   276 bits (705),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGV  159



>ref|XP_006404202.1| hypothetical protein EUTSA_v10010781mg [Eutrema salsugineum]
 gb|ESQ45655.1| hypothetical protein EUTSA_v10010781mg [Eutrema salsugineum]
Length=159

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A EGTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIEGTYIDQKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGIVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGM  159



>ref|NP_001238157.1| uncharacterized protein LOC100500186 [Glycine max]
 gb|ACU15150.1| unknown [Glycine max]
 gb|KHN34835.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI +HISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPSHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRP+SKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  121  GDHVIIGQCRPISKTVRFNVLKVIPAGSSSGAKKAFTGM  159



>ref|XP_010533097.1| PREDICTED: 40S ribosomal protein S11-like [Tarenaya hassleriana]
Length=159

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKKTGKGKRPGKGGNRFWK++GLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTGKGKRPGKGGNRFWKNVGLGFKTPREAIEGTFIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLHFV+KYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGPVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVRKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VI+GQCRPLSKTVRFNVLKVIPAGS+ GGKKAFTGM
Sbjct  121  GDHVIVGQCRPLSKTVRFNVLKVIPAGSSAGGKKAFTGM  159



>ref|XP_008776674.1| PREDICTED: 40S ribosomal protein S11-like [Phoenix dactylifera]
Length=160

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD++IIGQCRPL+KTVRFNVLKVIPAGS +GGGKKAF  +
Sbjct  121  GDHIIIGQCRPLAKTVRFNVLKVIPAGSKSGGGKKAFAAL  160



>ref|XP_011089695.1| PREDICTED: 40S ribosomal protein S11 [Sesamum indicum]
Length=159

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKAPGKGGNRYWKSIGLGFKTPREAVEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHWVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSRGKKAFTGM  159



>ref|XP_002874145.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50404.1| ribosomal protein S11-beta [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRFWK+IGLGFKTPREA EG YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKTSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDSKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGV  159



>ref|XP_006288822.1| hypothetical protein CARUB_v10002158mg [Capsella rubella]
 gb|EOA21720.1| hypothetical protein CARUB_v10002158mg [Capsella rubella]
Length=159

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDQKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGV  159



>ref|NP_001236713.1| uncharacterized protein LOC100500094 [Glycine max]
 gb|ACU14888.1| unknown [Glycine max]
 gb|KHN34834.1| 40S ribosomal protein S11 [Glycine soja]
Length=159

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AH SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPAHTSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRP+SKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  121  GDHVIIGQCRPISKTVRFNVLKVIPAGSSSGAKKAFTGM  159



>ref|XP_010927344.1| PREDICTED: 40S ribosomal protein S11-like [Elaeis guineensis]
Length=160

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK  KGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAAKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+V+KYQRYEKRHSNIAAH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVRKYQRYEKRHSNIAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD+VIIGQCRPL+KTVRFNVLKVIPAGS +GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLAKTVRFNVLKVIPAGSKSGGGKKAFAAI  160



>ref|XP_010421183.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
 ref|XP_010454662.1| PREDICTED: 40S ribosomal protein S11-3-like [Camelina sativa]
Length=159

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EG YID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGAYIDRKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGV  159



>ref|XP_002869362.1| 40S ribosomal protein S11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45621.1| 40S ribosomal protein S11 [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GK KRPGKGGNRFWK+IGLGFKTPREA EG Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKEKRPGKGGNRFWKNIGLGFKTPREAIEGAYVDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTGM
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSSSIGKKAFTGM  159



>gb|AAA32866.1| ribosomal protein S11 (probable start codon at bp 67), partial 
[Arabidopsis thaliana]
Length=182

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -2

Query  615  SAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYI  436
            S+ + MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA +G Y+
Sbjct  18   SSTSAMAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYV  77

Query  435  DKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPC  256
            DKKCPFTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPC
Sbjct  78   DKKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPC  137

Query  255  FRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            FRVKEGD++IIGQCRPLSKTVRFNVLKVIPAGS+   GKKAFTGM
Sbjct  138  FRVKEGDHIIIGQCRPLSKTVRFNVLKVIPAGSSSSFGKKAFTGM  182



>dbj|BAJ94606.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTV+IRGRI+AGT HSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVAIRGRIIAGTYHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD+VIIGQCRPLSKTVRFNVLKV+PAG+ GGGKKAF
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVVPAGTTGGGKKAF  156



>ref|XP_004492502.1| PREDICTED: 40S ribosomal protein S11-like [Cicer arietinum]
 ref|XP_004508404.1| PREDICTED: 40S ribosomal protein S11-like [Cicer arietinum]
Length=160

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLHF+KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS+ G  KKAFTG+
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSSSGVAKKAFTGI  160



>ref|XP_006394638.1| hypothetical protein EUTSA_v10005057mg [Eutrema salsugineum]
 gb|ESQ31924.1| hypothetical protein EUTSA_v10005057mg [Eutrema salsugineum]
Length=159

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A EG+YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIEGSYIDGKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGM  159



>ref|XP_009130101.1| PREDICTED: 40S ribosomal protein S11-3 [Brassica rapa]
 emb|CDY46968.1| BnaA02g32780D [Brassica napus]
Length=159

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGTYIDRKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  159



>ref|XP_010941685.1| PREDICTED: 40S ribosomal protein S11-like [Elaeis guineensis]
Length=163

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EG Y+DKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGAYVDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS GG GKKAFT +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKGGSGKKAFTAI  160



>gb|KFK34189.1| hypothetical protein AALP_AA5G112300 [Arabis alpina]
Length=159

 Score =   274 bits (701),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRIL+GTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILSGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFTGV  159



>gb|EEC83094.1| hypothetical protein OsI_28229 [Oryza sativa Indica Group]
Length=159

 Score =   274 bits (701),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL  KK+GKGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD+VIIGQCRPLSKTVRFNV+KVIPAGS GGGKKAF
Sbjct  121  GDHVIIGQCRPLSKTVRFNVIKVIPAGSTGGGKKAF  156



>ref|XP_006291971.1| hypothetical protein CARUB_v10018158mg [Capsella rubella]
 ref|XP_010503537.1| PREDICTED: 40S ribosomal protein S11-1 [Camelina sativa]
 ref|XP_010515228.1| PREDICTED: 40S ribosomal protein S11-1 isoform X1 [Camelina sativa]
 ref|XP_010515229.1| PREDICTED: 40S ribosomal protein S11-1 isoform X2 [Camelina sativa]
 ref|XP_010515230.1| PREDICTED: 40S ribosomal protein S11-1 isoform X3 [Camelina sativa]
 ref|XP_010426394.1| PREDICTED: 40S ribosomal protein S11-1 [Camelina sativa]
 gb|EOA24869.1| hypothetical protein CARUB_v10018158mg [Capsella rubella]
Length=160

 Score =   274 bits (700),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA +G Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+   GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSSFGKKAFTGM  160



>emb|CDX80385.1| BnaC07g30590D [Brassica napus]
Length=388

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +G YIDKKCP
Sbjct  230  MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGHYIDKKCP  289

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  290  FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  349

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  350  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  388



>gb|KDO61813.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=144

 Score =   273 bits (698),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 140/159 (88%), Gaps = 15/159 (9%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPG               KGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPG---------------KGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  45

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  46   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  105

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT M
Sbjct  106  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM  144



>ref|NP_197763.1| 40S ribosomal protein S11-3 [Arabidopsis thaliana]
 sp|P42733.2|RS113_ARATH RecName: Full=40S ribosomal protein S11-3 [Arabidopsis thaliana]
 gb|AAK25990.1|AF360280_1 putative 40S ribosomal protein S11 [Arabidopsis thaliana]
 dbj|BAB10047.1| 40S ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAL33787.1| putative 40S ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM64796.1| 40S ribosomal protein S11 [Arabidopsis thaliana]
 gb|AED93206.1| 40S ribosomal protein S11-3 [Arabidopsis thaliana]
Length=159

 Score =   274 bits (700),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRFWK+IGLGFKTPREA +G YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGV  159



>ref|XP_009392143.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   273 bits (699),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD+VIIGQCRPL+KTV FNVLKVIPAGS +GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLAKTVSFNVLKVIPAGSTSGGGKKAFAAV  160



>gb|KFK29657.1| hypothetical protein AALP_AA7G161800 [Arabis alpina]
Length=159

 Score =   273 bits (699),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSAIGKKAFTGI  159



>ref|XP_002877637.1| EMB1080 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53896.1| EMB1080 [Arabidopsis lyrata subsp. lyrata]
Length=160

 Score =   273 bits (699),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA +G Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIDGAYVDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            GD++IIGQCRPLSKTVRFNVLKVIPAGS+   GKKAFTGM
Sbjct  121  GDHIIIGQCRPLSKTVRFNVLKVIPAGSSSSFGKKAFTGM  160



>ref|XP_009141711.1| PREDICTED: 40S ribosomal protein S11-3-like [Brassica rapa]
 emb|CDY69343.1| BnaAnng30090D [Brassica napus]
 emb|CDX87158.1| BnaC09g04730D [Brassica napus]
Length=159

 Score =   273 bits (698),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGL FKTPR+A +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLSFKTPRDAIDGTYIDRKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  159



>ref|XP_009150903.1| PREDICTED: 40S ribosomal protein S11-3-like [Brassica rapa]
Length=159

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +G YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGHYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  159



>ref|XP_004252282.1| PREDICTED: 40S ribosomal protein S11 [Solanum lycopersicum]
 ref|XP_006346633.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
 ref|XP_006346634.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
 ref|XP_006361120.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
Length=159

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS GGGKKAFTGM
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGM  159



>ref|XP_007202693.1| hypothetical protein PRUPE_ppa012656mg [Prunus persica]
 gb|EMJ03892.1| hypothetical protein PRUPE_ppa012656mg [Prunus persica]
Length=159

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMN+TII+RRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIIRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKT RFNVLKV PAGS+G GKKAFTG+
Sbjct  121  GDHVTIGQCRPLSKTKRFNVLKVTPAGSSGAGKKAFTGI  159



>ref|XP_003609505.1| 40S ribosomal protein S11 [Medicago truncatula]
 gb|ACJ85897.1| unknown [Medicago truncatula]
 gb|AES91702.1| 40S ribosomal protein S11-1 [Medicago truncatula]
 gb|AFK37047.1| unknown [Medicago truncatula]
Length=160

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRF+KS+GLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFFKSVGLGFKTPREAIDGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTI+VRRNYLHF+KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIVVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG S+G GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAGKKAFTGM  160



>gb|AFK38811.1| unknown [Lotus japonicus]
 gb|AFK49311.1| unknown [Lotus japonicus]
Length=159

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EG+YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGSYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VS+RGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSVRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKV+PAGS+G  KKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVVPAGSSGAVKKAFTGI  159



>ref|XP_004287236.1| PREDICTED: 40S ribosomal protein S11-like [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 1/159 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNIAAH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNIAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTG  127
            GD+VIIGQCRPLSKT RFNVLKVIPAGS+   GKKAFTG
Sbjct  121  GDHVIIGQCRPLSKTKRFNVLKVIPAGSSSAFGKKAFTG  159



>ref|XP_009151636.1| PREDICTED: 40S ribosomal protein S11-3 [Brassica rapa]
 emb|CDX83060.1| BnaA01g20600D [Brassica napus]
Length=159

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREA +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFSKNIGLGFKTPREAIQGTYIDRKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  159



>gb|KFK27670.1| hypothetical protein AALP_AA8G413500 [Arabis alpina]
Length=159

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGK PGKGGNRFWK+IGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKGPGKGGNRFWKNIGLGFKTPREAIEGGYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAG+CHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSVRGRILAGSCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++  GKKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGM  159



>ref|NP_190462.1| 40S ribosomal protein S11-1 [Arabidopsis thaliana]
 sp|P16181.1|RS111_ARATH RecName: Full=40S ribosomal protein S11-1; AltName: Full=Protein 
EMBRYO DEFECTIVE 1080 [Arabidopsis thaliana]
 gb|AAC14454.1| ribosomal protein S11 [Arabidopsis thaliana]
 emb|CAB62017.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAL24429.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM10176.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM65578.1| cytosolic ribosomal protein S11 [Arabidopsis thaliana]
 gb|AEE78474.1| 40S ribosomal protein S11-1 [Arabidopsis thaliana]
Length=160

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA +G Y+DKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            GD++IIGQCRPLSKTVRFNVLKVIPAGS+   GKKAFTGM
Sbjct  121  GDHIIIGQCRPLSKTVRFNVLKVIPAGSSSSFGKKAFTGM  160



>ref|NP_194809.1| 40S ribosomal protein S11-2 [Arabidopsis thaliana]
 sp|O65569.2|RS112_ARATH RecName: Full=40S ribosomal protein S11-2 [Arabidopsis thaliana]
 emb|CAA18213.2| ribosomal protein S11-like [Arabidopsis thaliana]
 emb|CAB79798.1| ribosomal protein S11-like [Arabidopsis thaliana]
 gb|AAK76711.1| putative ribosomal protein S11 [Arabidopsis thaliana]
 gb|AAM14143.1| putative ribosomal protein S11 [Arabidopsis thaliana]
 gb|AEE85810.1| 40S ribosomal protein S11-2 [Arabidopsis thaliana]
Length=159

