BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051H07

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    417   3e-141   Nicotiana tomentosiformis
ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    408   4e-141   Cucumis melo [Oriental melon]
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    416   1e-140   Nicotiana sylvestris
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    410   1e-138   
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    410   2e-138   Solanum lycopersicum
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       409   4e-138   Cucumis sativus [cucumbers]
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    409   8e-138   Solanum tuberosum [potatoes]
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         407   4e-137   Jatropha curcas
emb|CDP13207.1|  unnamed protein product                                407   4e-137   Coffea canephora [robusta coffee]
emb|CBI23368.3|  unnamed protein product                                405   2e-136   Vitis vinifera
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           405   2e-136   Morus notabilis
ref|NP_001268094.1|  uncharacterized protein LOC100261274               405   3e-136   Vitis vinifera
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                403   9e-136   Erythranthe guttata [common monkey flower]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    403   1e-135   Malus domestica [apple tree]
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    403   1e-135   
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    403   2e-135   
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    402   2e-135   Prunus mume [ume]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     402   3e-135   Vitis vinifera
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             401   6e-135   Citrus clementina [clementine]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    401   6e-135   Pyrus x bretschneideri [bai li]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             400   1e-134   Prunus persica
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    400   2e-134   
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   398   8e-134   Citrus sinensis [apfelsine]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    398   9e-134   Eucalyptus grandis [rose gum]
gb|AAZ43368.1|  AlaT1                                                   398   1e-133   Vitis labrusca [Concord grape]
ref|XP_003613139.1|  Alanine aminotransferase                           397   3e-133   Medicago truncatula
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    397   4e-133   Nelumbo nucifera [Indian lotus]
gb|AET06145.1|  PLP-dependent aminotransferase                          395   2e-132   Papaver somniferum
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    395   2e-132   Fragaria vesca subsp. vesca
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    395   2e-132   Populus trichocarpa [western balsam poplar]
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    394   7e-132   Cicer arietinum [garbanzo]
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    393   7e-132   
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    393   9e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    392   2e-131   Elaeis guineensis
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    392   2e-131   Tarenaya hassleriana [spider flower]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    392   3e-131   Glycine max [soybeans]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    391   6e-131   Gossypium arboreum [tree cotton]
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    391   7e-131   
emb|CDY61225.1|  BnaC06g43710D                                          390   9e-131   Brassica napus [oilseed rape]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    390   9e-131   Brassica rapa
gb|KJB31170.1|  hypothetical protein B456_005G179600                    390   1e-130   Gossypium raimondii
ref|NP_001237567.1|  alanine aminotransferase 2                         390   1e-130   
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    391   2e-130   Brassica rapa
gb|KJB31175.1|  hypothetical protein B456_005G179600                    390   2e-130   Gossypium raimondii
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    389   3e-130   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             389   3e-130   Phaseolus vulgaris [French bean]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    389   3e-130   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                388   7e-130   Glycine soja [wild soybean]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    388   8e-130   Elaeis guineensis
dbj|BAJ90574.1|  predicted protein                                      381   8e-130   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    382   1e-129   
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             388   1e-129   
ref|NP_001237581.1|  alanine aminotransferase 3                         387   3e-129   Glycine max [soybeans]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              387   3e-129   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61453.1|  putative alanine aminotransferase                       387   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    386   5e-129   
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    385   1e-128   Populus euphratica
dbj|BAH20108.1|  AT1G70580                                              385   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             385   2e-128   Populus trichocarpa [western balsam poplar]
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             384   3e-128   
emb|CDY66294.1|  BnaAnng22050D                                          383   6e-128   Brassica napus [oilseed rape]
gb|EPS68501.1|  hypothetical protein M569_06265                         383   9e-128   Genlisea aurea
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       382   1e-127   Cucumis sativus [cucumbers]
emb|CDY25780.1|  BnaA07g10020D                                          380   1e-127   Brassica napus [oilseed rape]
gb|EMS58349.1|  Alanine aminotransferase 2                              382   2e-127   Triticum urartu
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    382   2e-127   Solanum lycopersicum
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             382   2e-127   
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    381   3e-127   Nicotiana tomentosiformis
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          381   4e-127   Amborella trichopoda
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    381   4e-127   Camelina sativa [gold-of-pleasure]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    381   4e-127   Brassica rapa
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    380   8e-127   Nicotiana sylvestris
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    380   1e-126   Camelina sativa [gold-of-pleasure]
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    380   1e-126   Brassica rapa
emb|CDX91708.1|  BnaC08g06270D                                          377   1e-126   
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             380   1e-126   Capsella rubella
ref|NP_001058716.1|  Os07g0108300                                       380   2e-126   
gb|AAO84040.1|  alanine aminotransferase                                380   2e-126   Oryza sativa Indica Group [Indian rice]
gb|AAK68842.1|  alanine aminotransferase-like protein                   376   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    379   2e-126   Camelina sativa [gold-of-pleasure]
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    379   4e-126   
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    379   4e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    379   5e-126   Camelina sativa [gold-of-pleasure]
emb|CDY41452.1|  BnaA08g20540D                                          378   6e-126   Brassica napus [oilseed rape]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    378   6e-126   Setaria italica
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          377   1e-125   
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    377   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    377   2e-125   Brachypodium distachyon [annual false brome]
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     374   2e-125   
gb|AAL24255.1|  At1g23310/F26F24_4                                      377   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 377   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    376   5e-125   Brassica rapa
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    376   6e-125   
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          375   8e-125   Arabidopsis lyrata subsp. lyrata
ref|NP_001151209.1|  alanine aminotransferase 2                         375   1e-124   
emb|CDY12474.1|  BnaC07g13140D                                          376   3e-124   Brassica napus [oilseed rape]
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    374   3e-124   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               374   4e-124   Zea mays [maize]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    373   5e-124   Cucumis melo [Oriental melon]
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             372   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    372   2e-123   Cucumis sativus [cucumbers]
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    363   7e-122   
gb|ABK25444.1|  unknown                                                 361   3e-119   Picea sitchensis
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              359   2e-118   
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    353   2e-117   Populus euphratica
gb|AFK42206.1|  unknown                                                 350   2e-117   Lotus japonicus
ref|XP_001782822.1|  predicted protein                                  320   5e-103   
ref|XP_001763950.1|  predicted protein                                  318   1e-102   
ref|XP_003613140.1|  Alanine aminotransferase                           318   1e-102   
ref|XP_001777071.1|  predicted protein                                  314   8e-101   
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    311   1e-99    
gb|EMT29455.1|  Alanine aminotransferase 2                              310   8e-99    
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              306   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             303   2e-96    Selaginella moellendorffii
ref|XP_002527918.1|  alanine aminotransferase, putative                 297   9e-95    
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    286   2e-94    
gb|AAM22749.1|  alanine aminotransferase                                263   1e-85    Deschampsia antarctica
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    264   1e-85    
ref|XP_005651940.1|  alanine aminotransferase                           273   2e-84    Coccomyxa subellipsoidea C-169
ref|XP_002947519.1|  alanine aminotransferase                           272   3e-84    Volvox carteri f. nagariensis
ref|XP_001698518.1|  alanine aminotransferase                           265   2e-81    Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                263   1e-80    Chlamydomonas reinhardtii
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               259   3e-78    Nannochloropsis gaditana
gb|KIZ07569.1|  alanine transaminase                                    255   9e-77    Monoraphidium neglectum
ref|XP_003291733.1|  alanine transaminase                               245   1e-73    Dictyostelium purpureum
gb|EEE58449.1|  hypothetical protein OsJ_09677                          235   6e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         239   8e-72    
ref|XP_004992298.1|  alanine aminotransferase                           239   1e-71    Salpingoeca rosetta
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              233   3e-71    
ref|NP_001060284.1|  Os07g0617800                                       233   3e-71    
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              237   1e-70    Chlorella variabilis
emb|CDX91589.1|  BnaC02g15710D                                          224   2e-70    
gb|ETK83815.1|  hypothetical protein L915_11053                         226   2e-70    Phytophthora parasitica
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              230   3e-70    
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    234   3e-70    Oryza brachyantha
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    234   7e-70    Oryza brachyantha
dbj|BAC79866.1|  putative alanine aminotransferase                      233   1e-69    Oryza sativa Japonica Group [Japonica rice]
gb|AAV64199.1|  putative alanine aminotransferase                       234   1e-69    Zea mays [maize]
gb|EEC74641.1|  hypothetical protein OsI_10280                          233   2e-69    Oryza sativa Indica Group [Indian rice]
gb|ETL37230.1|  hypothetical protein L916_10951                         224   2e-69    Phytophthora parasitica
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         233   2e-69    Oryza brachyantha
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              234   3e-69    Zea mays [maize]
gb|AAV64237.1|  putative alanine aminotransferase                       233   3e-69    Zea mays [maize]
ref|NP_001064504.1|  Os10g0390500                                       232   3e-69    
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            232   3e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EEE67593.1|  hypothetical protein OsJ_25140                          233   5e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          233   5e-69    Oryza sativa Indica Group [Indian rice]
gb|EFA80185.1|  alanine transaminase                                    234   6e-69    Heterostelium album PN500
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          233   6e-69    Sorghum bicolor [broomcorn]
ref|XP_010490704.1|  PREDICTED: glutamate--glyoxylate aminotransf...    223   8e-69    Camelina sativa [gold-of-pleasure]
ref|XP_002887430.1|  ALAAT2                                             231   2e-68    
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    229   4e-68    Auxenochlorella protothecoides
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         230   4e-68    Phoenix dactylifera
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               229   2e-67    Acytostelium subglobosum LB1
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    228   2e-67    Phytophthora parasitica INRA-310
gb|ETP41623.1|  hypothetical protein F442_11247                         228   2e-67    Phytophthora parasitica P10297
gb|ETP13560.1|  hypothetical protein F441_11279                         228   3e-67    Phytophthora parasitica CJ01A1
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              228   3e-67    Phoenix dactylifera
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    228   3e-67    Camelina sativa [gold-of-pleasure]
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      227   3e-67    Ectocarpus siliculosus