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDQKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRIL+GTCHSAKM RTIIVRR+YLHFVKKY+RYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILSGTCHSAKMQRTIIVRRDYLHFVKKYRRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD V IGQCRPLSKTVRFNVLKVIPAGS+  GKKAFTGM
Sbjct  121  GDRVTIGQCRPLSKTVRFNVLKVIPAGSSSIGKKAFTGM  159



>ref|XP_002454168.1| hypothetical protein SORBIDRAFT_04g025870 [Sorghum bicolor]
 ref|XP_002448129.1| hypothetical protein SORBIDRAFT_06g021750 [Sorghum bicolor]
 ref|XP_004976135.1| PREDICTED: 40S ribosomal protein S11-like [Setaria italica]
 gb|EES07144.1| hypothetical protein SORBIDRAFT_04g025870 [Sorghum bicolor]
 gb|EES12457.1| hypothetical protein SORBIDRAFT_06g021750 [Sorghum bicolor]
Length=160

 Score =   271 bits (694),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 147/158 (93%), Gaps = 1/158 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK  KG +PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKAAKGNKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS  G  KKAFT
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAVKKAFT  158



>ref|XP_004288615.1| PREDICTED: 40S ribosomal protein S11 [Fragaria vesca subsp. vesca]
 ref|XP_004290932.1| PREDICTED: 40S ribosomal protein S11 [Fragaria vesca subsp. vesca]
Length=160

 Score =   271 bits (693),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 1/159 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM+RTIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMSRTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTG  127
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+   GKKAFTG
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSAFGKKAFTG  159



>ref|XP_010240412.1| PREDICTED: 40S ribosomal protein S11 [Brachypodium distachyon]
Length=158

 Score =   271 bits (693),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 1/157 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTV+IRGRI+AGTCHSAKMNRTIIVRR+YLHFVKKYQRYEKRHSNI AHISPCFR++E
Sbjct  61   FTGTVAIRGRIIAGTCHSAKMNRTIIVRRDYLHFVKKYQRYEKRHSNIPAHISPCFRIRE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS  GGKKAF 
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGST-GGKKAFV  156



>ref|XP_009149784.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X2 [Brassica 
rapa]
 emb|CDY64707.1| BnaA06g38660D [Brassica napus]
Length=159

 Score =   271 bits (693),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREAT+GTYID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFVKNIGLGFKTPREATQGTYIDSKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTG  127
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTG
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTG  158



>emb|CDX88047.1| BnaA06g26380D [Brassica napus]
Length=206

 Score =   273 bits (697),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +G YIDKKCP
Sbjct  48   MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGHYIDKKCP  107

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVS+RGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  108  FTGTVSVRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  167

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  168  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  206



>ref|XP_008447825.1| PREDICTED: 40S ribosomal protein S11-like [Cucumis melo]
Length=159

 Score =   271 bits (693),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKKT KGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTAKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            F GTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FAGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAF G+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSRGKKAFAGI  159



>ref|XP_004953088.1| PREDICTED: 40S ribosomal protein S11-like isoform X2 [Setaria 
italica]
Length=160

 Score =   271 bits (693),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 146/158 (92%), Gaps = 1/158 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL  KK  KG +PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCPKKAAKGNKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS  G  KKAFT
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAVKKAFT  158



>ref|XP_006361121.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
Length=159

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS GGGKKAFTG+
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGI  159



>ref|XP_008813136.1| PREDICTED: 40S ribosomal protein S11-like [Phoenix dactylifera]
Length=160

 Score =   271 bits (692),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAH SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHASPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTGM  124
            GD+VIIGQCRPL+KTVRFNVLKVIPAG  +GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLAKTVRFNVLKVIPAGLKSGGGKKAFAAI  160



>emb|CDY64632.1| BnaCnng44460D [Brassica napus]
Length=230

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 156/171 (91%), Gaps = 2/171 (1%)
 Frame = -2

Query  636  LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPRE  457
            L SS   +AA  MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPRE
Sbjct  48   LASSFHKTAA--MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFSKNIGLGFKTPRE  105

Query  456  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  277
            A +GTYID+KCPFTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  106  AIQGTYIDRKCPFTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNI  165

Query  276  AAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
             AH+SPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTG+
Sbjct  166  PAHVSPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGI  216



>gb|AFX66997.1| 40s ribosomal protein S11 [Solanum tuberosum]
Length=159

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPG FLSSKKTGKGKRPGKGGNR++KSIGLGFKTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGEFLSSKKTGKGKRPGKGGNRYFKSIGLGFKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS GGGKKAFTGM
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGM  159



>ref|XP_009398660.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD+VIIGQCRPL+KTV FNVLKVIPAGS +GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLAKTVGFNVLKVIPAGSTSGGGKKAFAAV  160



>ref|NP_001053235.1| Os04g0502300 [Oryza sativa Japonica Group]
 dbj|BAF15149.1| Os04g0502300 [Oryza sativa Japonica Group]
 emb|CAH67584.1| OSIGBa0112M24.1 [Oryza sativa Indica Group]
Length=160

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 149/159 (94%), Gaps = 1/159 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL  KKT KGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTG  127
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS +G GKK FT 
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAGKKVFTA  159



>emb|CDY05882.1| BnaC08g20590D [Brassica napus]
Length=159

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREA++GTYID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFVKNIGLGFKTPREASQGTYIDSKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTG  127
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTG
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTG  158



>ref|XP_004144894.1| PREDICTED: 40S ribosomal protein S11-3-like [Cucumis sativus]
 ref|XP_004153463.1| PREDICTED: 40S ribosomal protein S11-3-like [Cucumis sativus]
 ref|XP_004168298.1| PREDICTED: 40S ribosomal protein S11-3-like [Cucumis sativus]
 gb|KGN43351.1| hypothetical protein Csa_7G025720 [Cucumis sativus]
Length=159

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKKT KG +PGKGGNRFWK+IGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKTAKGNKPGKGGNRFWKNIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            F GTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FAGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+  GKKAF G+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSRGKKAFAGI  159



>ref|XP_009358523.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
 ref|XP_009358525.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
Length=159

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKT RFNVLKV PAGS+G GKKAF G+
Sbjct  121  GDHVTIGQCRPLSKTKRFNVLKVTPAGSSGTGKKAFAGI  159



>pdb|3J60|L Chain L, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=160

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 149/159 (94%), Gaps = 1/159 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL  KKT KGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTG  127
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS +G GKK FT 
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAGKKVFTA  159



>ref|XP_009405706.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQ  VFL SKKTGKGKRPGKGGNRFWKSIGLGFKTP+EA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQSKVFLCSKKTGKGKRPGKGGNRFWKSIGLGFKTPKEAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD+VIIGQCRPL+KTV FNVLKVIPAGS +GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLAKTVTFNVLKVIPAGSTSGGGKKAFAAV  160



>emb|CDY16867.1| BnaA09g05150D [Brassica napus]
Length=159

 Score =   269 bits (688),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGL FKTPR+A +GTYID+KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLSFKTPRDAIDGTYIDRKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTII RRNY HFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIFRRNYFHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  159



>gb|ACG35231.1| 40S ribosomal protein S11 [Zea mays]
Length=160

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 146/158 (92%), Gaps = 1/158 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK  K  +PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKATKVNKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            GD+VIIGQCRP+SKTVRFNV+KVIPAGS  G  KKAFT
Sbjct  121  GDHVIIGQCRPVSKTVRFNVVKVIPAGSKSGAVKKAFT  158



>ref|NP_001146950.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG24698.1| 40S ribosomal protein S11 [Zea mays]
Length=160

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 147/158 (93%), Gaps = 1/158 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK  KG +PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKASKGNKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            GD+VIIGQCRP+SKTVRFNV+KVIPAGS  G  KKAFT
Sbjct  121  GDHVIIGQCRPVSKTVRFNVVKVIPAGSKSGAVKKAFT  158



>emb|CDY44261.1| BnaC02g41560D [Brassica napus]
Length=177

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  591  QTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFTG  412
            QTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPR+A +GTYID+KCPFTG
Sbjct  22   QTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPRDAIDGTYIDRKCPFTG  81

Query  411  TVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGDY  232
            TVS+RGRILAGTCHSAKM RTI+VRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKEGD+
Sbjct  82   TVSVRGRILAGTCHSAKMQRTIVVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDH  141

Query  231  VIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            VIIGQCRPLSKTVRFNVLKVIPAG++   KKAFTGM
Sbjct  142  VIIGQCRPLSKTVRFNVLKVIPAGASAFAKKAFTGM  177



>ref|XP_006586636.1| PREDICTED: uncharacterized protein LOC100500186 isoform X1 [Glycine 
max]
Length=177

 Score =   268 bits (686),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 152/173 (88%), Gaps = 4/173 (2%)
 Frame = -2

Query  642  NSLLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTP  463
            NSL   C  +       QTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTP
Sbjct  9    NSLFIICFLN----FGLQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTP  64

Query  462  REATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHS  283
            R+A EGTYIDKKCPFTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHS
Sbjct  65   RDAIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHS  124

Query  282  NIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            NI +HISPCFRVKEGD+VIIGQCRP+SKTVRFNVLKVIPAGS+ G KKAFTGM
Sbjct  125  NIPSHISPCFRVKEGDHVIIGQCRPISKTVRFNVLKVIPAGSSSGAKKAFTGM  177



>ref|XP_008336943.1| PREDICTED: 40S ribosomal protein S11-like [Malus domestica]
Length=159

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI  H+SPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNIPXHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKT RFNVLKV PAGS+G GKKAF G+
Sbjct  121  GDHVTIGQCRPLSKTKRFNVLKVTPAGSSGTGKKAFAGI  159



>ref|XP_009410372.1| PREDICTED: 40S ribosomal protein S11-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRG ILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGCILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTGM  124
            GD+VIIGQCRPL+KTV FNVLKVIPAGS +GGGKKAF  +
Sbjct  121  GDHVIIGQCRPLAKTVTFNVLKVIPAGSTSGGGKKAFAAV  160



>dbj|BAJ89702.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFL-SSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKC  424
            MAEQTEKAFLKQP VFL S K T    +PGK GNRFWKS+GLGFKTP+EA EGTYIDKKC
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKATKGNNKPGKEGNRFWKSVGLGFKTPKEAIEGTYIDKKC  60

Query  423  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVK  244
            PFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRV+
Sbjct  61   PFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVR  120

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFTGM  124
            EGD+VIIGQCRPLSKTVRFNVLKV+PAGS  G  KKAFTG+
Sbjct  121  EGDHVIIGQCRPLSKTVRFNVLKVVPAGSKSGAVKKAFTGV  161



>ref|XP_008219543.1| PREDICTED: 40S ribosomal protein S11 [Prunus mume]
Length=159

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKKTGKGKRPGKGGNRFWKS+GLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSVGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH++KKYQRY    S I AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLHYIKKYQRYXXXXSTIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GDYVIIGQCRPLSKTVRFNVLKV PAGS+G GKKAFTG+
Sbjct  121  GDYVIIGQCRPLSKTVRFNVLKVTPAGSSGAGKKAFTGI  159



>ref|XP_004953087.1| PREDICTED: 40S ribosomal protein S11-like isoform X1 [Setaria 
italica]
Length=174

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 144/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            +  QTEKAFLKQP VFL  KK  KG +PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  15   LVLQTEKAFLKQPKVFLCPKKAAKGNKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  74

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  75   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  134

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS  G  KKAFT
Sbjct  135  GDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAVKKAFT  172



>ref|XP_003575346.1| PREDICTED: 40S ribosomal protein S11-like [Brachypodium distachyon]
Length=161

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFL-SSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKC  424
            MAEQTEK+FLKQP VFL   K T    +PGK GNRFWKS+GLGFKTP+EA EGTYIDKKC
Sbjct  1    MAEQTEKSFLKQPKVFLCPKKITKGNNKPGKQGNRFWKSVGLGFKTPKEAIEGTYIDKKC  60

Query  423  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVK  244
            PFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRV+
Sbjct  61   PFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVR  120

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFTG  127
            EGD+VIIGQCRPLSKTVRFNVLKVIPAGS  G  KKAFTG
Sbjct  121  EGDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAVKKAFTG  160



>gb|EMS61594.1| 40S ribosomal protein S11 [Triticum urartu]
Length=156

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA +GTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIDGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTV+IRGRI+AGTCHSAKMNRTIIVRRNYLHFVKK   YEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVAIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKK---YEKRHSNIPAHISPCFRVKE  117

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD+VIIGQCRPLSKTVRFNVLKV+PAG+ GGGKKAF
Sbjct  118  GDHVIIGQCRPLSKTVRFNVLKVVPAGTTGGGKKAF  153



>gb|AFK46727.1| unknown [Lotus japonicus]
Length=151

 Score =   263 bits (673),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHF+KKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMTRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG  148
            GD+VIIGQCRP+SKT RFNVLKVIPAGS+ G
Sbjct  121  GDHVIIGQCRPISKTARFNVLKVIPAGSSSG  151