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    222   4e-67    
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    227   5e-67    Acanthamoeba castellanii str. Neff
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             226   5e-67    Guillardia theta CCMP2712
gb|AAK59591.2|  putative alanine aminotransferase                       227   8e-67    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001086104.1|  alanine aminotransferase 2                         227   9e-67    Xenopus laevis [clawed frog]
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         224   9e-67    Falco cherrug
ref|NP_565040.2|  alanine aminotransferase 2                            227   1e-66    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185380.1|  alanine aminotransferase 2                         227   1e-66    Arabidopsis thaliana [mouse-ear cress]
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  226   1e-66    
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         224   2e-66    
gb|EXX69945.1|  alanine transaminase ALT1                               226   2e-66    Rhizophagus irregularis DAOM 197198w
gb|ETI43749.1|  hypothetical protein F443_11362                         226   2e-66    Phytophthora parasitica P1569
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         226   2e-66    
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              225   3e-66    
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              225   3e-66    
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    226   3e-66    Camelina sativa [gold-of-pleasure]
ref|XP_002906656.1|  alanine aminotransferase 2                         224   4e-66    Phytophthora infestans T30-4
gb|KDD76740.1|  aminotransferase                                        224   5e-66    Helicosporidium sp. ATCC 50920
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              225   5e-66    Elaeis guineensis
ref|XP_002681562.1|  alanine aminotransferase                           224   7e-66    Naegleria gruberi strain NEG-M
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    225   7e-66    Prunus mume [ume]
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             225   8e-66    Prunus persica
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   219   9e-66    Gossypium raimondii
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   219   9e-66    Gossypium raimondii
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    223   1e-65    
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    223   1e-65    
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    224   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         224   1e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    223   1e-65    Solanum lycopersicum
gb|KDE04574.1|  hypothetical protein MVLG_05042                         225   2e-65    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    222   2e-65    Elaeis guineensis
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         223   2e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    223   2e-65    
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    222   2e-65    Cucumis melo [Oriental melon]
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              223   3e-65    Fragaria vesca subsp. vesca
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    222   3e-65    Solanum tuberosum [potatoes]
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    222   3e-65    
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    223   3e-65    
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    222   3e-65    Hordeum vulgare [barley]
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    222   4e-65    Elaeis guineensis
ref|XP_005514471.1|  PREDICTED: alanine aminotransferase 2-like         219   5e-65    
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    222   5e-65    Hordeum vulgare [barley]
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    222   5e-65    Cucumis melo [Oriental melon]
ref|XP_637993.1|  alanine transaminase                                  222   6e-65    Dictyostelium discoideum AX4
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    221   6e-65    
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              216   7e-65    Leptonychotes weddellii
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    222   7e-65    
gb|EMC77259.1|  Alanine aminotransferase 2                              220   7e-65    
emb|CCI42079.1|  unnamed protein product                                221   7e-65    Albugo candida
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    221   8e-65    Brachypodium distachyon [annual false brome]
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       222   8e-65    Cucumis sativus [cucumbers]
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    222   8e-65    Cucumis melo [Oriental melon]
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              222   9e-65    Sesamum indicum [beniseed]
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    221   1e-64    Cucumis sativus [cucumbers]
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    221   1e-64    
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         219   1e-64    Cuculus canorus
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              220   1e-64    Eptesicus fuscus
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         221   1e-64    Sesamum indicum [beniseed]
gb|KFO75258.1|  Alanine aminotransferase 2                              219   1e-64    Cuculus canorus
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    221   2e-64    Solanum tuberosum [potatoes]
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             221   2e-64    Capsella rubella
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             221   2e-64    
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             221   2e-64    Citrus clementina [clementine]
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              219   2e-64    Brachypodium distachyon [annual false brome]
ref|XP_002499950.1|  alanine aminotransferase                           219   3e-64    Micromonas commoda
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                219   3e-64    Erythranthe guttata [common monkey flower]
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    219   3e-64    Gossypium arboreum [tree cotton]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    220   4e-64    Cicer arietinum [garbanzo]
gb|AIT69922.1|  alanine transaminase                                    219   4e-64    Sargassum fusiforme
ref|XP_008869166.1|  hypothetical protein H310_06043                    219   4e-64    Aphanomyces invadans
ref|XP_007024768.1|  Alanine aminotransferase 2                         220   4e-64    
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    221   4e-64    Brachypodium distachyon [annual false brome]
gb|AET06148.1|  PLP-dependent aminotransferase                          219   4e-64    Papaver somniferum
gb|ADE77246.1|  unknown                                                 214   4e-64    Picea sitchensis
emb|CDJ93113.1|  Aminotransferase domain containing protein             219   5e-64    Haemonchus contortus [red stomach worm]
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    220   6e-64    Citrus sinensis [apfelsine]
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   220   6e-64    Citrus sinensis [apfelsine]
ref|XP_004345426.2|  alanine aminotransferase                           218   7e-64    Capsaspora owczarzaki ATCC 30864
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               219   8e-64    Glycine soja [wild soybean]
ref|XP_010096539.1|  Alanine aminotransferase 2                         219   1e-63    Morus notabilis
ref|XP_008620886.1|  alanine transaminase                               218   1e-63    Saprolegnia diclina VS20
ref|XP_006828623.1|  hypothetical protein AMTR_s00129p00080070          216   1e-63    
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         218   1e-63    
emb|CEI91975.1|  Putative Alanine transaminase                          218   1e-63    Rhizopus microsporus
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         218   1e-63    Anolis carolinensis [Carolina anole]
gb|KJE95383.1|  alanine aminotransferase                                219   2e-63    Capsaspora owczarzaki ATCC 30864
gb|ETK88933.1|  hypothetical protein L915_06890                         211   2e-63    Phytophthora parasitica
gb|EMT23015.1|  Alanine aminotransferase 2                              217   3e-63    
emb|CEG73189.1|  Putative Alanine transaminase                          217   3e-63    Rhizopus microsporus
ref|XP_004400797.1|  PREDICTED: alanine aminotransferase 1              217   3e-63    Odobenus rosmarus divergens
gb|EIE85592.1|  hypothetical protein RO3G_10302                         216   3e-63    Rhizopus delemar RA 99-880
ref|XP_001745052.1|  hypothetical protein                               216   3e-63    Monosiga brevicollis MX1
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...    217   3e-63    
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             217   3e-63    Phytophthora sojae
gb|EMS46317.1|  Alanine aminotransferase 2                              218   3e-63    Triticum urartu
ref|NP_001016805.1|  alanine aminotransferase 2                         218   3e-63    Xenopus tropicalis [western clawed frog]
gb|EPS60556.1|  hypothetical protein M569_14246                         217   3e-63    Genlisea aurea
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              218   4e-63    Beta vulgaris subsp. vulgaris [field beet]
gb|AIT69930.1|  alanine transaminase                                    217   4e-63    Sargassum hemiphyllum var. chinense
ref|XP_004356702.1|  alanine aminotransferase, mitochondrial, put...    216   4e-63    Acanthamoeba castellanii str. Neff
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         218   5e-63    
emb|CEF68484.1|  Alanine aminotransferase 1                             216   5e-63    Strongyloides ratti
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    216   5e-63    
ref|XP_009899311.1|  PREDICTED: alanine aminotransferase 1              214   5e-63    Picoides pubescens
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...    216   5e-63    Monodelphis domestica
ref|XP_003627448.1|  Alanine aminotransferase                           217   5e-63    Medicago truncatula
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    217   6e-63    
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              216   6e-63    Ochotona princeps [southern American pika]
ref|XP_006105500.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    216   6e-63    
gb|KFV67752.1|  Alanine aminotransferase 2                              214   7e-63    Picoides pubescens
gb|KJB31174.1|  hypothetical protein B456_005G179600                    213   9e-63    Gossypium raimondii
gb|AHJ25706.1|  GPT2                                                    207   9e-63    Panthera tigris altaica
ref|XP_002826439.1|  PREDICTED: alanine aminotransferase 2              207   9e-63    
gb|ETL42327.1|  hypothetical protein L916_06840                         207   9e-63    Phytophthora parasitica
emb|CCA27196.1|  unnamed protein product                                216   1e-62    Albugo laibachii Nc14
ref|XP_006186085.1|  PREDICTED: alanine aminotransferase 1              213   1e-62    Camelus ferus
ref|XP_010628764.1|  PREDICTED: alanine aminotransferase 1              216   1e-62    Fukomys damarensis [Damara mole rat]
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         216   1e-62    Anolis carolinensis [Carolina anole]
ref|XP_011226825.1|  PREDICTED: alanine aminotransferase 1 isofor...    216   1e-62    
gb|ABK93875.1|  unknown                                                 206   2e-62    
ref|XP_005062449.1|  PREDICTED: alanine aminotransferase 2-like i...    214   2e-62    
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    216   2e-62    
gb|ACJ85860.1|  unknown                                                 216   2e-62    
ref|XP_009175684.1|  hypothetical protein T265_10908                    214   2e-62    
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg             216   2e-62    
dbj|GAA29952.1|  alanine transaminase                                   214   2e-62    
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    213   2e-62    
emb|CDJ93112.1|  Aminotransferase domain containing protein             213   2e-62    
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              214   2e-62    
ref|XP_005062450.1|  PREDICTED: alanine aminotransferase 2-like i...    214   3e-62    
ref|XP_004779455.1|  PREDICTED: alanine aminotransferase 1 isofor...    214   3e-62    
ref|XP_007516096.1|  PREDICTED: alanine aminotransferase 1              214   3e-62    
ref|XP_010959534.1|  PREDICTED: alanine aminotransferase 1              213   3e-62    
ref|XP_001769989.1|  predicted protein                                  214   3e-62    
gb|KDO24164.1|  hypothetical protein SPRG_10592                         214   4e-62    
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    213   4e-62    
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             215   4e-62    
gb|AIT69931.1|  alanine transaminase                                    214   4e-62    
ref|XP_004826063.1|  PREDICTED: alanine aminotransferase 1 isofor...    214   4e-62    
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2              214   4e-62    
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1              214   4e-62    
ref|XP_004779454.1|  PREDICTED: alanine aminotransferase 1 isofor...    214   5e-62    
ref|XP_009826737.1|  hypothetical protein H257_04062                    214   5e-62    
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2              215   5e-62    
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    213   6e-62    
ref|XP_005775483.1|  alanine aminotransferase                           214   6e-62    
ref|XP_011226824.1|  PREDICTED: alanine aminotransferase 1 isofor...    215   6e-62    
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2              214   6e-62    
gb|KFK41654.1|  hypothetical protein AALP_AA2G155600                    214   7e-62    
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603             213   7e-62    
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              213   7e-62    
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              213   8e-62    
gb|AIT69921.1|  alanine transaminase                                    213   8e-62    
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    214   8e-62    
gb|KGB32667.1|  Alanine aminotransferase 2                              213   9e-62    
ref|XP_006172385.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...    211   9e-62    
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              211   1e-61    
gb|ETI43741.1|  hypothetical protein F443_11357                         213   1e-61    
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         210   1e-61    