>gb|AAA32867.1| ribosomal protein S11 [Arabidopsis thaliana]
Length=159

 Score =   264 bits (674),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRFWK+IGLGFKTPREA +G YID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRR+YLHFVKKY RYEKRHS+I AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYPRYEKRHSHIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIP G++  GKKA TG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPTGASAFGKKALTGV  159



>ref|XP_006349147.1| PREDICTED: 40S ribosomal protein S11-like [Solanum tuberosum]
Length=159

 Score =   264 bits (674),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNR++KSI LG KTPREATEGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPGVFLSSKKTGKGKRPGKGGNRYFKSIVLGSKTPREATEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL GTCHSAKMNRTIIVRRNYLH+VKKY+RYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILVGTCHSAKMNRTIIVRRNYLHYVKKYKRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKTVRFNVLKVIPAGS GGGKKAFTGM
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVIPAGSGGGGKKAFTGM  159



>ref|XP_003573544.1| PREDICTED: 40S ribosomal protein S11-like isoform X2 [Brachypodium 
distachyon]
Length=160

 Score =   263 bits (673),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 146/158 (92%), Gaps = 1/158 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL  KK+ KGKRPGK GNRFWK++GLGFKTP+EA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCPKKSDKGKRPGKAGNRFWKNVGLGFKTPKEAIEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTII+ RNYLHFVKKYQRYEKRHSNI AHI PCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIICRNYLHFVKKYQRYEKRHSNIPAHIYPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFT  130
            GD+VIIGQCRPLSKTVRFN+LKVIPAGS GG GKKAFT
Sbjct  121  GDHVIIGQCRPLSKTVRFNILKVIPAGSTGGTGKKAFT  158



>gb|EAY94752.1| hypothetical protein OsI_16531 [Oryza sativa Indica Group]
 gb|EAZ31257.1| hypothetical protein OsJ_15361 [Oryza sativa Japonica Group]
Length=167

 Score =   263 bits (673),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 149/166 (90%), Gaps = 8/166 (5%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL  KKT KGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR-------YEKRHSNIAAHIS  262
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQR       YEKRHSNI AHIS
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQVNLVAGYEKRHSNIPAHIS  120

Query  261  PCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGS-AGGGKKAFTG  127
            PCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAGS +G GKK FT 
Sbjct  121  PCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAGKKVFTA  166



>gb|ABK22030.1| unknown [Picea sitchensis]
 gb|ABK22500.1| unknown [Picea sitchensis]
 gb|ABR18448.1| unknown [Picea sitchensis]
 gb|ACN40680.1| unknown [Picea sitchensis]
Length=160

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFLSSKK+GKGKRPGKGGNRF+K++GLGFKTP+EA +GTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLSSKKSGKGKRPGKGGNRFFKNVGLGFKTPKEAVQGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTC+SAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAG S+G  KKAFT +
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGSAKKAFTAI  160



>ref|XP_007011791.1| Ribosomal protein S11-beta [Theobroma cacao]
 gb|EOY29410.1| Ribosomal protein S11-beta [Theobroma cacao]
Length=192

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  588  TEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFTGT  409
            TEKAFL+QP VFL SKK+GKGKRPGKGGNR WKSIGLGFK PREA EGTYIDKKCPFT T
Sbjct  38   TEKAFLRQPKVFLCSKKSGKGKRPGKGGNRLWKSIGLGFKAPREAIEGTYIDKKCPFTDT  97

Query  408  VSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGDYV  229
            VSIRGRILAGTCH AKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKEGD+V
Sbjct  98   VSIRGRILAGTCHGAKMMRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKEGDHV  157

Query  228  IIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            IIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTG+
Sbjct  158  IIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGI  192



>ref|XP_006652811.1| PREDICTED: 40S ribosomal protein S11-like [Oryza brachyantha]
 ref|XP_006663985.1| PREDICTED: 40S ribosomal protein S11-like [Oryza brachyantha]
Length=161

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPA  163
            GD+VIIGQCRPLSKTVRFNVLKVIPA
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPA  146



>ref|XP_003589042.1| 40S ribosomal protein S11 [Medicago truncatula]
 gb|AES59293.1| 40S ribosomal protein S11-1 [Medicago truncatula]
Length=161

 Score =   261 bits (667),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 149/161 (93%), Gaps = 2/161 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQ  VFL SK +GKGKRPGKGGNRF K++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQNKVFLCSKISGKGKRPGKGGNRFHKTVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRI++GTCHSAKMN+TI+VRRNYLHF+KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRIISGTCHSAKMNKTIVVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSA--GGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+   G KKAFTG+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAGAKKAFTGV  161



>ref|NP_001060007.1| Os07g0565000 [Oryza sativa Japonica Group]
 ref|NP_001053856.2| Os04g0613600 [Oryza sativa Japonica Group]
 dbj|BAC79661.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 dbj|BAD30107.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 dbj|BAF21921.1| Os07g0565000 [Oryza sativa Japonica Group]
 dbj|BAH00296.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77986.1| hypothetical protein OsI_17372 [Oryza sativa Indica Group]
 gb|EEE67424.1| hypothetical protein OsJ_24764 [Oryza sativa Japonica Group]
 dbj|BAF15770.2| Os04g0613600 [Oryza sativa Japonica Group]
Length=161

 Score =   261 bits (667),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPA  163
            GD+VIIGQCRPLSKTVRFNVLKVIPA
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIPA  146



>ref|XP_004976788.1| PREDICTED: 40S ribosomal protein S11-like [Setaria italica]
Length=161

 Score =   261 bits (667),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLS+KK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSTKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD+VIIGQCRPLSKTVRFNV+KVIP
Sbjct  121  GDHVIIGQCRPLSKTVRFNVVKVIP  145



>ref|XP_010687771.1| PREDICTED: 40S ribosomal protein S11-3 [Beta vulgaris subsp. 
vulgaris]
Length=159

 Score =   260 bits (665),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP +FLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKLFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG+VSIRGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNIAAH+SPCFRVKE
Sbjct  61   FTGSVSIRGRILAGTCHSAKMQRTIIVRRNYLHYIKKYQRYEKRHSNIAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPL+KTVRFNVLKVIPAG+A GGKKAFTG+
Sbjct  121  GDHVIIGQCRPLAKTVRFNVLKVIPAGAAAGGKKAFTGI  159



>ref|XP_009362323.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
Length=186

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 153/186 (82%), Gaps = 27/186 (15%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKS----------------------  487
            MAEQTEKAFLKQP VFLSSKKTGKGK+PGKGGNRFWKS                      
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKTGKGKKPGKGGNRFWKSVGLGFKTPRDAIEGKRPGKGGN  60

Query  486  -----IGLGFKTPREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH  322
                 +GLGFKTPR+A EGTYIDKKCPFTG VSIRGRIL+GTCHSAKM+RTIIVRRNYLH
Sbjct  61   RFWKSVGLGFKTPRDAIEGTYIDKKCPFTGNVSIRGRILSGTCHSAKMSRTIIVRRNYLH  120

Query  321  FVKKYQRYEKRHSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGK  142
            ++KKYQRYEKRHSNI AH+SPCFRVKEGDYVIIGQCRPLSKTVRFNVLKV PAGS+G GK
Sbjct  121  YIKKYQRYEKRHSNIPAHVSPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVTPAGSSGTGK  180

Query  141  KAFTGM  124
            KAFTG+
Sbjct  181  KAFTGI  186



>ref|XP_010234462.1| PREDICTED: 40S ribosomal protein S11-like isoform X1 [Brachypodium 
distachyon]
Length=170

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  624  CDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEG  445
            C       M+ QTEKAFLKQP VFL  KK+ KGKRPGK GNRFWK++GLGFKTP+EA EG
Sbjct  3    CSVVRPKQMSGQTEKAFLKQPKVFLCPKKSDKGKRPGKAGNRFWKNVGLGFKTPKEAIEG  62

Query  444  TYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHI  265
             YIDKKCPFTGTVSIRGRI+AGTCHSAKMNRTII+ RNYLHFVKKYQRYEKRHSNI AHI
Sbjct  63   AYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIICRNYLHFVKKYQRYEKRHSNIPAHI  122

Query  264  SPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFT  130
             PCFRVKEGD+VIIGQCRPLSKTVRFN+LKVIPAGS GG GKKAFT
Sbjct  123  YPCFRVKEGDHVIIGQCRPLSKTVRFNILKVIPAGSTGGTGKKAFT  168



>tpg|DAA37074.1| TPA: 40S ribosomal protein S11 [Zea mays]
Length=571

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -2

Query  612  AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYID  433
            +A  MAEQTE+AFLKQP VFL SKK  K  +PGKGGNRFWK+IGLGFKTPREA EGTYID
Sbjct  408  SAASMAEQTERAFLKQPKVFLCSKKATKVNKPGKGGNRFWKNIGLGFKTPREAIEGTYID  467

Query  432  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCF  253
            KKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCF
Sbjct  468  KKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCF  527

Query  252  RVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            RVKEGD+VIIGQCRP+SKTVRFNVLKVIPAGS  G  KKAFT
Sbjct  528  RVKEGDHVIIGQCRPVSKTVRFNVLKVIPAGSKSGAVKKAFT  569



>ref|NP_001105562.1| 40S ribosomal protein S11 [Zea mays]
 ref|XP_002447086.1| hypothetical protein SORBIDRAFT_06g028330 [Sorghum bicolor]
 ref|XP_008668895.1| PREDICTED: 40S ribosomal protein S11 [Zea mays]
 sp|P25460.1|RS11_MAIZE RecName: Full=40S ribosomal protein S11 [Zea mays]
 emb|CAA39438.1| ribosomal protein S11 [Zea mays]
 gb|ACG31238.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG34039.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG37864.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACG46678.1| 40S ribosomal protein S11 [Zea mays]
 gb|ACN28179.1| unknown [Zea mays]
 gb|ACN31404.1| unknown [Zea mays]
 gb|ACN31475.1| unknown [Zea mays]
 gb|EES11414.1| hypothetical protein SORBIDRAFT_06g028330 [Sorghum bicolor]
 gb|AFW59427.1| ribosomal protein S11 [Zea mays]
 tpg|DAA36049.1| TPA: 40S ribosomal protein S11 [Zea mays]
Length=159

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTG  127
            GD+VIIGQCRPLSKTVRFNV+KVIPAGSA  GKKAFT 
Sbjct  121  GDHVIIGQCRPLSKTVRFNVVKVIPAGSAAAGKKAFTA  158



>ref|XP_009149783.1| PREDICTED: 40S ribosomal protein S11-3-like isoform X1 [Brassica 
rapa]
Length=185

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 149/184 (81%), Gaps = 26/184 (14%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSK +GKGKRPGKGGNRF K+IGLGFKTPREAT+GTYID KCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFVKNIGLGFKTPREATQGTYIDSKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ---------------------  304
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQ                     
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRFDSYIKFTFVHMTFFTSMFI  120

Query  303  -----RYEKRHSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKK  139
                 RYEKRHSNI AH+SPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAG++   KK
Sbjct  121  LYFVVRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGASAFAKK  180

Query  138  AFTG  127
            AFTG
Sbjct  181  AFTG  184



>gb|EMT05895.1| 40S ribosomal protein S11 [Aegilops tauschii]
Length=176

 Score =   257 bits (656),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 145/175 (83%), Gaps = 17/175 (10%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFL---------SSkktgkgkrpgkgGNRFWKSIGLGFKTPREATE  448
            MAEQTEKAFLKQP VFL         S K T    +PGK GNRFWKS+GLGFKTP+EA E
Sbjct  1    MAEQTEKAFLKQPKVFLWYEEVLFSNSKKTTKGNNKPGKEGNRFWKSVGLGFKTPKEAIE  60

Query  447  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQR-------YEKR  289
            GTYIDKKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLH+VKKYQR       YEKR
Sbjct  61   GTYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQRQANLLHWYEKR  120

Query  288  HSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFTG  127
            HSNI AHISPCFRV+EGD+VIIGQCRPLSKTVRFNVLKV+PAGS  G  KKAFTG
Sbjct  121  HSNIPAHISPCFRVREGDHVIIGQCRPLSKTVRFNVLKVVPAGSKSGAVKKAFTG  175



>ref|XP_010245616.1| PREDICTED: 40S ribosomal protein S11-like [Nelumbo nucifera]
Length=160

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP V +SSK+TGKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPHVGISSKRTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI+AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHYVKKYQRYEKRHSNISAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD+VIIGQCRPLSKTVRFNVLKVIP
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIP  145



>ref|XP_010266772.1| PREDICTED: 40S ribosomal protein S11 [Nelumbo nucifera]
Length=160

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGDVSIRGRILAGTCHSAKMIRTIIVRRNYLHYVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD+VIIGQCRPLSKTVRFNVLKVIP
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIP  145



>ref|XP_002267523.1| PREDICTED: 40S ribosomal protein S11 [Vitis vinifera]
 emb|CBI25585.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+ KGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSAKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AH SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMMRTIIVRRNYLHYVKKYQRYEKRHSNIPAHTSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD+VIIGQCRPLSKTVRFNVLKVIP
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIP  145



>ref|XP_006856463.1| hypothetical protein AMTR_s00046p00028310 [Amborella trichopoda]
 gb|ERN17930.1| hypothetical protein AMTR_s00046p00028310 [Amborella trichopoda]
Length=192

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = -2

Query  642  NSLLSSCDTSAATIMA-EQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKT  466
            +SLL   D     I +   TEKAFLKQP VF SSKK+GKGKRPGKGGNRFWK+IGLGFKT
Sbjct  18   SSLLIITDCLTYWIHSGNHTEKAFLKQPKVFQSSKKSGKGKRPGKGGNRFWKNIGLGFKT  77

Query  465  PREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRH  286
            PREA EGTYIDKKCPF+G VSIRGRIL GTC+SAKM RTIIVRR+YLHFVKKYQRYEKRH
Sbjct  78   PREAIEGTYIDKKCPFSGNVSIRGRILTGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRH  137

Query  285  SNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAG-GGKKAF  133
            SNI AHISPCFRVKEGD+V+IGQCRPLSKTVRFNVLKVIPAGS+G GGKKAF
Sbjct  138  SNIPAHISPCFRVKEGDHVVIGQCRPLSKTVRFNVLKVIPAGSSGSGGKKAF  189



>ref|XP_002285422.1| PREDICTED: 40S ribosomal protein S11 [Vitis vinifera]
 emb|CBI21107.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKGGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGGVSIRGRILAGTCHSAKMMRTIIVRRNYLHYVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD+VIIGQCRPLSKTVRFNVLKVIP
Sbjct  121  GDHVIIGQCRPLSKTVRFNVLKVIP  145



>gb|EMT19025.1| 40S ribosomal protein S11 [Aegilops tauschii]
Length=218

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = -2

Query  588  TEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFTGT  409
            TEK+FLKQP VFLS+KK  K KRPGK GNRFWKS+GLGFKTPREA +GTYIDKKCPFTGT
Sbjct  67   TEKSFLKQPKVFLSTKKADKAKRPGKAGNRFWKSVGLGFKTPREAIDGTYIDKKCPFTGT  126

Query  408  VSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGDYV  229
            V+IRGRI+AGTCHSAKMNRTIIVRRNYLHFVKK   YEKRHSNI AHISPCFRVKEGD+V
Sbjct  127  VAIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKK---YEKRHSNIPAHISPCFRVKEGDHV  183

Query  228  IIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            IIGQCRPLSKTVRFNVLKV+PAG+ GGGKKAF
Sbjct  184  IIGQCRPLSKTVRFNVLKVVPAGTTGGGKKAF  215



>dbj|BAC22544.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 emb|CAE05212.3| OSJNBa0070C17.19 [Oryza sativa Japonica Group]
 dbj|BAD30108.1| putative 40S ribosomal protein S11 [Oryza sativa Japonica Group]
 gb|EAY95523.1| hypothetical protein OsI_17369 [Oryza sativa Indica Group]
 gb|EAZ40319.1| hypothetical protein OsJ_24765 [Oryza sativa Japonica Group]
Length=170

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 143/155 (92%), Gaps = 9/155 (6%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ---------RYEKRHSNIAAH  268
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQ         RYEKRHSNI AH
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQGANLPPCRYEKRHSNIPAH  120

Query  267  ISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPA  163
            +SPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPA
Sbjct  121  VSPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPA  155



>gb|KCW50239.1| hypothetical protein EUGRSUZ_J00035 [Eucalyptus grandis]
Length=205

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = -2

Query  636  LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPRE  457
            L S+C  S A  M  QTEKAFLKQP VFL SKK+GKGKRPGKGGNR+ KS+GLGFKTPRE
Sbjct  34   LASACSISQALKMDAQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRYHKSVGLGFKTPRE  93

Query  456  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  277
            A EGTYIDKKCPFTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI
Sbjct  94   AIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRYEKRHSNI  153

Query  276  AAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIP-AGSAGGGKKAFTGM  124
             AHISPCFRVKEGD+V +GQCRPLSKTVRFNVLKVIP   S GGGKKAFTGM
Sbjct  154  PAHISPCFRVKEGDHVTVGQCRPLSKTVRFNVLKVIPAGSSGGGGKKAFTGM  205



>ref|XP_006852797.1| hypothetical protein AMTR_s00033p00158320 [Amborella trichopoda]
 gb|ERN14264.1| hypothetical protein AMTR_s00033p00158320 [Amborella trichopoda]
Length=160

 Score =   251 bits (641),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREA EGT+IDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTFIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG+VSIRGRIL GTC+SAKM RTIIVRR+YLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGSVSIRGRILTGTCYSAKMTRTIIVRRDYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD+V+IGQCRPLSKTVRFNVLKVIP
Sbjct  121  GDHVVIGQCRPLSKTVRFNVLKVIP  145



>gb|AAA34006.1| ribosomal protein S11, partial [Glycine max]
Length=141

 Score =   250 bits (639),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  504  NRFWKSIGLGFKTPREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYL  325
            NRFWKSIGLGFKTPREA EGTYIDKKCPFTG VSIRGRILAGTCHSAKMNRTIIVRRNYL
Sbjct  15   NRFWKSIGLGFKTPREAIEGTYIDKKCPFTGNVSIRGRILAGTCHSAKMNRTIIVRRNYL  74

Query  324  HFVKKYQRYEKRHSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG  145
            HF+KKYQRYEKRHSNI AHISP FRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAGS+ G 
Sbjct  75   HFIKKYQRYEKRHSNIPAHISPAFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGA  134

Query  144  KKAFTGM  124
            KKAFTGM
Sbjct  135  KKAFTGM  141



>gb|EYU32366.1| hypothetical protein MIMGU_mgv1a015357mg [Erythranthe guttata]
 gb|EYU32367.1| hypothetical protein MIMGU_mgv1a015357mg [Erythranthe guttata]
Length=160

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR+WK+IGL +KTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYWKNIGLIYKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRI++GTCHSAKM RTIIVR++Y H+VKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGNVSIRGRIISGTCHSAKMMRTIIVRKDYFHWVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG-GKKAFTGM  124
            GD V IGQCRPLSKTVRFNVLKV PAGS+   GKK+FTG 
Sbjct  121  GDRVTIGQCRPLSKTVRFNVLKVSPAGSSSALGKKSFTGF  160



>gb|EEE68230.1| hypothetical protein OsJ_26414 [Oryza sativa Japonica Group]
Length=519

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL  KK+GKGK+PGKGGNRFWK+IGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNV+KVIPA        +F G+
Sbjct  121  GDHVIIGQCRPLSKTVRFNVIKVIPAWFHSPAISSFLGI  159



>tpg|DAA37073.1| TPA: hypothetical protein ZEAMMB73_529952 [Zea mays]
Length=568

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 145/162 (90%), Gaps = 4/162 (2%)
 Frame = -2

Query  612  AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYID  433
            +A  MAEQTE+AFLKQP VFL SKK  K  +PGKGGNRFWK+IGLGFKTPREA EGTYID
Sbjct  408  SAASMAEQTERAFLKQPKVFLCSKKATKVNKPGKGGNRFWKNIGLGFKTPREAIEGTYID  467

Query  432  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCF  253
            KKCPFTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKK   YEKRHSNI AHISPCF
Sbjct  468  KKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKK---YEKRHSNIPAHISPCF  524

Query  252  RVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG-KKAFT  130
            RVKEGD+VIIGQCRP+SKTVRFNVLKVIPAGS  G  KKAFT
Sbjct  525  RVKEGDHVIIGQCRPVSKTVRFNVLKVIPAGSKSGAVKKAFT  566



>ref|XP_001761870.1| predicted protein [Physcomitrella patens]
 gb|EDQ73311.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEK+FLKQP VFLS+K + KGK  GK G RFWK++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKASSKGKAAGKAGTRFWKNVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL GT +  KM RTI +RR+YLHFV+KYQRYEKRHSN+AAH+SP FRVKE
Sbjct  61   FTGDVSIRGRILTGTVNCTKMTRTITIRRDYLHFVRKYQRYEKRHSNLAAHVSPAFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTGM  124
            GD VIIGQCRPLSKTVRFNVLKVIP G S GG KK FT +
Sbjct  121  GDKVIIGQCRPLSKTVRFNVLKVIPMGASDGGNKKVFTAV  160



>emb|CAE05213.3| OSJNBa0070C17.20 [Oryza sativa Japonica Group]
Length=185

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 143/170 (84%), Gaps = 24/170 (14%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGK+PGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQ---------------------  304
            FTGTVSIRGRI+AGTCHSAKMNRTIIVRRNYLHFVKKYQ                     
Sbjct  61   FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRQVNNYGFYLCFFSFFFPISD  120

Query  303  ---RYEKRHSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPA  163
               RYEKRHSNI AH+SPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPA
Sbjct  121  LGCRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPA  170



>gb|EYU20229.1| hypothetical protein MIMGU_mgv1a015021mg [Erythranthe guttata]
Length=170

 Score =   246 bits (627),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFL SKK+GKGK PGKGGNR++KSIGL +KTPREA+EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLCSKKSGKGKTPGKGGNRYFKSIGLQYKTPREASEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNY+H+V KYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGDVSIRGRILAGTCHSAKMVRTIIVRRNYMHWVSKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTG  127
            GD+V IGQCRPLSKTVRFNVLKV PAG    G++   G
Sbjct  121  GDHVTIGQCRPLSKTVRFNVLKVNPAGQLVLGRRPLQG  158



>ref|XP_001756109.1| predicted protein [Physcomitrella patens]
 ref|XP_001757892.1| predicted protein [Physcomitrella patens]
 ref|XP_001765740.1| predicted protein [Physcomitrella patens]
 gb|EDQ69331.1| predicted protein [Physcomitrella patens]
 gb|EDQ77134.1| predicted protein [Physcomitrella patens]
 gb|EDQ78975.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   245 bits (626),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEK+FLKQP VFLS+K + KGK  GK G RFWK++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKSFLKQPKVFLSTKASAKGKAAGKAGTRFWKNVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL GT +  KM RTI +RR+YLHFV+KYQRYEKRHSN+AAH+SP FRVKE
Sbjct  61   FTGDVSIRGRILTGTVNCTKMTRTITIRRDYLHFVRKYQRYEKRHSNLAAHVSPAFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTGM  124
            GD VIIGQCRPLSKTVRFNVLKVIP G S GG KK FT +
Sbjct  121  GDKVIIGQCRPLSKTVRFNVLKVIPMGASDGGNKKVFTAV  160



>ref|XP_010048926.1| PREDICTED: 40S ribosomal protein S11-like [Eucalyptus grandis]
 gb|KCW81347.1| hypothetical protein EUGRSUZ_C02730 [Eucalyptus grandis]
 gb|KCW81348.1| hypothetical protein EUGRSUZ_C02730 [Eucalyptus grandis]
Length=160

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            M  QTEKAFLKQP VFL S+K+GKGKRPGKGGNR+ KS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MDAQTEKAFLKQPKVFLCSQKSGKGKRPGKGGNRYHKSVGLGFKTPREAVEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP-AGSAGGGKKAFTGM  124
            GD+V +GQCRPLSKTVRFNVLKVIP   S GGGKKAFTGM
Sbjct  121  GDHVTVGQCRPLSKTVRFNVLKVIPAGSSGGGGKKAFTGM  160



>ref|XP_010030990.1| PREDICTED: 40S ribosomal protein S11 [Eucalyptus grandis]
Length=160

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            M  QTEKAFLKQP VFL SKK+GKGKRPGKGGNR+ KS+GLGFKTPREA EGTYIDKKCP
Sbjct  1    MDAQTEKAFLKQPKVFLCSKKSGKGKRPGKGGNRYHKSVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGNVSIRGRILAGTCHSAKMMRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP-AGSAGGGKKAFTGM  124
            GD+V +GQCRPLSKTVRFNVLKVIP   S GGGKKAFTGM
Sbjct  121  GDHVTVGQCRPLSKTVRFNVLKVIPAGSSGGGGKKAFTGM  160



>ref|XP_008242908.1| PREDICTED: 40S ribosomal protein S11-like [Prunus mume]
Length=156

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 140/159 (88%), Gaps = 3/159 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFW           EA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWXXXXX---XXXEAIEGTYIDKKCP  57

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  58   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  117

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKT RFNVLKV PAGS+G GKKAFTG+
Sbjct  118  GDHVTIGQCRPLSKTKRFNVLKVTPAGSSGAGKKAFTGI  156



>ref|XP_009338409.1| PREDICTED: 40S ribosomal protein S11-like [Pyrus x bretschneideri]
Length=156

 Score =   240 bits (612),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 140/159 (88%), Gaps = 3/159 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VF+SSKK+GKGKRPGKGGNRFWKS  + F        GTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFISSKKSGKGKRPGKGGNRFWKSANISFFL---FLTGTYIDKKCP  57

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAGTCHSAKMN+TIIVRRNYLH++KKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  58   FTGNVSIRGRILAGTCHSAKMNKTIIVRRNYLHYIKKYQRYEKRHSNIPAHVSPCFRVKE  117

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+V IGQCRPLSKT RFNVLKV PAGS+G GKKAF G+
Sbjct  118  GDHVTIGQCRPLSKTKRFNVLKVTPAGSSGIGKKAFAGI  156