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like         214   1e-61    
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              210   1e-61    
gb|AIT69918.1|  alanine transaminase                                    213   1e-61    
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    213   1e-61    
emb|CDO97792.1|  unnamed protein product                                212   2e-61    
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              208   2e-61    
ref|XP_006908800.1|  PREDICTED: alanine aminotransferase 2              211   2e-61    
gb|KFQ69505.1|  Alanine aminotransferase 2                              211   2e-61    
ref|XP_006064662.1|  PREDICTED: alanine aminotransferase 1 isofor...    212   2e-61    
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...    212   2e-61    
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              210   2e-61    
gb|ADB91976.1|  alanine aminotransferase                                212   2e-61    
gb|AFK39904.1|  unknown                                                 213   2e-61    
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    206   2e-61    
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    214   2e-61    
ref|XP_005613478.1|  PREDICTED: alanine aminotransferase 1              210   2e-61    
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              213   2e-61    
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    213   3e-61    
ref|XP_001490415.3|  PREDICTED: alanine aminotransferase 2 isofor...    213   3e-61    
gb|KFR15864.1|  Alanine aminotransferase 2                              211   3e-61    
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              211   3e-61    
gb|EMT05433.1|  Alanine aminotransferase 2                              212   3e-61    
emb|CCD81366.1|  putative alanine aminotransferase                      211   3e-61    
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              210   3e-61    
ref|XP_004906842.1|  PREDICTED: alanine aminotransferase 1 isofor...    212   3e-61    
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...    211   3e-61    
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    211   3e-61    
ref|XP_010015482.1|  PREDICTED: alanine aminotransferase 2              210   3e-61    
gb|KFV00293.1|  Alanine aminotransferase 2                              207   3e-61    
gb|KFH70378.1|  alanine transaminase                                    211   3e-61    
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    211   3e-61    
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              209   3e-61    
ref|XP_005318527.1|  PREDICTED: alanine aminotransferase 2              211   4e-61    
emb|CEP13768.1|  hypothetical protein                                   212   4e-61    
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              209   4e-61    
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              207   4e-61    
ref|XP_010193171.1|  PREDICTED: alanine aminotransferase 2              209   4e-61    
gb|KFP35282.1|  Alanine aminotransferase 2                              210   4e-61    
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    211   4e-61    
ref|XP_009976045.1|  PREDICTED: alanine aminotransferase 2              209   4e-61    
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318              211   4e-61    
gb|ETP13552.1|  hypothetical protein F441_11274                         211   4e-61    
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              209   4e-61    
gb|AAR05449.1|  alanine aminotransferase                                211   4e-61    
ref|XP_004443056.1|  PREDICTED: alanine aminotransferase 1              211   5e-61    
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              209   5e-61    
emb|CAD58795.1|  glutamic-pyruvate transaminase                         206   5e-61    
gb|KFQ52041.1|  Alanine aminotransferase 2                              210   5e-61    
gb|EPB88721.1|  alanine transaminase                                    211   5e-61    
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              211   5e-61    
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              209   5e-61    
ref|XP_009816631.1|  PREDICTED: alanine aminotransferase 2              209   5e-61    
gb|KFZ65228.1|  Alanine aminotransferase 2                              209   5e-61    
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              211   5e-61    
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    209   5e-61    
ref|NP_001077209.1|  alanine aminotransferase 1                         211   5e-61    
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              210   5e-61    
gb|EMS62762.1|  Alanine aminotransferase 2                              212   6e-61    
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1              209   6e-61    
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...    211   6e-61    
gb|EDL29603.1|  glutamic pyruvic transaminase 1, soluble, isoform...    209   6e-61    
ref|XP_009274977.1|  PREDICTED: alanine aminotransferase 2              209   6e-61    
ref|XP_004906841.1|  PREDICTED: alanine aminotransferase 1 isofor...    211   6e-61    
gb|KFU99477.1|  Alanine aminotransferase 2                              209   6e-61    
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              210   6e-61    
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              209   6e-61    
ref|XP_009487594.1|  PREDICTED: alanine aminotransferase 2              209   6e-61    
gb|KFQ20610.1|  Alanine aminotransferase 2                              209   7e-61    
gb|KFV58998.1|  Alanine aminotransferase 2                              209   7e-61    
ref|XP_010842208.1|  PREDICTED: alanine aminotransferase 2              209   7e-61    
ref|XP_005401470.1|  PREDICTED: alanine aminotransferase 2-like i...    209   7e-61    
ref|XP_005395954.1|  PREDICTED: alanine aminotransferase 1              211   7e-61    
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              210   7e-61    
gb|KFP49490.1|  Alanine aminotransferase 2                              207   7e-61    
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    210   7e-61    
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    211   7e-61    
ref|XP_006390672.1|  hypothetical protein EUTSA_v10019459mg             212   8e-61    
ref|XP_004472119.1|  PREDICTED: alanine aminotransferase 1              209   8e-61    
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              209   8e-61    
ref|XP_004324928.1|  PREDICTED: alanine aminotransferase 2              209   8e-61    
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              211   8e-61    
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    211   8e-61    
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    212   8e-61    
ref|XP_009571057.1|  PREDICTED: alanine aminotransferase 2              209   8e-61    
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...    211   8e-61    
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              209   9e-61    
ref|NP_001237553.1|  alanine aminotransferase 1                         210   9e-61    
ref|XP_005233896.1|  PREDICTED: alanine aminotransferase 2              209   9e-61    
gb|AIT69919.1|  alanine transaminase                                    211   9e-61    
gb|AGV14561.1|  alanine transaminase, variant                           210   1e-60    
gb|KFQ54613.1|  Alanine aminotransferase 2                              209   1e-60    
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    210   1e-60    
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     210   1e-60    
gb|KFP59082.1|  Alanine aminotransferase 2                              209   1e-60    
ref|XP_005401469.1|  PREDICTED: alanine aminotransferase 2-like i...    209   1e-60    
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1              210   1e-60    
emb|CEG76882.1|  Putative Alanine transaminase                          211   1e-60    
ref|XP_010812871.1|  PREDICTED: alanine aminotransferase 2 isofor...    208   1e-60    
ref|XP_008068165.1|  PREDICTED: alanine aminotransferase 1              210   1e-60    
gb|KFZ58051.1|  Alanine aminotransferase 2                              209   1e-60    
gb|AIT69926.1|  alanine transaminase                                    210   1e-60    
gb|KFQ05762.1|  Alanine aminotransferase 2                              209   1e-60    
ref|XP_008524431.1|  PREDICTED: alanine aminotransferase 1              210   1e-60    
ref|XP_010309159.1|  PREDICTED: alanine aminotransferase 2              208   1e-60    
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    211   1e-60    
ref|XP_571848.1|  transaminase                                          211   1e-60    
ref|XP_009920931.1|  PREDICTED: alanine aminotransferase 2              208   1e-60    
ref|XP_006261713.1|  PREDICTED: alanine aminotransferase 2              208   1e-60    
gb|AIT69916.1|  alanine transaminase                                    210   1e-60    
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              211   1e-60    
gb|KFO93213.1|  Alanine aminotransferase 2                              209   1e-60    
ref|XP_006887880.1|  PREDICTED: alanine aminotransferase 2              211   1e-60    
ref|XP_006211266.1|  PREDICTED: alanine aminotransferase 1              210   2e-60    
ref|XP_414111.3|  PREDICTED: alanine aminotransferase 2 isoform X2      211   2e-60    
gb|KFP94695.1|  Alanine aminotransferase 2                              208   2e-60    
ref|XP_004583880.1|  PREDICTED: alanine aminotransferase 2 isofor...    209   2e-60    
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    209   2e-60    
ref|XP_008936281.1|  PREDICTED: alanine aminotransferase 2              208   2e-60    
emb|CDX81815.1|  BnaC08g37860D                                          211   2e-60    
emb|CEG73120.1|  Putative Alanine transaminase                          210   2e-60    
ref|XP_002430266.1|  Alanine aminotransferase, putative                 209   2e-60    
ref|XP_004744170.1|  PREDICTED: alanine aminotransferase 2 isofor...    210   2e-60    
ref|XP_004656487.1|  PREDICTED: alanine aminotransferase 1              209   2e-60    
gb|KFO06425.1|  Alanine aminotransferase 2                              208   2e-60    
ref|NP_001012057.1|  alanine aminotransferase 2                         210   2e-60    
gb|KFO61771.1|  Alanine aminotransferase 2                              209   2e-60    
emb|CEG73119.1|  Putative Alanine transaminase                          210   2e-60    
ref|XP_002166762.2|  PREDICTED: alanine aminotransferase 2-like         208   2e-60    
gb|AFR96660.1|  alanine transaminase                                    210   2e-60    
gb|ELK15350.1|  Alanine aminotransferase 2                              210   2e-60    
gb|KFQ82063.1|  Alanine aminotransferase 2                              208   2e-60    
gb|ETN63742.1|  alanine aminotransferase                                209   2e-60    
ref|XP_004403733.1|  PREDICTED: alanine aminotransferase 2              210   2e-60    
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    206   2e-60    
ref|XP_003463744.1|  PREDICTED: alanine aminotransferase 1 isofor...    209   2e-60    
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         211   2e-60    
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              209   2e-60    
ref|XP_005692006.1|  PREDICTED: alanine aminotransferase 2              207   3e-60    
ref|XP_003792568.1|  PREDICTED: alanine aminotransferase 2              210   3e-60    
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...    210   3e-60    
gb|KFQ16813.1|  Alanine aminotransferase 2                              208   3e-60    
ref|XP_009676627.1|  PREDICTED: alanine aminotransferase 2              208   3e-60    
ref|XP_009636322.1|  PREDICTED: alanine aminotransferase 2              207   3e-60    
dbj|BAC04465.1|  unnamed protein product                                207   3e-60    
ref|NP_877957.1|  alanine aminotransferase 1                            209   3e-60    
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...    210   3e-60    
ref|NP_001135938.1|  alanine aminotransferase 2 isoform 2               207   3e-60    
ref|XP_004629253.1|  PREDICTED: alanine aminotransferase 2              209   3e-60    
ref|XP_006064660.1|  PREDICTED: alanine aminotransferase 1 isofor...    212   3e-60    
ref|XP_007439806.1|  PREDICTED: alanine aminotransferase 2              207   3e-60    
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...    210   3e-60    
ref|XP_010884160.1|  PREDICTED: alanine aminotransferase 1 isofor...    207   3e-60    
ref|XP_006207932.1|  PREDICTED: alanine aminotransferase 2              209   3e-60    
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...    209   3e-60    
ref|XP_008635361.1|  PREDICTED: alanine aminotransferase 1              209   3e-60    
ref|XP_009088853.1|  PREDICTED: alanine aminotransferase 2              207   3e-60    
emb|CEI94294.1|  Putative Alanine transaminase                          209   3e-60    
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2              208   4e-60    
ref|XP_010346117.1|  PREDICTED: alanine aminotransferase 2              210   4e-60    
gb|KFO63157.1|  Alanine aminotransferase 2                              209   4e-60    
dbj|GAN09782.1|  alanine transaminase                                   209   4e-60    
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2              210   4e-60    
gb|KFP15258.1|  Alanine aminotransferase 2                              207   4e-60    
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2              210   4e-60    
ref|XP_004371688.1|  PREDICTED: alanine aminotransferase 2              209   4e-60    
ref|XP_005534389.1|  PREDICTED: alanine aminotransferase 2-like i...    208   4e-60    
gb|AFW68849.1|  hypothetical protein ZEAMMB73_492015                    200   4e-60    
ref|XP_005662864.1|  PREDICTED: alanine aminotransferase 1 isofor...    206   5e-60    
gb|KFW64540.1|  Alanine aminotransferase 2                              209   5e-60    
ref|XP_004264915.1|  PREDICTED: alanine aminotransferase 2              209   5e-60    
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              210   5e-60    
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2              208   5e-60    
ref|XP_003055208.1|  predicted protein                                  208   5e-60    
ref|XP_007119541.1|  PREDICTED: alanine aminotransferase 2              209   6e-60    
gb|KFM05788.1|  Alanine aminotransferase 2                              209   6e-60    
ref|XP_010199869.1|  PREDICTED: alanine aminotransferase 2              206   6e-60    
gb|KFV83100.1|  Alanine aminotransferase 2                              208   6e-60    
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2              209   6e-60    
ref|XP_010221695.1|  PREDICTED: alanine aminotransferase 2              206   6e-60    
gb|EHH31638.1|  Alanine aminotransferase 2                              207   6e-60    
gb|KFO69634.1|  Alanine aminotransferase 2                              208   6e-60    