>ref|XP_002982779.1| hypothetical protein SELMODRAFT_268639 [Selaginella moellendorffii]
 ref|XP_002990930.1| hypothetical protein SELMODRAFT_272177 [Selaginella moellendorffii]
 gb|EFJ07974.1| hypothetical protein SELMODRAFT_272177 [Selaginella moellendorffii]
 gb|EFJ16024.1| hypothetical protein SELMODRAFT_268639 [Selaginella moellendorffii]
Length=160

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQ  VF   K +GK KRPGKGG+RFWK++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQHKVFPLGKTSGKKKRPGKGGSRFWKNVGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FT  VSIRGRIL GT  + KM R+IIVRR+YLH+VKKYQRYEKRHSN+AAH+SPCFRVKE
Sbjct  61   FTSDVSIRGRILTGTVATTKMTRSIIVRRDYLHYVKKYQRYEKRHSNVAAHVSPCFRVKE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAG-SAGGGKKAFTG  127
            GD VI+GQCRPLSKT+RFNVLKVIP G S GG KK FT 
Sbjct  121  GDKVILGQCRPLSKTIRFNVLKVIPRGASDGGAKKVFTA  159



>gb|KDO61816.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=130

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE  120

Query  240  GDYVIIGQCR  211
            GD+VIIGQCR
Sbjct  121  GDHVIIGQCR  130



>gb|KHG16468.1| 40S ribosomal S11 [Gossypium arboreum]
Length=141

 Score =   232 bits (592),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 136/159 (86%), Gaps = 18/159 (11%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+ KGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSSKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTI                  RHSNI AHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMIRTI------------------RHSNIPAHISPCFRVKE  102

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  103  GDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  141



>gb|AEI83509.1| 40S ribosomal protein S11 [Wolffia arrhiza]
Length=142

 Score =   230 bits (587),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  504  NRFWKSIGLGFKTPREATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYL  325
            NR+WKSIGLGFK PREA EGTYIDKKCPFTG VSIRGRIL+G CHSAKMNRTIIVR++Y 
Sbjct  16   NRYWKSIGLGFKVPREAIEGTYIDKKCPFTGNVSIRGRILSGVCHSAKMNRTIIVRKDYP  75

Query  324  HFVKKYQRYEKRHSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGG  145
            H+V+KYQRYEKRHSNI AH+SPCFRV+EGD+V IGQCRPLSKTVRFNVLKV PAGS  GG
Sbjct  76   HYVRKYQRYEKRHSNIPAHVSPCFRVREGDHVTIGQCRPLSKTVRFNVLKVTPAGSGAGG  135

Query  144  KKAFT  130
            KKAF+
Sbjct  136  KKAFS  140



>ref|XP_010904992.1| PREDICTED: 40S ribosomal protein S11 isoform X2 [Elaeis guineensis]
Length=133

 Score =   229 bits (585),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTE+AFLKQP VFL SKK GKGKRPGKGGNRFWKSIGLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTERAFLKQPKVFLCSKKAGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLH+VKKYQRYEKRHSNIAAHISPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHYVKKYQRYEKRHSNIAAHISPCFRVKE  120

Query  240  GDYVIIGQC  214
            GD+VIIGQC
Sbjct  121  GDHVIIGQC  129



>ref|XP_004138715.1| PREDICTED: 40S ribosomal protein S11-3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159258.1| PREDICTED: 40S ribosomal protein S11-3-like isoform 1 [Cucumis 
sativus]
Length=165

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWKSIGLGFKTPR+A EGTYIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPRDAIEGTYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLH+VKKYQRYEKRHSNI AHI+PCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMVRTIIVRRNYLHYVKKYQRYEKRHSNIPAHIAPCFRVKE  120

Query  240  GDYVIIGQCR  211
            GD+VIIGQCR
Sbjct  121  GDHVIIGQCR  130



>emb|CDX96205.1| BnaC02g14460D [Brassica napus]
Length=146

 Score =   223 bits (567),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 5/132 (4%)
 Frame = -2

Query  504  NRFWKSIGLGFKTPREATEGT---YIDK--KCPFTGTVSIRGRILAGTCHSAKMNRTIIV  340
            NRFWK+IGLGFKTPR+A EG    ++++  +CPFTGTVS+RGRILAGTCHSAKM RTII 
Sbjct  15   NRFWKNIGLGFKTPRDAIEGLAYFFVNRGLQCPFTGTVSVRGRILAGTCHSAKMQRTIIF  74

Query  339  RRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAG  160
            RRNY HFVKKYQRYEKRHSNI AH+SPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAG
Sbjct  75   RRNYFHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAG  134

Query  159  SAGGGKKAFTGM  124
            ++   KKAFTGM
Sbjct  135  ASAFAKKAFTGM  146



>ref|XP_005643310.1| ribosomal protein S11 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE18766.1| ribosomal protein S11 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=156

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MA+QTE+AF KQ GV +   K    K PGK G R+WK++GLGFKTP+EA EGTYIDKKCP
Sbjct  1    MADQTERAFQKQLGVNIG-FKKAAKKIPGKFGQRYWKNVGLGFKTPKEAIEGTYIDKKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL+G   S KMNRTIIVRRNY H++KKY RYEKRH+NIA H+SPCFRV +
Sbjct  60   FTGNVSIRGRILSGIVRSTKMNRTIIVRRNYAHYIKKYARYEKRHTNIAVHLSPCFRVHD  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD VI GQCRPLSKTVRFNVL+VIPAGS+   KK FTG 
Sbjct  120  GDTVIFGQCRPLSKTVRFNVLRVIPAGSS--SKKGFTGF  156



>ref|XP_002501446.1| ribosomal protein [Micromonas sp. RCC299]
 gb|ACO62704.1| ribosomal protein [Micromonas sp. RCC299]
Length=158

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  603  IMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKC  424
            + AEQTEKA+ KQ GV +     GK  RPGK G R++K++GLGFKTPREA EGTYIDKKC
Sbjct  1    MAAEQTEKAYQKQLGVNVGFGPKGKKARPGKNGTRYYKNVGLGFKTPREAIEGTYIDKKC  60

Query  423  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVK  244
            PFTG VSIRGRIL G   + KMNRT+I+R +YLH++KKYQRYEKRH+N+ AHISPCFRVK
Sbjct  61   PFTGNVSIRGRILTGLVKTHKMNRTLIMRMDYLHYIKKYQRYEKRHTNLPAHISPCFRVK  120

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG  148
            EGD V++GQCRPLSKTVRFNVLKVIP+GS  G
Sbjct  121  EGDTVVVGQCRPLSKTVRFNVLKVIPSGSKSG  152



>ref|XP_001418420.1| Ribosomal protein S11, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96713.1| Ribosomal protein S11, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=158

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -2

Query  603  IMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKC  424
            + AEQ E+AF KQ GV +      K K PGKGGNR++K++GLGFKTPREA EGTYIDKKC
Sbjct  1    MAAEQHERAFQKQLGVNVGFASATKKKTPGKGGNRYYKNVGLGFKTPREAIEGTYIDKKC  60

Query  423  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVK  244
            PFTG VSIRGRIL G   S KMNRTI++R +YLHF++KYQRYEKRH+NI+AHISPCFR  
Sbjct  61   PFTGNVSIRGRILTGVVKSTKMNRTIVMRMDYLHFIRKYQRYEKRHTNISAHISPCFRCN  120

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            EGD V++GQCRPLSKTVRFN LKVIP+GS  G  KAF
Sbjct  121  EGDKVVVGQCRPLSKTVRFNTLKVIPSGSKAG--KAF  155



>gb|KDO61815.1| hypothetical protein CISIN_1g031480mg [Citrus sinensis]
Length=132

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -2

Query  447  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAH  268
            GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI AH
Sbjct  25   GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAH  84

Query  267  ISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            ISPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT M
Sbjct  85   ISPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM  132



>ref|XP_006450367.1| hypothetical protein CICLE_v10009763mg [Citrus clementina]
 gb|ESR63607.1| hypothetical protein CICLE_v10009763mg [Citrus clementina]
Length=114

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -2

Query  450  EGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAA  271
             GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI A
Sbjct  6    SGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPA  65

Query  270  HISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            HISPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAGS+GG KKAFT M
Sbjct  66   HISPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGAKKAFTAM  114



>ref|XP_010417155.1| PREDICTED: 40S ribosomal protein S11-1-like isoform X2 [Camelina 
sativa]
 ref|XP_010429367.1| PREDICTED: 40S ribosomal protein S11-1-like isoform X2 [Camelina 
sativa]
Length=131

 Score =   218 bits (554),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAFLKQP VFLSSKK+GKGKRPGKGGNRFWK+IGLGFKTPREATEG YIDKKCP
Sbjct  1    MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREATEGAYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTGTVSIRGRILAGTCHSAKM RTIIVRRNYLHFVKKYQRYEKRHSNI AH+SPCFRVKE
Sbjct  61   FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE  120

Query  240  GDYVII  223
            GD+  +
Sbjct  121  GDHTFV  126



>gb|KJB23701.1| hypothetical protein B456_004G110600 [Gossypium raimondii]
Length=116

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = -2

Query  450  EGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAA  271
            EGTYIDKKCPFTG VS+RGRILAGTCHSAKM RTIIVRRNYLH++KKYQRYEKRHSNI A
Sbjct  8    EGTYIDKKCPFTGPVSVRGRILAGTCHSAKMMRTIIVRRNYLHYIKKYQRYEKRHSNIPA  67

Query  270  HISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            HISPCFRVKEGD+VIIGQCRPLSKTVRFNVLKVIPAGS+GGGKKAFTGM
Sbjct  68   HISPCFRVKEGDHVIIGQCRPLSKTVRFNVLKVIPAGSSGGGKKAFTGM  116



>emb|CEF98300.1| Ribosomal protein S17 [Ostreococcus tauri]
Length=151

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 8/156 (5%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MA+Q E+AF KQ GV              K G R++K++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MADQHERAFQKQLGV------QRGFGSHTKKGERYYKNVGLGFKTPREAIEGTYIDKKCP  54

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL G   SAKMNRTI++R +YLHF++KYQRYEKRH+NI+AH+SPCFR  E
Sbjct  55   FTGNVSIRGRILTGVVKSAKMNRTIVMRMDYLHFIRKYQRYEKRHTNISAHLSPCFRCNE  114

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD V++GQCRPLSKTVRFN LKVIP+GS GG  KAF
Sbjct  115  GDKVVVGQCRPLSKTVRFNTLKVIPSGSKGG--KAF  148



>ref|XP_001702980.1| ribosomal protein S11, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO96718.1| ribosomal protein S11 [Chlamydomonas reinhardtii]
Length=156

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MA+QTE+AF KQ GV     K+ + K PGK G+RF+K IGLGFKTP+EA EG YIDKKCP
Sbjct  1    MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL G   S KMNRTIIVRR+YLHFVKKY RYEKRH NI+AHISPCFRV+E
Sbjct  60   FTGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNISAHISPCFRVRE  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            GD V+IGQCRPLSKTVRFNVL+V P+GS+   KK F+
Sbjct  120  GDSVVIGQCRPLSKTVRFNVLRVTPSGSS--AKKGFS  154



>ref|XP_002947898.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50886.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=156

 Score =   215 bits (547),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MA+QTE+AF KQ GV     K+ + K PGK G+R++K IGLGFKTP+EA EG YIDKKCP
Sbjct  1    MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRYYKQIGLGFKTPKEAIEGHYIDKKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL+G   S KMNRTIIVRR+YLH+VKKY RYEKRH NIAAH+SPCFRVKE
Sbjct  60   FTGNVSIRGRILSGVVKSTKMNRTIIVRRDYLHYVKKYGRYEKRHRNIAAHVSPCFRVKE  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            GD V++GQCRPLSKTVRFNVL+V P GS+   KK F+
Sbjct  120  GDSVVVGQCRPLSKTVRFNVLRVTPQGSS--AKKGFS  154



>ref|XP_005842843.1| hypothetical protein CHLNCDRAFT_37706 [Chlorella variabilis]
 gb|EFN50731.1| hypothetical protein CHLNCDRAFT_37706 [Chlorella variabilis]
Length=157

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MA+QTE+AF +Q  V             GKGG R++K++GLGF+TP+EA EG YID KCP
Sbjct  1    MADQTERAFQRQLAV-QRGYNKPAKNIVGKGGKRWYKNVGLGFRTPKEAIEGNYIDHKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRILAG   S KMNRTI++RR+YLHF+KKYQRYEKRH+NI+AHISPCFR  E
Sbjct  60   FTGNVSIRGRILAGKVKSTKMNRTIVMRRDYLHFIKKYQRYEKRHTNISAHISPCFRCNE  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD VIIGQCRPLSKTVRFNVL+VIPAG AGG KK+F
Sbjct  120  GDNVIIGQCRPLSKTVRFNVLRVIPAG-AGGSKKSF  154



>ref|XP_003059480.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56612.1| predicted protein [Micromonas pusilla CCMP1545]
Length=156

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -2

Query  603  IMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKC  424
            + AEQTEKA+ KQ GV  ++  + K K PGK G R++KS+GLGFKTPREA EGTYIDKKC
Sbjct  1    MAAEQTEKAYQKQLGV--NAGCSIKNKAPGKAGTRYYKSVGLGFKTPREAIEGTYIDKKC  58

Query  423  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVK  244
            PFTG VSIRGRIL GT  S KM RT+I+R +YLH+++KYQRYEKRH+NIAAHISPCFR  
Sbjct  59   PFTGNVSIRGRILTGTVKSYKMKRTLIMRMDYLHYIQKYQRYEKRHTNIAAHISPCFRCF  118

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGG  148
            EGD V++GQCRPLSKTVRFN LKVIP+GS  G
Sbjct  119  EGDTVVVGQCRPLSKTVRFNTLKVIPSGSKAG  150



>sp|P42756.1|RS11_DUNTE RecName: Full=40S ribosomal protein S11 [Dunaliella tertiolecta]
 emb|CAA46835.1| ribosomal protein S11 [Dunaliella tertiolecta]
Length=157

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAF KQ GV     K+ + K PGK G+RF+K++GL FKTP+EA +G Y+DKKCP
Sbjct  1    MAEQTEKAFQKQVGV-TGCFKSKEKKAPGKSGHRFFKNVGLNFKTPKEAIDGNYVDKKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL G   S+KM RTIIVRR+YLHF+ KY RYEKRH+NI AH+SPCFRV++
Sbjct  60   FTGNVSIRGRILTGVVKSSKMMRTIIVRRDYLHFIPKYARYEKRHTNIPAHVSPCFRVRD  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD VIIGQCRPLSKT+RFNVL+VIP   A  GKK+F+G 
Sbjct  120  GDTVIIGQCRPLSKTIRFNVLRVIPQAGA-TGKKSFSGF  157



>gb|ABD64589.1| 40S ribosomal protein S11 [Chlamydomonas sp. ICE-L]
Length=155

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 129/159 (81%), Gaps = 4/159 (3%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQ EKA+ KQ GV  +  K    K PGKGG+RF+KS+GLGFKTP+ A EGTYIDKKCP
Sbjct  1    MAEQNEKAYQKQLGV-TAGFKVKDKKAPGKGGHRFYKSVGLGFKTPQSAIEGTYIDKKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL GT  S KM RTI+VRR+YLHFVKKY RYEKRHSN++AH SPCFRVK+
Sbjct  60   FTGDVSIRGRILTGTVKSTKMTRTIVVRRDYLHFVKKYARYEKRHSNLSAHCSPCFRVKD  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            GD V++GQCRPL+KTVRFNVLK I + ++   KKAF+G 
Sbjct  120  GDTVVVGQCRPLTKTVRFNVLKHIASSAS---KKAFSGF  155



>ref|XP_002841871.1| 40S ribosomal protein S11 [Tuber melanosporum Mel28]
 emb|CAZ86062.1| unnamed protein product [Tuber melanosporum]
Length=161

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK     +R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLASKTRPAKRRVGKGGRRWYKDVGLGFKTPKTAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+++RR+YLH++ KYQRYEKRH NI+AH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVISTKMHRTLVIRRDYLHYIPKYQRYEKRHKNISAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G G KAF
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKGVKAF  158



>ref|XP_006573320.1| PREDICTED: 40S ribosomal protein S11-like [Glycine max]
Length=118

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  447  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAH  268
            GTYIDKKCPFTG VSIRGRILAGTCHSAKM+RTIIVRRNYLHF+KKYQRYEKRHSNI AH
Sbjct  11   GTYIDKKCPFTGNVSIRGRILAGTCHSAKMSRTIIVRRNYLHFIKKYQRYEKRHSNIPAH  70

Query  267  ISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFTGM  124
            ISPCFRVKEGD+VIIGQCRP+SKTVRFNVLKVIP GS+ G KK FTGM
Sbjct  71   ISPCFRVKEGDHVIIGQCRPISKTVRFNVLKVIPGGSSSGAKKGFTGM  118



>ref|XP_011399858.1| 40S ribosomal protein S11 [Auxenochlorella protothecoides]
 gb|KFM26910.1| 40S ribosomal protein S11 [Auxenochlorella protothecoides]
Length=156

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 122/156 (78%), Gaps = 3/156 (2%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MA+QTE+AF +Q G           K PGK G RF+K+IGLGFKTP+EA EG YID KCP
Sbjct  1    MADQTERAFQRQLGA-QRGYNKSTKKTPGKAGARFYKNIGLGFKTPKEAIEGNYIDHKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG +SIRGRIL G   S KM RT+++RR+YLH+++KYQRYEKRH+NIAAHISP FR  E
Sbjct  60   FTGNISIRGRILVGKVKSTKMTRTLVLRRDYLHYIRKYQRYEKRHTNIAAHISPAFRASE  119

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            GD VI+GQCRPLSKTVRFNVL+V+PAGS   GKK F
Sbjct  120  GDTVIVGQCRPLSKTVRFNVLRVVPAGS--NGKKGF  153



>gb|EMF17289.1| 40S ribosomal protein S11 [Sphaerulina musiva SO2202]
Length=161

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSQKKSTRVGKGGRRWYKDVGLGFRTPKTAIEGQYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  SAKM+RTII+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSAKMHRTIIIRREYLHFVPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V EGD V +GQCRPLSKTVRFNVL+V+P    G   K FT
Sbjct  122  VSEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKQVKQFT  159



>gb|KFY68897.1| hypothetical protein V496_00720 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY98476.1| hypothetical protein V498_01442 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=161

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 125/160 (78%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFKTPKTAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G +SIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGQISIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G   KAF+
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKAFS  159



>gb|KFY96632.1| hypothetical protein V500_02366 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=161

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFKTPKNAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGEVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>gb|ESX00172.1| 40S ribosomal protein S11-A [Ogataea parapolymorpha DL-1]
Length=155

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 121/160 (76%), Gaps = 8/160 (5%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+EKAF KQP +F + K     +       R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSEKAFQKQPHIFTNPKAKASRRT-----KRWYKDVGLGFKTPKSAIEGTYIDK  56

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTGTVSIRGRIL GT  S KM+RTII+RR+YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  57   KCPFTGTVSIRGRILTGTVVSTKMHRTIIIRRDYLHYIPKYNRYEKRHKNLAAHVSPAFR  116

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNV+KV    SA G  KAFT
Sbjct  117  VQEGDIVTVGQCRPLSKTVRFNVVKV---ASAKGKAKAFT  153



>gb|ELR05457.1| 40S ribosomal protein S11 [Pseudogymnoascus destructans 20631-21]
 gb|KFZ10497.1| hypothetical protein V501_05169 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=161

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 125/160 (78%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKNAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G   KAF+
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKAFS  159



>gb|EHK40336.1| hypothetical protein TRIATDRAFT_302714 [Trichoderma atroviride 
IMI 206040]
Length=161

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKTKSARPGKGGRRWYKDVGLGFRTPKAAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTGTVSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGTVSIRGRILTGTVVSTKMHRTVIIRREYLHFIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKT+RFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTIRFNVLRVLP  149



>gb|KFY00910.1| hypothetical protein O988_03033 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY03132.1| hypothetical protein V490_00279 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFY45545.1| hypothetical protein V495_02920 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY61154.1| hypothetical protein V497_03100 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
 gb|KFY76566.1| hypothetical protein V499_03857 [Pseudogymnoascus pannorum VKM 
F-103]
Length=161

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 125/160 (78%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G   KAF+
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKAFS  159



>gb|KFY15274.1| hypothetical protein V492_02114 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY41133.1| hypothetical protein V494_03196 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=238

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = -2

Query  621  DTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGT  442
            + + AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGT
Sbjct  75   NANMATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGT  134

Query  441  YIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHIS  262
            YIDKKCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+S
Sbjct  135  YIDKKCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVS  194

Query  261  PCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            P FRV+EGD V +GQCRPLSKTVRFNVL+V+P    G   KAF+
Sbjct  195  PAFRVEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKAFS  236



>gb|KFZ16779.1| hypothetical protein V502_04895 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=161

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGFKTP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFKTPKNAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGEVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>emb|CCQ18653.1| 40S ribosomal protein S11 [Sycon ciliatum]
Length=153

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 123/157 (78%), Gaps = 8/157 (5%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQTEKAF KQP VFL+ K     K+     +RF +++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQTEKAFQKQPTVFLNRKAVPGQKKT----SRFVRNVGLGFKTPREAEEGTYIDKKCP  56

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR-VK  244
            FTG VSIRGRIL G   S KM RTI++RR+YLH+++KY RYEKRH NI+AH+SPCF+ V+
Sbjct  57   FTGNVSIRGRILTGVVASMKMKRTIVIRRDYLHYIRKYNRYEKRHKNISAHLSPCFQDVQ  116

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
             GD +++GQCRPLSKTVRFNVLKV     +  GKK+F
Sbjct  117  LGDIIVVGQCRPLSKTVRFNVLKV---QRSAAGKKSF  150



>emb|CCT63377.1| probable 40s ribosomal protein s11.e, cytosolic [Fusarium fujikuroi 
IMI 58289]
Length=167

 Score =   206 bits (523),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -2

Query  621  DTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGT  442
            D   AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+
Sbjct  4    DDDKATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGS  63

Query  441  YIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHIS  262
            YIDKKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF+ KY RYEKRH N+AAH+S
Sbjct  64   YIDKKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYSRYEKRHKNVAAHVS  123

Query  261  PCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            P FRV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  124  PAFRVQEGDQVTVGQCRPLSKTVRFNVLRVLP  155



>gb|EMT61393.1| 40S ribosomal protein S11-B [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH61491.1| 40S ribosomal protein S11-B [Fusarium oxysporum f. sp. cubense 
race 1]
Length=167

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -2

Query  621  DTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGT  442
            D   AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+
Sbjct  4    DDDKATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKAAIEGS  63

Query  441  YIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHIS  262
            YIDKKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF+ KY RYEKRH N+AAH+S
Sbjct  64   YIDKKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYSRYEKRHKNVAAHVS  123

Query  261  PCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            P FRV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  124  PAFRVEEGDQVTVGQCRPLSKTVRFNVLRVLP  155



>gb|KFY31291.1| hypothetical protein V493_01246 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=161

 Score =   205 bits (522),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGEVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_006696347.1| 40S ribosomal protein S11-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS18016.1| 40S ribosomal protein S11-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=161

 Score =   205 bits (521),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AFLKQP +FL+SK   K  RPGKGG R++K +GLGFKTP+ A EG YIDK
Sbjct  2    ATELTVQSERAFLKQPHIFLNSKVKVKSTRPGKGGRRWYKDVGLGFKTPKTAIEGHYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL G   S KM+RTII+RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGMVSIRGRILTGRVVSTKMHRTIIIRREYLHYIPKYNRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V++GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDMVVVGQCRPLSKTVRFNVLRVLP  149



>gb|KEZ42227.1| hypothetical protein SAPIO_CDS6080 [Scedosporium apiospermum]
Length=161

 Score =   205 bits (521),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+A+LKQP +F ++K   K  RPGKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAYLKQPHIFQNAKVKVKSTRPGKGGRRWYKDVGLGFRTPKTAIEGNYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+IVRR YLHF+KKY RYEKRH N+A H+SPCFR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTVIVRREYLHFIKKYSRYEKRHKNLAVHVSPCFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_002901699.1| 40S ribosomal protein S11 [Phytophthora infestans T30-4]
 ref|XP_008913503.1| archaeal ribosomal protein S17P [Phytophthora parasitica INRA-310]
 ref|XP_009516691.1| hypothetical protein PHYSODRAFT_353636 [Phytophthora sojae]
 ref|XP_009516703.1| hypothetical protein PHYSODRAFT_353660 [Phytophthora sojae]
 gb|EEY58755.1| 40S ribosomal protein S11 [Phytophthora infestans T30-4]
 gb|EGZ29416.1| hypothetical protein PHYSODRAFT_353636 [Phytophthora sojae]
 gb|EGZ29428.1| hypothetical protein PHYSODRAFT_353660 [Phytophthora sojae]
 gb|ETI34812.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1569]
 gb|ETI34831.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1569]
 gb|ETN01176.1| archaeal ribosomal protein S17P [Phytophthora parasitica INRA-310]
 gb|ETO63572.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1976]
 gb|ETO63573.1| archaeal ribosomal protein S17P [Phytophthora parasitica P1976]
 gb|ETP04670.1| archaeal ribosomal protein S17P [Phytophthora parasitica CJ01A1]
 gb|ETP32818.1| archaeal ribosomal protein S17P [Phytophthora parasitica P10297]
Length=159

 Score =   204 bits (520),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = -2

Query  594  EQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFT  415
            +QTEKA+ KQ GVFL+SKK    K+      RF+K +GLGFKTP+ A EG Y+DKKCPFT
Sbjct  5    DQTEKAYQKQQGVFLASKKFAGKKKGP----RFYKEVGLGFKTPKSAIEGQYVDKKCPFT  60

Query  414  GTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGD  235
            G +SIRGRIL G   S KM RTIIVRR+YLHFVKKY+R+EKRH N+AAH+SP FRVKEGD
Sbjct  61   GNISIRGRILKGVVLSTKMKRTIIVRRDYLHFVKKYKRFEKRHKNVAAHLSPAFRVKEGD  120