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   417 bits (1073),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/210 (93%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASISLSPNVPG
Sbjct  272  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIEAAKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EDMPAIMSSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   408 bits (1048),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI PR+V+EIYKVASISLSPNVP 
Sbjct  29   DMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPA  88

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYS
Sbjct  89   QIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYS  148

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  149  FPQIRLPPKAIEAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  208

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  209  EDMPEIMASFKKFNDSFMEEYEDHRGYSRM  238



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   416 bits (1069),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/210 (93%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASISLSPNVPG
Sbjct  272  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EDMPAIMSSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI PR+V+EIYKVASISLSPNVP 
Sbjct  251  DMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPA  310

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYS
Sbjct  311  QIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYS  370

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  371  FPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  430

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  431  EDMPEIMTSFKKFNDSFMEEYEDHRGYSRM  460



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   410 bits (1054),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASISLSPNVPG
Sbjct  272  DMGLPLSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIETA  LGKAPDV YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIETANKLGKAPDVLYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIMESFKKFNDEFM++YEDH+GYSRM
Sbjct  452  EDMPAIMESFKKFNDEFMEKYEDHKGYSRM  481



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   409 bits (1052),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI PR+V+EIYKVASISLSPNVP 
Sbjct  272  DMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  452  EDMPEIMTSFKKFNDSFMEEYEDHRGYSRM  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   409 bits (1050),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASISLSPNVPG
Sbjct  272  DMGLPLSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQ+VRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQYVRESKGILESLRRRAHMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIETA  LGKA DV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIETANKLGKAADVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIMESFKKFNDEFM++YEDH+GYSRM
Sbjct  452  EDMPAIMESFKKFNDEFMEKYEDHKGYSRM  481



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   407 bits (1045),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS+SLSPNVP 
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQFVRE KGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFVREGKGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKRLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIM SFKKFNDEFM+QYEDH GYSRM
Sbjct  452  EEMPAIMSSFKKFNDEFMEQYEDHTGYSRM  481