Query  234  YVIIGQCRPLSKTVRFNVLKVIPA  163
             V IGQCRPL+KTVRFNVL+V PA
Sbjct  121  VVTIGQCRPLAKTVRFNVLEVEPA  144



>emb|CCA19404.1| 40S ribosomal protein S11 putative [Albugo laibachii Nc14]
Length=159

 Score =   204 bits (520),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = -2

Query  594  EQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFT  415
            +QTEKAF KQ GVFL+SKK    K+      R +K IGLGFKTP+ A EG YIDKKCPFT
Sbjct  5    DQTEKAFQKQEGVFLASKKYVNKKKGP----RKFKDIGLGFKTPKAAIEGQYIDKKCPFT  60

Query  414  GTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGD  235
              VSIRGRIL G   S KM RTIIVRR+YLH+VKKY+R+EKRH N+AAH+SPCFRVKEGD
Sbjct  61   SNVSIRGRILKGVVLSTKMKRTIIVRRDYLHYVKKYKRFEKRHKNVAAHVSPCFRVKEGD  120

Query  234  YVIIGQCRPLSKTVRFNVLKVIPAGS  157
             V IGQCRPL+KTVRFNVL+V+PA  
Sbjct  121  VVTIGQCRPLAKTVRFNVLEVLPASE  146



>gb|EYB33503.1| hypothetical protein FG05_00671 [Fusarium graminearum]
Length=185

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  627  SCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATE  448
            +C  + AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A E
Sbjct  20   TCCGARATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIE  79

Query  447  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAH  268
            G+YIDKKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+AAH
Sbjct  80   GSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVAAH  139

Query  267  ISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            +SP FRV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  140  VSPAFRVQEGDQVTVGQCRPLSKTVRFNVLRVLP  173



>gb|EHK25200.1| hypothetical protein TRIVIDRAFT_79227 [Trichoderma virens Gv29-8]
Length=161

 Score =   204 bits (520),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKTKSVRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTVIIRREYLHYIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G   K+FT
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKSFT  159



>ref|XP_001560156.1| 40S ribosomal protein S11 [Botrytis cinerea B05.10]
 emb|CCD49311.1| similar to 40S ribosomal protein S11 [Botrytis cinerea T4]
 gb|EMR82615.1| putative 40s ribosomal protein s11 protein [Botrytis cinerea 
BcDW1]
Length=161

 Score =   204 bits (520),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSKTKSSRVGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>gb|KHN96715.1| 40S ribosomal protein S11 [Metarhizium album ARSEF 1941]
Length=172

 Score =   205 bits (521),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  636  LLSSCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPRE  457
            L  +     AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ 
Sbjct  4    LFETLTRIMATELTVQSERAFQKQPHIFLNSKTKAKSARPGKGGRRWYKDVGLGFRTPKT  63

Query  456  ATEGTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNI  277
            A EG+YIDKKCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+
Sbjct  64   AIEGSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNL  123

Query  276  AAHISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            AAH+SP FRV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  124  AAHVSPAFRVEEGDQVTVGQCRPLSKTVRFNVLRVLP  160



>ref|XP_008610788.1| 40S ribosomal protein S11 [Saprolegnia diclina VS20]
 gb|EQC36026.1| 40S ribosomal protein S11 [Saprolegnia diclina VS20]
 gb|KDO29959.1| 40S ribosomal protein S11 [Saprolegnia parasitica CBS 223.65]
Length=159

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 114/144 (79%), Gaps = 4/144 (3%)
 Frame = -2

Query  594  EQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFT  415
            EQ EKAF KQ GVFL+SKK    K       RF+KSIGLGFKTP+ A EG Y+DKKCPFT
Sbjct  5    EQNEKAFQKQDGVFLASKKFAGKKSGP----RFYKSIGLGFKTPKTAIEGAYVDKKCPFT  60

Query  414  GTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGD  235
            G VSIRGRIL G   S KM RTIIVRR+YLHF+KKY+R+EKRH N+AAH+SP FRVKEGD
Sbjct  61   GNVSIRGRILKGVVLSTKMKRTIIVRRDYLHFIKKYKRFEKRHKNVAAHVSPAFRVKEGD  120

Query  234  YVIIGQCRPLSKTVRFNVLKVIPA  163
             V IGQCRPLSKTVRFNV++V  A
Sbjct  121  VVTIGQCRPLSKTVRFNVVEVEAA  144



>gb|KFG78441.1| 40S ribosomal protein S11 [Metarhizium anisopliae]
 gb|KID60391.1| Ribosomal protein S17, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID75345.1| hypothetical protein MBR_05672, partial [Metarhizium brunneum 
ARSEF 3297]
Length=162

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  3    ATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  62

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  63   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLAAHVSPAFR  122

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  123  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  150



>ref|XP_003382520.1| PREDICTED: 40S ribosomal protein S11-like [Amphimedon queenslandica]
Length=158

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 124/158 (78%), Gaps = 5/158 (3%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgG-NRFWKSIGLGFKTPREATEGTYIDKKC  424
            MA+QTEKA+ KQ GVF +SK    G    KG   RF +++GLGFKTP+EA EGTYIDKKC
Sbjct  1    MADQTEKAYQKQKGVFQNSKAVLLGLGKKKGKGQRFVRNVGLGFKTPKEAIEGTYIDKKC  60

Query  423  PFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR-V  247
            PFTG VSIRGRIL GT  S KM RTI++RR+YLH++KKY R+EKRH N++AH+SPCFR V
Sbjct  61   PFTGNVSIRGRILTGTVRSMKMKRTIVIRRDYLHYIKKYNRFEKRHKNLSAHLSPCFRDV  120

Query  246  KEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            + GD V++GQCRPLSKTVRFNVLKV  A S   GKK F
Sbjct  121  ELGDLVVVGQCRPLSKTVRFNVLKVQKAKS---GKKQF  155



>ref|XP_006966565.1| hypothetical protein TRIREDRAFT_122587 [Trichoderma reesei QM6a]
 gb|EGR47438.1| hypothetical protein TRIREDRAFT_122587 [Trichoderma reesei QM6a]
 gb|ETS00867.1| 40S ribosomal protein S11 [Trichoderma reesei RUT C-30]
Length=161

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTVIIRREYLHYIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKT+RFNVL+V+P    G   K+FT
Sbjct  122  VEEGDQVTVGQCRPLSKTIRFNVLRVLP--RTGKAVKSFT  159



>emb|CCI40506.1| unnamed protein product [Albugo candida]
Length=159

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = -2

Query  594  EQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFT  415
            +QTEKAF KQ GVFL+SKK    K+      R +K IGLGFKTP+ A EG YIDKKCPFT
Sbjct  5    DQTEKAFQKQEGVFLASKKYANKKKGP----RKYKDIGLGFKTPKAAIEGQYIDKKCPFT  60

Query  414  GTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGD  235
              VSIRGRIL G   S KM RTIIVRR+YLH+VKKY+R+EKRH N+AAH+SPCFRVKEGD
Sbjct  61   SNVSIRGRILKGVVLSTKMKRTIIVRRDYLHYVKKYKRFEKRHKNVAAHVSPCFRVKEGD  120

Query  234  YVIIGQCRPLSKTVRFNVLKVIPA  163
             V IGQCRPL+KTVRFNVL+V PA
Sbjct  121  VVTIGQCRPLAKTVRFNVLEVFPA  144



>ref|XP_003659345.1| hypothetical protein MYCTH_2088473 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO54100.1| hypothetical protein MYCTH_2088473 [Myceliophthora thermophila 
ATCC 42464]
Length=161

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGFKTP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKSTRPGKGGRRWYKDVGLGFKTPKTAIEGQYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGMVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYNRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_009252037.1| hypothetical protein FPSE_00642 [Fusarium pseudograminearum CS3096]
 gb|EKJ79167.1| hypothetical protein FPSE_00642 [Fusarium pseudograminearum CS3096]
Length=182

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  612  AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYID  433
            AAT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YID
Sbjct  22   AATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKAAIEGSYID  81

Query  432  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCF  253
            KKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+AAH+SP F
Sbjct  82   KKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVAAHVSPAF  141

Query  252  RVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            RV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  142  RVQEGDQVTVGQCRPLSKTVRFNVLRVLP  170



>gb|EXV02037.1| 40S ribosomal protein S17 [Metarhizium robertsii]
Length=161

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_011316367.1| 40S ribosomal protein S11 [Fusarium graminearum PH-1]
 gb|ESU05882.1| 40S ribosomal protein S11 [Fusarium graminearum PH-1]
Length=161

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VQEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_003716203.1| 40S ribosomal protein S11 [Magnaporthe oryzae 70-15]
 gb|ADD84572.1| Rps11bp [Magnaporthe oryzae]
 gb|EHA49884.1| 40S ribosomal protein S11 [Magnaporthe oryzae 70-15]
 gb|ELQ38323.1| 40S ribosomal protein S11 [Magnaporthe oryzae Y34]
 gb|ELQ61607.1| 40S ribosomal protein S11 [Magnaporthe oryzae P131]
Length=161

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKSARPGKGGRRYYKDVGLGFRTPKTAIEGQYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+++RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILNGTVISTKMHRTLVIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD+V +GQCRPLSKTVRFNVLKV P
Sbjct  122  VEEGDHVTVGQCRPLSKTVRFNVLKVQP  149



>gb|KHJ35420.1| putative 40s ribosomal protein s11 [Erysiphe necator]
Length=161

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  +PGKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKTKSVKPGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG +SIRGRIL GT  S KM+RT+IVRR YLHF+ KY RYE+RH N+AAH+SP FR
Sbjct  62   KCPFTGLISIRGRILTGTVVSTKMHRTLIVRREYLHFIPKYARYERRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_002791628.1| 40S ribosomal protein S11 [Paracoccidioides sp. 'lutzii' Pb01]
 ref|XP_010757385.1| 40S ribosomal protein S11 [Paracoccidioides brasiliensis Pb18]
 gb|EEH20543.1| 40S ribosomal protein S11 [Paracoccidioides brasiliensis Pb03]
 gb|EEH35320.1| 30S ribosomal protein S17P [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH45117.1| 40S ribosomal protein S11 [Paracoccidioides brasiliensis Pb18]
Length=161

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK+  K K+ GKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKQKSKSKKVGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH NIAAH+SP FR
Sbjct  62   KCPFTGQVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYSRYEKRHKNIAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G G K F
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKGVKQF  158



>gb|KIE01292.1| Ribosomal protein S17, partial [Metarhizium majus ARSEF 297]
Length=167

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -2

Query  627  SCDTSAATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATE  448
            S  T  AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A E
Sbjct  2    SSVTVEATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIE  61

Query  447  GTYIDKKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAH  268
            G+YIDKKCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH
Sbjct  62   GSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLAAH  121

Query  267  ISPCFRVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            +SP  RV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VSPALRVEEGDQVTVGQCRPLSKTVRFNVLRVLP  155



>gb|KID89820.1| Ribosomal protein S17 [Metarhizium guizhouense ARSEF 977]
Length=174

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  15   ATELTVQSERAFQKQPHIFLNSKTKAKSSRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  74

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  75   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLAAHVSPAFR  134

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  135  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  162



>gb|EPE10077.1| 40s ribosomal protein s11 [Ophiostoma piceae UAMH 11346]
Length=161

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K++GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKTARPGKNGRRWYKNVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH+N+AAH SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYSRYEKRHTNLAAHCSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKT+RFNVL+V+P    G   KAFT
Sbjct  122  VEEGDQVTVGQCRPLSKTIRFNVLRVLP--RTGKTVKAFT  159



>ref|XP_007797900.1| putative 40s ribosomal protein s11 protein [Eutypa lata UCREL1]
 gb|EMR62989.1| putative 40s ribosomal protein s11 protein [Eutypa lata UCREL1]
Length=161

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K +GLGFKTP+ A +G+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKTSRPGKNGRRWYKDVGLGFKTPKTAIDGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_007920165.1| hypothetical protein MYCFIDRAFT_55564 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME89086.1| hypothetical protein MYCFIDRAFT_55564 [Pseudocercospora fijiensis 
CIRAD86]
Length=161

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TPR A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSKAKSTRVGKGGRRWYKDVGLGFRTPRTAIEGKYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V++GD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEDGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_002491500.1| 40S ribosomal protein S11 [Komagataella pastoris GS115]
 emb|CAY69220.1| Protein component of the small (40S) ribosomal subunit [Komagataella 
pastoris GS115]
 emb|CCA38389.1| 40S ribosomal protein S11 [Komagataella pastoris CBS 7435]
Length=155

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+EKAF KQP +F + K     +       R+ K +GLGFKTP+ A EG+YIDK
Sbjct  2    ATELIVQSEKAFQKQPHIFTNPKAKANKRT-----KRWHKDVGLGFKTPKSAIEGSYIDK  56

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTGTVSIRG+IL GT  S KM+RTII+RR+YLH+V KY RYEKRH N+AAH+SP FR
Sbjct  57   KCPFTGTVSIRGKILTGTVISTKMHRTIIIRRDYLHYVPKYNRYEKRHKNVAAHVSPAFR  116

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKK  139
            V EGD V +GQCRPLSKTVRFNVLKV PA   GG KK
Sbjct  117  VNEGDLVTVGQCRPLSKTVRFNVLKVTPA--VGGNKK  151