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   407 bits (1045),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPI+KELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASI+LSPNVPG
Sbjct  272  DMGPPINKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASIALSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY+++VRESK +LESLRKRA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYERYVRESKAVLESLRKRAHIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYEDH+GYSRM
Sbjct  452  EDMPAIMASFKKFNDEFMEQYEDHKGYSRM  481



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   405 bits (1041),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASISLSPNVPG
Sbjct  272  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLG+MVNPP PGDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGVMVNPPTPGDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EDMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   405 bits (1041),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI P +V+EIYKV+SISLSPNVP 
Sbjct  272  DMGPPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPETVDEIYKVSSISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPP+PGDISY+Q+VRESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPRPGDISYEQYVRESKGILESLRRRASIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG+FHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGMFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EDMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   405 bits (1040),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASISLSPNVPG
Sbjct  272  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLG+MVNPP PGDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGVMVNPPTPGDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EEMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   403 bits (1036),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PI+KELQLVSFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASI+LSPNVP 
Sbjct  271  DMGAPINKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASIALSPNVPA  330

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY++F+RESKGILESLR+RA++MTDGFNSCRNVVCNFTEGAMYS
Sbjct  331  QIFMGLMVNPPKPGDISYERFIRESKGILESLRRRAQLMTDGFNSCRNVVCNFTEGAMYS  390

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  391  FPQIRLPPKAIEAAQKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  450

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM+SFKKFNDEFM+QYEDH+GYSRM
Sbjct  451  EDMPAIMDSFKKFNDEFMEQYEDHKGYSRM  480



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   403 bits (1035),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MG PISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASI+LSPNVP Q
Sbjct  273  MGLPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPPRAIE AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPRAIEAAQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMPAIM+SFKKFNDEFMDQYED RGYSRM
Sbjct  453  DMPAIMDSFKKFNDEFMDQYEDQRGYSRM  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   403 bits (1035),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE QLVSFHTVSKGYWGECGQRGGYFEMTNI+P++VEEIYKVASISLSPNVP 
Sbjct  269  DMGPPISKECQLVSFHTVSKGYWGECGQRGGYFEMTNISPKTVEEIYKVASISLSPNVPA  328

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGDISY+++VRESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  329  QIFMGLMVNPLKPGDISYERYVRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  388

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  389  FPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  448

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  449  EDMPAIMASFKKFNDEFMEQYEDHRGYSRM  478



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   403 bits (1035),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI PR+V+EIYKVASISLSPNVP 
Sbjct  272  DMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFND FM++YED  GYSRM
Sbjct  452  EDMPEIMTSFKKFNDSFMEEYEDXWGYSRM  481



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   402 bits (1034),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MG PISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASI+LSPNVP Q
Sbjct  273  MGLPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASIALSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISY+QFVRESKGILESLRKRARIMTDGFN+CRNVVCNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYEQFVRESKGILESLRKRARIMTDGFNNCRNVVCNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPPRAIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPRAIEAAKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMPAIM+SFKKFNDEFM+QYEDHRGYSRM
Sbjct  453  DMPAIMDSFKKFNDEFMEQYEDHRGYSRM  481



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   402 bits (1033),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASISLSPNVPG
Sbjct  272  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLG+MVNPP PGDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGVMVNPPTPGDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E MPAIMESFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EXMPAIMESFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   401 bits (1031),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASI+LSPNVP 
Sbjct  272  DMGPPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPLKPGDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIMESFKKFNDEFM+QYED+RGYSRM
Sbjct  452  EDMPAIMESFKKFNDEFMEQYEDYRGYSRM  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   401 bits (1031),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MG PISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASI+LSPNVP Q
Sbjct  273  MGLPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPPRAIE AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPRAIEAAQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMPAIM+SFKKFN+EFMDQYED RGYSRM
Sbjct  453  DMPAIMDSFKKFNNEFMDQYEDQRGYSRM  481



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   400 bits (1029),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MG PISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASI+LSPNVP Q
Sbjct  273  MGLPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASIALSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISY+QFVRESKGILESLR+RARIMTDGFN+CRN+VCNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYEQFVRESKGILESLRRRARIMTDGFNNCRNIVCNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPPRAIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPRAIEAAKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMPAIM+SFKKFNDEFM+QYEDHRGYSRM
Sbjct  453  DMPAIMDSFKKFNDEFMEQYEDHRGYSRM  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MG P+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKV SI+LSPNVP Q
Sbjct  273  MGLPVSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVVSIALSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISY+QF+RESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYEQFIRESKGILESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPPRAIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPRAIEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMPAIM+SFKKFNDEFMDQYED RGYSRM
Sbjct  453  DMPAIMDSFKKFNDEFMDQYEDRRGYSRM  481



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   398 bits (1022),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASI+LSPNVP 
Sbjct  254  DMGLPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPA  313

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  314  QIFMGLMVNPLKPGDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  373

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEG+FHLRTTILPAE
Sbjct  374  FPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGIFHLRTTILPAE  433

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIMESFKKFNDEFM+QYED+RGYSRM
Sbjct  434  EDMPAIMESFKKFNDEFMEQYEDYRGYSRM  463



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   398 bits (1023),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPPIS+ELQLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS+SLSPNVP 
Sbjct  272  NMGPPISRELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI +G+MV+PPKPGDISYD +VRESKGI+ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QILMGMMVDPPKPGDISYDLYVRESKGIIESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EDMPEIMASFKKFNDEFMEQYEDHRGYSRM  481



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASISLSPNVPG
Sbjct  272  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLG+MVNPP PGDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGVMVNPPTPGDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRG  143
            EDMPAIMESFKKFNDEFM+QYEDHRG
Sbjct  452  EDMPAIMESFKKFNDEFMEQYEDHRG  477



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   397 bits (1019),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPP+SKE+QLVSFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  272  DIGPPLSKEVQLVSFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLM+NPPKPGDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMINPPKPGDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+A+ETA+  GKA DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKALETAKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIM+SFKKFND+FM+QY+DHRGYSR+
Sbjct  452  EEMPAIMDSFKKFNDDFMEQYDDHRGYSRL  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   397 bits (1019),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+G P+S+E+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS+SLSPNVP 
Sbjct  272  DLGAPLSREVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKPGDISY +FV ESK IL+SLR+RA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKPGDISYLKFVTESKAILDSLRRRAHIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIEAAKNAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYEDHRGYSRM
Sbjct  452  EDMPAIMASFKKFNDEFMEQYEDHRGYSRM  481



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISK++QLVSFHTVSKGYWGECGQRGGYFEMTNI   SV+EIYKVASISLSPNVPG
Sbjct  271  DMGTPISKDVQLVSFHTVSKGYWGECGQRGGYFEMTNIPAESVDEIYKVASISLSPNVPG  330

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKPGDISY +FV+ESK ILESLRKRA IMT+GFNSCRNVVCNFTEGAMYS
Sbjct  331  QIFLGLMVNPPKPGDISYQKFVQESKTILESLRKRAHIMTNGFNSCRNVVCNFTEGAMYS  390

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  391  FPQIRLPPKAIEVAKMAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  450

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM+SFKKFND FM+QYED RGYSRM
Sbjct  451  EDMPAIMDSFKKFNDAFMEQYEDQRGYSRM  480



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGP ISKELQLVSFH+VSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS++LSPNVP Q
Sbjct  273  MGPFISKELQLVSFHSVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASVALSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISYDQF RESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYDQFARESKEILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPPRAI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQK+GVFHLRTTILPAEE
Sbjct  393  PQIRLPPRAIQAAKSAGKVPDVFYCLKLLEATGISTVPGSGFGQKDGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMPAIM+SFKKFN+EFM+QYED RGYSRM
Sbjct  453  DMPAIMDSFKKFNNEFMEQYEDDRGYSRM  481



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGPP+SKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS+SLSPNVP Q
Sbjct  273  MGPPVSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKAVDEIYKVASVSLSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISY+QF+RESKGILESLR+RAR+MTDGFNSCRNV+CNFTEGAMYSF
Sbjct  333  IFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARMMTDGFNSCRNVICNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPKAIDAAKMAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            DMP IM+SFKKFNDEFM+QYE H GYSR+
Sbjct  453  DMPEIMDSFKKFNDEFMEQYEGHGGYSRL  481



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   394 bits (1011),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPP+SKE+QLVSFH+VSKGY+GECGQRGGYFEM NI+P +V+EIYKVASISLSPNVP 
Sbjct  272  DIGPPLSKEVQLVSFHSVSKGYYGECGQRGGYFEMVNISPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI LPP+A+ETA+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIVLPPKALETAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIM+SFKKFND+FM+QYEDHRGYSR+
Sbjct  452  EEMPAIMDSFKKFNDDFMEQYEDHRGYSRL  481