>gb|EPQ62013.1| Protein component of the small (40S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU74536.1| 40S ribosomal protein S11 [Blumeria graminis f. sp. hordei DH14]
Length=161

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  + GKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKTKSTKVGKGGRRWYKDVGLGFRTPKTAIEGNYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_007292620.1| 40S ribosomal protein S11 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD17154.1| 40S ribosomal protein S11 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=161

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K    GKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKSKSKSTAVGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V++GD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEDGDQVTVGQCRPLSKTVRFNVLRVLP  149



>gb|KIL84538.1| 40s ribosomal protein s11 [Fusarium avenaceum]
Length=181

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  612  AATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYID  433
             AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YID
Sbjct  21   TATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGSYID  80

Query  432  KKCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCF  253
            KKCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF+ KY RYEKRH N+AAH+SP F
Sbjct  81   KKCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYSRYEKRHKNVAAHVSPAF  140

Query  252  RVKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            RV+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  141  RVQEGDQVTVGQCRPLSKTVRFNVLRVLP  169



>ref|XP_008860970.1| archaeal ribosomal protein S17P [Aphanomyces invadans]
 gb|ETW09559.1| archaeal ribosomal protein S17P [Aphanomyces invadans]
Length=161

 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 117/149 (79%), Gaps = 4/149 (3%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            +T   +QTEKAF KQ GVFL+SKK    K       RF+KSIGLGFKTP+ A EG Y+DK
Sbjct  2    STEHVDQTEKAFQKQDGVFLASKKFAGKKSGP----RFYKSIGLGFKTPKTAIEGGYVDK  57

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL G   S KM RTIIVRR+YLH++KKY+R+EKRH N+AAH+SP FR
Sbjct  58   KCPFTGNVSIRGRILKGVVLSNKMKRTIIVRRDYLHYIKKYKRFEKRHKNVAAHVSPAFR  117

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPA  163
            VKEGD V IGQCRPL+KTVRFNVL+V  A
Sbjct  118  VKEGDVVTIGQCRPLAKTVRFNVLEVEAA  146



>emb|CEF72646.1| unnamed protein product [Fusarium graminearum]
Length=157

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            M  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDKKCP
Sbjct  1    MTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKTAIEGSYIDKKCP  60

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKE  241
            FTG VSIRGRIL GT  S KM+RTII+RR YLHF++KY RYEKRH N+AAH+SP FRV+E
Sbjct  61   FTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIQKYSRYEKRHKNVAAHVSPAFRVQE  120

Query  240  GDYVIIGQCRPLSKTVRFNVLKVIP  166
            GD V +GQCRPLSKTVRFNVL+V+P
Sbjct  121  GDQVTVGQCRPLSKTVRFNVLRVLP  145



>gb|EFW99488.1| 40S ribosomal protein s11 [Grosmannia clavigera kw1407]
Length=161

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K++GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKTSRPGKAGRRWYKNVGLGFRTPKAAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLH++ KY RYEKRH+N+AAH SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHYIPKYSRYEKRHTNLAAHCSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G G K F+
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKGVKKFS  159



>ref|XP_964961.1| 40S ribosomal protein S11 [Neurospora crassa OR74A]
 ref|XP_009856354.1| hypothetical protein NEUTE1DRAFT_118897 [Neurospora tetrasperma 
FGSC 2508]
 gb|EAA35725.1| 40S ribosomal protein S11 [Neurospora crassa OR74A]
 gb|EGO52716.1| hypothetical protein NEUTE1DRAFT_118897 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ77543.1| hypothetical protein NEUTE2DRAFT_142864 [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE85952.1| hypothetical protein GE21DRAFT_1138 [Neurospora crassa]
Length=161

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP  A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKSARPGKGGRRWYKDVGLGFRTPAAAIEGQYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL+GT  S KM+RTII+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGQVSIRGRILSGTVVSTKMHRTIIIRREYLHFIPKYNRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDKVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_002542812.1| 40S ribosomal protein S11 [Uncinocarpus reesii 1704]
 gb|EEP77479.1| 40S ribosomal protein S11 [Uncinocarpus reesii 1704]
Length=161

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K K+ GKGG R++K +GLGFKTP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKSKSKKVGKGGRRWYKDVGLGFKTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHYIPKYNRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G   K FT
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKGFT  159



>ref|XP_003652243.1| 40S ribosomal protein S11 [Thielavia terrestris NRRL 8126]
 gb|AEO65907.1| hypothetical protein THITE_2113512 [Thielavia terrestris NRRL 
8126]
Length=161

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKSTRPGKGGRRWYKDVGLGFRTPKTAIEGQYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGMVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYNRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_009830155.1| archaeal ribosomal protein S17P [Aphanomyces astaci]
 gb|ETV80231.1| archaeal ribosomal protein S17P [Aphanomyces astaci]
Length=161

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = -2

Query  594  EQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCPFT  415
            +QTEKAF KQ GVFL+SKK    K       RF+KSIGLGFKTP+ A EG Y+DKKCPFT
Sbjct  7    DQTEKAFQKQDGVFLASKKFAGKKNGP----RFYKSIGLGFKTPKAAIEGGYVDKKCPFT  62

Query  414  GTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFRVKEGD  235
            G VSIRGRIL G   S KM RTIIVRR+YLH++KKY+R+EKRH N+AAH+SP FRVKEGD
Sbjct  63   GNVSIRGRILKGVVLSNKMKRTIIVRRDYLHYIKKYKRFEKRHKNVAAHVSPAFRVKEGD  122

Query  234  YVIIGQCRPLSKTVRFNVLKVIPA  163
             V IGQCRPL+KTVRFNVL+V  A
Sbjct  123  VVTIGQCRPLAKTVRFNVLEVEAA  146



>ref|XP_002158762.1| PREDICTED: 40S ribosomal protein S11-like [Hydra vulgaris]
Length=156

 Score =   202 bits (515),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 119/157 (76%), Gaps = 5/157 (3%)
 Frame = -2

Query  600  MAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDKKCP  421
            MAEQ E+AF KQP +FL+ K+        K   R+ +++GLGFKTPREA EGTYIDKKCP
Sbjct  1    MAEQNERAFQKQPAIFLNKKRVVAKTTKNKEL-RYVRNVGLGFKTPREAIEGTYIDKKCP  59

Query  420  FTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCF-RVK  244
            FTG VSIRGRIL G   S KM RTI++RR+YLHF+KKYQRYEKRH N+ AH+SPCF  V 
Sbjct  60   FTGNVSIRGRILTGIVKSLKMKRTIVIRRDYLHFIKKYQRYEKRHKNLVAHMSPCFLDVA  119

Query  243  EGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
             GD V +GQCRPLSKT+RFNVLKV  + SA   KK+F
Sbjct  120  LGDLVTVGQCRPLSKTIRFNVLKVSKSTSA---KKSF  153



>ref|XP_009224414.1| 40S ribosomal protein S11 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT74470.1| 40S ribosomal protein S11 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=161

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKSARPGKGGRRYYKDVGLGFRTPKNAIEGQYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+++RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILNGTVVSTKMHRTLVIRREYLHYIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD+V +GQCRPLSKTVRFNVL+V P
Sbjct  122  VEEGDHVTVGQCRPLSKTVRFNVLRVTP  149



>ref|XP_002620373.1| 40S ribosomal protein S11 [Blastomyces dermatitidis SLH14081]
 gb|EEQ76071.1| 40S ribosomal protein S11 [Blastomyces dermatitidis SLH14081]
 gb|EEQ85456.1| 40S ribosomal protein S11 [Blastomyces dermatitidis ER-3]
 gb|EGE84938.1| 40S ribosomal protein S11 [Blastomyces dermatitidis ATCC 18188]
 gb|EQL33555.1| 40S ribosomal protein S11 [Blastomyces dermatitidis ATCC 26199]
 gb|EQL33556.1| 40S ribosomal protein S11, variant [Blastomyces dermatitidis 
ATCC 26199]
Length=161

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK+  K K+ GKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKQKSKSKKVGKGGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTIIVRR YLH++ KY RYEKRH NIAAH+SP FR
Sbjct  62   KCPFTGQVSIRGRILTGTAVSTKMHRTIIVRREYLHYIPKYSRYEKRHKNIAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>gb|EWG36522.1| 40S ribosomal protein S11 [Fusarium verticillioides 7600]
 gb|EWY92870.1| 40S ribosomal protein S11 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ51834.1| 40S ribosomal protein S11 [Fusarium oxysporum Fo47]
 gb|EWZ87127.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA51913.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK49129.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK96192.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL43873.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL89374.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM12196.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM30406.1| 40S ribosomal protein S11 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=161

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +F +SK   K  RPGKGG R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFQNSKTKTKSTRPGKGGRRWYKDVGLGFRTPKAAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHFIPKYSRYEKRHKNVAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>gb|KFY15673.1| hypothetical protein V491_05601 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=161

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  R GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKVKAKSARAGKGGRRWYKDVGLGFRTPKTAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPF G VSIRGRIL GT  S KM+RT+I+RR YLHFV KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFVGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFVPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAFT  130
             ++GD V +GQCRPLSKTVRFNVL+V+P    G   KAF+
Sbjct  122  ERQGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKAFS  159



>ref|XP_007276194.1| 40s ribosomal protein s11 [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA34740.1| 40s ribosomal protein s11 [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ENH80304.1| 40s ribosomal protein s11 [Colletotrichum orbiculare MAFF 240422]
 gb|EQB48918.1| hypothetical protein CGLO_11794 [Colletotrichum gloeosporioides 
Cg-14]
Length=161

 Score =   202 bits (515),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQ G+FL+ K   K  RPGK G R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQKGIFLNQKVKAKSARPGKSGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGQVSIRGRILTGTVVSTKMHRTLIIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_002483612.1| 40S ribosomal protein S11 [Talaromyces stipitatus ATCC 10500]
 gb|EED16378.1| 40S ribosomal protein S11 [Talaromyces stipitatus ATCC 10500]
Length=161

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +F ++K   K KR GKGG R++K +GLGF+TP+ A EGTYIDK
Sbjct  2    ATELTVQSERAFQKQPHIFANTKTKAKSKRVGKGGRRWYKDVGLGFRTPKNAIEGTYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLH+V KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHYVPKYDRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_003170224.1| 40S ribosomal protein S11 [Microsporum gypseum CBS 118893]
 gb|EFR04461.1| 40S ribosomal protein S11 [Microsporum gypseum CBS 118893]
Length=161

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AFLKQP +F ++K   K K  GKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFLKQPHIFTNAKVKSKSKAVGKGGRRWYKDVGLGFRTPKTAIEGNYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+++RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGQVSIRGRILTGTVVSTKMHRTLVIRREYLHYIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGSAGGGKKAF  133
            V+EGD V +GQCRPLSKTVRFNVL+V+P    G   KAF
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP--RTGKAVKAF  158



>ref|XP_002849541.1| 40S ribosomal protein S11 [Arthroderma otae CBS 113480]
 gb|EEQ29656.1| 40S ribosomal protein S11 [Arthroderma otae CBS 113480]
Length=161

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AFLKQP +F +SK   K K  GKGG R++K +GLGF+TP+ A EG YIDK
Sbjct  2    ATELTVQSERAFLKQPHIFTNSKVKSKSKAVGKGGRRWYKDVGLGFRTPKTAIEGNYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+++RR YLH++ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGQVSIRGRILTGTVVSTKMHRTLVIRREYLHYIPKYSRYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>ref|XP_007914554.1| putative 40s ribosomal protein s11 protein [Togninia minima UCRPA7]
 gb|EOO00854.1| putative 40s ribosomal protein s11 protein [Togninia minima UCRPA7]
Length=161

 Score =   202 bits (515),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +F +SK   K  RPGK G R++K +GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFQNSKVKAKSARPGKAGRRWYKDVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RT+I+RR YLHF+ KY RYEKRH N+AAH+SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTVIIRREYLHFIPKYARYEKRHKNLAAHVSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIP  166
            V+EGD V +GQCRPLSKTVRFNVL+V+P
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLP  149



>gb|ERT02285.1| 40S ribosomal protein S11 [Sporothrix schenckii ATCC 58251]
Length=161

 Score =   202 bits (514),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  609  ATIMAEQTEKAFLKQPGVFLSSkktgkgkrpgkgGNRFWKSIGLGFKTPREATEGTYIDK  430
            AT +  Q+E+AF KQP +FL+SK   K  RPGK G R++K++GLGF+TP+ A EG+YIDK
Sbjct  2    ATELTVQSERAFQKQPHIFLNSKTKVKTARPGKNGRRWYKNVGLGFRTPKTAIEGSYIDK  61

Query  429  KCPFTGTVSIRGRILAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIAAHISPCFR  250
            KCPFTG VSIRGRIL GT  S KM+RTII+RR YLH++ KY RYEKRH+N+AAH SP FR
Sbjct  62   KCPFTGLVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYARYEKRHTNLAAHCSPAFR  121

Query  249  VKEGDYVIIGQCRPLSKTVRFNVLKVIPAGS  157
            V+EGD V +GQCRPLSKTVRFNVL+V+P  S
Sbjct  122  VEEGDQVTVGQCRPLSKTVRFNVLRVLPRTS  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600