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   393 bits (1010),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI+P++VEEIYKVASISLSPNVPG
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNISPQTVEEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISY+++VRESKGILESLR+RARIMTDGFN CRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYERYVRESKGILESLRRRARIMTDGFNCCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP + +E A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPLKVMEAAKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYED+ GYSRM
Sbjct  452  EDMPAIMASFKKFNDEFMEQYEDNGGYSRM  481



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   393 bits (1010),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI  ++V+EIYKVAS+SLSPNVPG
Sbjct  272  DMGPPMSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKVASVSLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGDISY +FV ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPLKPGDISYLRFVAESTAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIEAAKSAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QYED+RGYSRM
Sbjct  452  EDMPAIMTSFKKFNDEFMEQYEDYRGYSRM  481



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVAS+SLSPNVPG
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASVSLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKPGDIS+ +FV ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKPGDISHLKFVVESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI LPP+AIE A+ +GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQICLPPKAIEAAKKVGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIM SFKKFNDEFM+QYED RGYSRM
Sbjct  452  EEMPAIMASFKKFNDEFMEQYEDCRGYSRM  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNVP 
Sbjct  272  DMGPPVSREVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PP PGDISY+QF+RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPNPGDISYEQFIRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP RAIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPARAIEAARQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QYED+ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQYEDNFGYSRM  481



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   392 bits (1006),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            ++GPPISKE+QL+SFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  272  ELGPPISKEVQLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+M+NPP+PGDISYD+FVRES GILESLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGVMLNPPQPGDISYDKFVRESTGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRA+E A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRALEAAKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM+SFKKFNDEFM+QYED RGYSR+
Sbjct  452  EDMPDIMDSFKKFNDEFMEQYEDDRGYSRL  481



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   391 bits (1004),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASISLSPNVP 
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGD+SYDQ+VRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPLKPGDVSYDQYVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI LPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIHLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFNDEFM QYED+  +SRM
Sbjct  452  EDMPEIMSSFKKFNDEFMAQYEDNWNHSRM  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   391 bits (1004),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+  ++V+EIYKVASISLSPNVPG
Sbjct  272  DMGPPMSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPSQTVDEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKPGDISY +FV+ESK +LESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKPGDISYLKFVQESKAVLESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAARKAGKAPDVFYCLGLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SF+KFNDEFM+QYE+ RGYSRM
Sbjct  452  EDMPAIMASFRKFNDEFMEQYENCRGYSRM  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   390 bits (1003),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPLSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  452  EEMPEIMESFKKFNDEFMSQYGDNFGYSRM  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   390 bits (1003),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPLSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  452  EEMPEIMESFKKFNDEFMSQYGDNFGYSRM  481



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISK++QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASISLSPNVP 
Sbjct  272  DMGPPISKDVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPLKPGDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQ+RLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQLRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFNDEFM QYED+   SRM
Sbjct  452  EDMPEIMSSFKKFNDEFMAQYEDNWNRSRM  481



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   390 bits (1002),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPPISKE+QL+SFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  272  DLGPPISKEVQLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+M++PP+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGVMLHPPQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRA+E A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRALEAAKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM+SFKKFNDEFM+QYED RGYSR+
Sbjct  452  EDMPDIMDSFKKFNDEFMEQYEDDRGYSRL  481



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  300  DMGAPLSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  359

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  360  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  419

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  420  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  479

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  480  EEMPEIMESFKKFNDEFMSQYGDNFGYSRM  509



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISK++QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASISLSPNVP 
Sbjct  286  DMGPPISKDVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPA  345

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  346  QIFMGLMVNPLKPGDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  405

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQ+RLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  406  FPQLRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  465

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFNDEFM QYED+   SRM
Sbjct  466  EDMPEIMSSFKKFNDEFMAQYEDNWNRSRM  495



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P+SKELQLVSFHTVSKGYWGECGQRGGYFEMTNI   SV+EIYK+ASI+LSPNVPG
Sbjct  272  NMGLPMSKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPQESVDEIYKIASIALSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKPGDISY ++ +ESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKPGDISYLRYEQESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI LPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFH+RTTILPAE
Sbjct  392  FPQICLPPKAIEDAKKAGKHPDVFYCLKLLEATGISTVPGSGFGQKEGVFHMRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM+SFKKFND FM+QYEDHRGYSRM
Sbjct  452  EDMPAIMDSFKKFNDAFMEQYEDHRGYSRM  481



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   389 bits (1000),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPPISKE+QL+SFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  272  DLGPPISKEVQLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+M+NP KPGDISYDQFVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGVMINPLKPGDISYDQFVRESNGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIEAAKQAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIM+SFK FNDEFM+QYED+RGYSR+
Sbjct  452  EEMPAIMDSFKNFNDEFMEQYEDNRGYSRL  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   389 bits (999),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS E+QLVSFHTVSKGYWGECGQRGGYFEMTN+  ++V+EIYKVAS+SLSPNVPG
Sbjct  272  DMGPPISTEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPAKTVDEIYKVASVSLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKPGDISY +F  ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKPGDISYLRFAAESNAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GKAPDV+YCLKL+EATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKRAGKAPDVFYCLKLVEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MPAIM+SFKKFNDEFM+QYED+RGYSRM
Sbjct  452  EEMPAIMDSFKKFNDEFMEQYEDYRGYSRM  481



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   388 bits (997),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPPISKE+QL+SFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  272  DLGPPISKEVQLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+M++PP+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGVMLHPPQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRA+E A+  GK PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP E
Sbjct  392  FPQIRLPPRALEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM+SFKKFNDEFM+QYED+RGYSR+
Sbjct  452  EDMPAIMDSFKKFNDEFMEQYEDNRGYSRL  481



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   388 bits (997),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+  ++V+EIYKVAS+SLSPNVPG
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPSQTVDEIYKVASVSLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPK GDISY + V+ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKAGDISYLKLVQESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP +AIE A+  GKAPDV+YCLKLLEATGI+TVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPLKAIEAARKAGKAPDVFYCLKLLEATGIATVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SF+KFNDEFM+QYED+RGYSRM
Sbjct  452  EDMPAIMTSFRKFNDEFMEQYEDYRGYSRM  481



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   381 bits (979),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASI+LSPNVPG
Sbjct  89   DMGPPVSREVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPG  148

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  149  QIFMGLMVNPPKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  208

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP RA++ A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  209  FPQIRLPQRAMDVAKSAGKEPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  268

Query  220  EDMPAIMESFKKFNDEFMDQYEDH  149
            EDMPAIM SFKKFND FMDQY+DH
Sbjct  269  EDMPAIMSSFKKFNDSFMDQYQDH  292



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   382 bits (982),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS ELQL+SFHTVSKGYWGECGQRGGYFEMTNI PR+V+EIYKVASISLSPNVP 
Sbjct  132  DMGPPISNELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPA  191

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGD SYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  192  QIFMGLMVNPPKPGDFSYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  251

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE+A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  252  FPQIRLPPRAIESAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  311

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            EDMP IM SFKKFND FM++Y
Sbjct  312  EDMPEIMASFKKFNDAFMEEY  332



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   388 bits (996),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY D  GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQYGDSFGYSRM  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   387 bits (993),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPPISKE+QL+SFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  271  DLGPPISKEVQLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  330

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+M++PP+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  331  QIFMGVMLHPPQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  390

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRA+E A+   K PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP E
Sbjct  391  FPQIRLPPRALEAAKQAAKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDE  450

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM+SFKKFNDEFM+QYED+RGYSR+
Sbjct  451  EDMPAIMDSFKKFNDEFMEQYEDNRGYSRL  480



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   387 bits (993),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   387 bits (993),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   386 bits (992),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK++SISLSPNVP 
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKISSISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGDISY+Q+VRESKGIL+SLR+RA IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPLKPGDISYEQYVRESKGILDSLRRRAWIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+A+E A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAVEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMP IM SFKKFNDEFM+QYED+  +SRM
Sbjct  452  EDMPEIMSSFKKFNDEFMEQYEDNWSHSRM  481



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGPP+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS+SLSPNVP Q
Sbjct  273  MGPPMSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNP KPGDISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSF
Sbjct  333  IFMGLMVNPLKPGDISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPKAIEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            +MP IM SFKKFN+EFM+QY+D  GYSR+
Sbjct  453  EMPEIMASFKKFNNEFMEQYDDRSGYSRL  481



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEI+KVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIHKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVAS+SLSPNVP Q
Sbjct  273  MGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQ  332

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNP KPG+ISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSF
Sbjct  333  IFMGLMVNPLKPGNISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSF  392

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  393  PQIRLPPKAIEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  452

Query  217  DMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            +MP IM SFKKFN+EFM+QY+D  GYSR+
Sbjct  453  EMPEIMASFKKFNNEFMEQYDDRSGYSRL  481



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+ EEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTAEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPSKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM SFKKFNDEFM QY D+ GYSRM
Sbjct  452  EEMPEIMGSFKKFNDEFMSQYGDNFGYSRM  481



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPLSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPK GDISYDQFVRES+GILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKSGDISYDQFVRESEGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IMESFKKFN EFM QY D+ GYSRM
Sbjct  452  EEMPEIMESFKKFNHEFMSQYGDNFGYSRM  481



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   383 bits (983),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 196/211 (93%), Gaps = 2/211 (1%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            +GPP+S ELQLVSFHTVSKGYWGECGQRGGYFEMTNI+P +V+EIYKV+SI+LSPNVP Q
Sbjct  271  IGPPMSNELQLVSFHTVSKGYWGECGQRGGYFEMTNISPETVDEIYKVSSIALSPNVPAQ  330

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGDISYD+F+ ESKGILESLR+RARIMTDGFNSCRN+VCNFTEGAMYSF
Sbjct  331  IFMGLMVNPPKPGDISYDKFITESKGILESLRRRARIMTDGFNSCRNIVCNFTEGAMYSF  390

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQI+LP RAIE A   GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE
Sbjct  391  PQIQLPARAIEAANRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  450

Query  217  DMPAIMESFKKFNDEFMDQYED--HRGYSRM  131
            +MP IM SFKKFND+FMDQYE+  H+ YSRM
Sbjct  451  EMPEIMASFKKFNDDFMDQYEEDHHKAYSRM  481



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS ELQL+SFHTVSKGYWGECGQRGGYFEMTNI PR+V+EIYKVASISLSPNVP 
Sbjct  272  DMGPPISNELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPPRAIE A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIQLPPRAIEAAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            EDMP IM SFKKFND FM++Y
Sbjct  452  EDMPEIMTSFKKFNDAFMEEY  472



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   380 bits (975),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN  PR VEEIYKVASI+LSPNV  
Sbjct  194  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSA  253

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  254  QIFMGLMVNPPKPGDISYDQFTRESKGILESLRRRANIMTDGFNSCKNVVCNFTEGAMYS  313

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP A++ A+  GK PDV+YCLKLLE TGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  314  FPQIRLPPGALQAAKQAGKVPDVFYCLKLLETTGISTVPGSGFGQKEGVFHLRTTILPAE  373

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  374  EEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  403



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASI+LSPNVPG
Sbjct  272  DMGPPVSREVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP RA++ A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPQRAMDVAKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDH  149
            EDMPAIM SFKKFND FM+QY+DH
Sbjct  452  EDMPAIMSSFKKFNDSFMEQYQDH  475



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+SKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASISLSPNVP 
Sbjct  272  DMGPPVSKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGL+ NPPKPGDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFLGLLANPPKPGDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPPRAI+ A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIQLPPRAIDAAKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            E+MP+IM SFKKFNDEFM +YE
Sbjct  452  EEMPSIMASFKKFNDEFMARYE  473



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P+SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  269  DMGLPLSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  328

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  329  QIFMGLMVSPPKPGDISYDQFSRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  388

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  389  FPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  448

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  449  EEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  478



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPI+KELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASISLSPNVP 
Sbjct  272  DMGPPITKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLM NPPKPGDISYDQFVRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFLGLMANPPKPGDISYDQFVRESKGILESLRRRAHLMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP   I+ A+ LGK PDV+YC+KLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIQLPRGVIDAAKKLGKTPDVFYCIKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            EDMP+IM SFKKFND+FM+QYE
Sbjct  452  EDMPSIMASFKKFNDDFMEQYE  473



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG PIS E+QLVS+HTVSKGYWGECGQRGGYFEMTN++P +V+E+YK++SISLSPNVP 
Sbjct  272  EMGLPISMEVQLVSYHTVSKGYWGECGQRGGYFEMTNLSPETVDEMYKISSISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDIS+ +F  ESK ILESLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISFMRFAAESKEILESLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPKAIEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            +DMP IM SFKKFNDEFM+QYE HRGYSRM
Sbjct  452  QDMPEIMASFKKFNDEFMEQYEHHRGYSRM  481



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 196/210 (93%), Gaps = 2/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY    GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQY--GVGYSRM  479



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SK +QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  269  DMGSPFSKGVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  328

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  329  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  388

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP A++ A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  389  FPQIRLPPGALQAAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  448

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  449  EEMPEIMDSFKKFNDEFMAQYENGFGYSRM  478



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   380 bits (976),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DM PPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASISLSPNVP 
Sbjct  272  DMDPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLM NPPKPGDISYDQFVRESKGILESLR+RA IMT GFNSCRNV+CNFTEGAMYS
Sbjct  332  QIFLGLMANPPKPGDISYDQFVRESKGILESLRRRAHIMTGGFNSCRNVLCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP  AI+ A+ LGKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIQLPRGAIDAAKKLGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            EDMP+IM SFKKFND+FM QYE
Sbjct  452  EDMPSIMASFKKFNDDFMKQYE  473



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 196/210 (93%), Gaps = 2/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY    GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQY--GVGYSRM  479



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN  PR VEEIYKVASI+LSPNV  
Sbjct  269  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSA  328

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  329  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  388

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  389  FPQIKLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  448

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  449  EEMPEIMDSFKKFNDEFMTQYENSFGYSRM  478



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SK +QLVSFHTVSKGYWGECGQRGGYFEMTN  PR VEEIYKVASI+LSPNV  
Sbjct  194  DMGSPFSKGVQLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSA  253

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  254  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  313

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  314  FPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  373

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  374  EEMPEIMDSFKKFNDEFMAQYENGFGYSRM  403



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   380 bits (976),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SK +QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  272  DMGSPFSKGVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   380 bits (975),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 196/210 (93%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI+LSPNVPG
Sbjct  279  DMGPPMSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPG  338

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  339  QIFMGLMVNPPKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  398

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AI+ A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  399  FPQIRLPPKAIDAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  458

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFND FMDQY+   GYSRM
Sbjct  459  EDMPAIMTSFKKFNDTFMDQYD---GYSRM  485



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   380 bits (975),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 196/210 (93%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI+LSPNVPG
Sbjct  278  DMGPPMSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPG  337

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  338  QIFMGLMVNPPKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  397

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+AI+ A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  398  FPQIRLPPKAIDAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  457

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFND FMDQY+   GYSRM
Sbjct  458  EDMPAIMTSFKKFNDTFMDQYD---GYSRM  484



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   376 bits (965),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+ PR VEEIYKVASI+LSPNV  
Sbjct  170  EMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSA  229

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  230  QIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYS  289

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  290  FPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  349

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  350  DEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  379



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  272  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPAGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY++  GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMTQYDNTVGYSRM  481



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   379 bits (972),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI P+SVEEIYKVASISLSPNVP 
Sbjct  275  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPA  334

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGL+ NPPKPGDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  335  QIFLGLLANPPKPGDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYS  394

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP AI+ A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP E
Sbjct  395  FPQIQLPPGAIDAAKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPVE  454

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            E+MP+IM SFKKFNDEFM QYE
Sbjct  455  EEMPSIMASFKKFNDEFMAQYE  476



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   379 bits (972),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  272  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NV CNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVACNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPAGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   379 bits (972),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  272  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPAGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFND+FM QY+++ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDDFMTQYDNNFGYSRM  481



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SK +QLVSFHTVSKGYWGECGQRGGYFEMTNI PR VEEIYKVASI+LSPNV  
Sbjct  269  DMGSPFSKGVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSA  328

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  329  QIFMGLMVSPPKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  388

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  389  FPQIRLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  448

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY++  GYSRM
Sbjct  449  EEMPEIMDSFKKFNDEFMAQYDNGFGYSRM  478



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 194/210 (92%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI+LSPNVPG
Sbjct  272  DMGPPLSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASIALSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+MVNPPKPGDISY +F  ESK IL+SLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGVMVNPPKPGDISYLKFAAESKSILDSLRRRARMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIEAAKRAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ED PAIM SFK FND FM QYE   GYSRM
Sbjct  452  EDFPAIMSSFKNFNDSFMAQYE---GYSRM  478



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P SK +QLVSFHTVSKGYWGECGQRGGYFEMTN+ PR VEEIYKVASI+LSPNV  
Sbjct  272  EMGSPFSKGVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI +GLMV+PPKPGDISYDQF RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QILMGLMVSPPKPGDISYDQFARESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPGAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 195/210 (93%), Gaps = 2/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDISY QFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISYAQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFND+FM QY    GYSRM
Sbjct  452  EEMPEIMDSFKKFNDDFMSQY--GVGYSRM  479



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 196/210 (93%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS+E+QL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASI+LSPNVPG
Sbjct  273  DMGPPISREVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPG  332

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLM+NPPKPGDISY +F  ESK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  333  QIFMGLMMNPPKPGDISYLKFATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYS  392

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP RAI+TA+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  393  FPQIRLPKRAIDTAKSAGKEPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  452

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFND FM+QY+D   YSR+
Sbjct  453  EDMPAIMSSFKKFNDSFMEQYQD---YSRL  479



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 193/210 (92%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS ELQ+VSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI+LSPNVPG
Sbjct  193  DMGPPISSELQVVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPG  252

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+MVNPPKPGDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  253  QIFMGVMVNPPKPGDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  312

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  313  FPQIRLPPRAIEAARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  372

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ED PAIM SFKKFND FM+QYE   GYSR+
Sbjct  373  EDFPAIMSSFKKFNDSFMEQYE---GYSRL  399



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+ PR VEEIYKVASI+LSPNV  
Sbjct  272  EMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  452  DEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+ PR VEEIYKVASI+LSPNV  
Sbjct  272  EMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  452  DEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   376 bits (965),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN  PR VEEIYKVASI+LSPNV  
Sbjct  269  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSA  328

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  329  QIFMGLMVNPPKPGDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYS  388

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI LPP A++ A+  GK PDV+YCLKLLEA GISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  389  FPQILLPPGALQAAKQAGKVPDVFYCLKLLEAAGISTVPGSGFGQKEGVFHLRTTILPAE  448

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFND FM QY+++ GYSRM
Sbjct  449  EEMPEIMDSFKKFNDAFMTQYDNNFGYSRM  478



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   376 bits (966),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI+LSPNVPG
Sbjct  282  DMGPPMSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPG  341

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  342  QIFMGLMVNPPKPGDISYLKFAAESKAILESLRRRARLMTDGFNSCRNVVCNFTEGAMYS  401

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP RAI+ A   GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  402  FPQIRLPQRAIDAANRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  461

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRG---YSRM  131
            EDMPAIM SFKKFND FMD+Y+ + G   YSRM
Sbjct  462  EDMPAIMSSFKKFNDSFMDEYDGYGGGSSYSRM  494



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   375 bits (964),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG PISKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI PR+VEEIYKVASI+LSPNV  
Sbjct  272  DMGAPISKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+PPKPGDIS+DQFV ESK ILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVSPPKPGDISHDQFVCESKRILESLRRRARMMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +AIE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIKLPSKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHR-GYSRM  131
            E+MP IM+SFKKFNDEFM QY D+  GYSRM
Sbjct  452  EEMPEIMDSFKKFNDEFMSQYGDNNFGYSRM  482



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 193/210 (92%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS ELQ+VSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI+LSPNVPG
Sbjct  272  DMGPPISSELQVVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+MVNPPKPGDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGVMVNPPKPGDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPPRAIE A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPPRAIEAARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ED PAIM SFKKFND FM+QYE   GYSR+
Sbjct  452  EDFPAIMSSFKKFNDSFMEQYE---GYSRL  478



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN  PR VEEIYKVASI+LSPNV  
Sbjct  328  DMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSA  387

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMV+ PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+N VCNFTEGAMYS
Sbjct  388  QIFMGLMVSSPKPGDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNAVCNFTEGAMYS  447

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  448  FPQIQLPPGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  507

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  508  EEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  537



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 192/210 (91%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI LSPNVPG
Sbjct  273  DMGPPISREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPG  332

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+MVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  333  QIFMGVMVNPPKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  392

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP RAIE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  393  FPQIQLPARAIEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  452

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ED P IM SFKKFND FM+QYE   GYSRM
Sbjct  453  EDFPTIMSSFKKFNDSFMEQYE---GYSRM  479



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 192/210 (91%), Gaps = 3/210 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI LSPNVPG
Sbjct  273  DMGPPISREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPG  332

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+MVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  333  QIFMGVMVNPPKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  392

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP RAIE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  393  FPQIQLPARAIEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  452

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ED P IM SFKKFND FM+QYE   GYSRM
Sbjct  453  EDFPTIMSSFKKFNDSFMEQYE---GYSRM  479



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASISLSPNVP 
Sbjct  272  DMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKIASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+F+GLMVNPPKPGD+SY+Q+ RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QVFMGLMVNPPKPGDVSYEQYHRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AIETA+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP E
Sbjct  392  FPQIQLPPKAIETAKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPE  451

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E+MP IM SF+KFNDEFM+QY
Sbjct  452  EEMPGIMASFRKFNDEFMEQY  472



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+ PR VEEIYKVASI+LSPNV  
Sbjct  272  EMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVV NFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVRNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  392  FPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  452  DEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYK+ASISLSPNVP 
Sbjct  272  DMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKIASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+F+GLMVNP KPGD+SY+Q+ RESKGIL+SLR+RARIMTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QVFMGLMVNPLKPGDVSYEQYHRESKGILDSLRRRARIMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AIETA+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP E
Sbjct  392  FPQIQLPPKAIETAKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPE  451

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E+MPAIM SFKKFNDEFM+QY
Sbjct  452  EEMPAIMASFKKFNDEFMEQY  472



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   363 bits (931),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 187/210 (89%), Gaps = 6/210 (3%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPPISKE+QLVSFHTVSKGYWGECGQ GGYFEMTNI P++V+EIYKVASISLSPNVP 
Sbjct  135  DLGPPISKEVQLVSFHTVSKGYWGECGQXGGYFEMTNIPPKTVDEIYKVASISLSPNVPI  194

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFL LMVNPPKPGDISY +F      I ESL++RA IMTDGFNSC+NVVCNFTEGAMYS
Sbjct  195  QIFLSLMVNPPKPGDISYLKF------ITESLKRRAHIMTDGFNSCKNVVCNFTEGAMYS  248

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQ+RLPP+AIETA+  GK PDV+YCLKLLEATGIS VPGSGFGQKE  FHL TTILPAE
Sbjct  249  FPQMRLPPKAIETAKRAGKVPDVFYCLKLLEATGISMVPGSGFGQKEEAFHLMTTILPAE  308

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EDMPAIM SFKKFNDEFM+QY DHRGYS M
Sbjct  309  EDMPAIMASFKKFNDEFMEQYGDHRGYSWM  338



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKELQLVS+HTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASISLSPNVPG
Sbjct  272  DMGLPFSKELQLVSYHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASISLSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIFLGLMVNPPKP DISY +FV ESK ILESLR+RA +MTDGFN+CRNV+CNFTEGAMYS
Sbjct  332  QIFLGLMVNPPKPADISYQRFVAESKAILESLRRRAHLMTDGFNNCRNVICNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+AI  A+  GKAPDV+YCLKLLEATG+STVPGSGFGQKEGVFHLRTTILP E
Sbjct  392  FPQIKLPPKAIAAAKEAGKAPDVFYCLKLLEATGMSTVPGSGFGQKEGVFHLRTTILPPE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            E+MP IM  FK FND+FM +YE++  +SR+
Sbjct  452  EEMPEIMNVFKIFNDDFMAKYENY-SWSRL  480



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPIS+E+QLVSFHTVSKGYWGECGQRGGYFEMTN+ P++V+EIYKVASI LSPNVPG
Sbjct  273  DMGPPISREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPG  332

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+G+MVNPPKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYS
Sbjct  333  QIFMGVMVNPPKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYS  392

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP RAIE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  393  FPQIQLPARAIEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  452

Query  220  EDMPAIMESFKKFNDEF  170
            ED P IM SFKKFND F
Sbjct  453  EDFPTIMSSFKKFNDSF  469



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 189/211 (90%), Gaps = 3/211 (1%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGPP+SKE+QL+SFHTVSKGYWGECGQRGGYFEMTNI P +V EIYKVAS+S+SPNVP Q
Sbjct  173  MGPPVSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPETVVEIYKVASLSISPNVPAQ  232

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            IF+GLMVNPPKPGD+SY+QF+RESKGILESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSF
Sbjct  233  IFMGLMVNPPKPGDVSYEQFIRESKGILESLRRRARMMTDGFNSCKNVICNFTEGAMYSF  292

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGF--GQKEGVFHLRTTILPA  224
            PQI  PP+AI+ A+  GK PDV+YCLKLLEATGISTVP  G    +   VFHLRTTILPA
Sbjct  293  PQIX-PPKAIDAAKRAGKVPDVFYCLKLLEATGISTVPQIGLIVIRSCRVFHLRTTILPA  351

Query  223  EEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            EEDMP IM+SFKKFNDEFM++YE H GYSR+
Sbjct  352  EEDMPEIMDSFKKFNDEFMERYEGHGGYSRL  382



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE QLV FH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  116  DMGPPISKEQQLVCFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  175

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQFVRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  176  QIFMGLMVNPPKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYS  235

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPPRAIE A+   KAPDVYYCLKLLEATGISTVPGSGFGQK+G FHLRTTILP E
Sbjct  236  FPQIKLPPRAIEAAKQARKAPDVYYCLKLLEATGISTVPGSGFGQKDGYFHLRTTILPLE  295

Query  220  EDMPAIMESF  191
            E+MPAIM  F
Sbjct  296  EEMPAIMGEF  305



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGPP S+ L+LVSFHTVSKG+ GECGQRGGYFEMTN  P++V+E+YKV+SI+LSPNV GQ
Sbjct  274  MGPPASEALELVSFHTVSKGFLGECGQRGGYFEMTNFHPKTVDELYKVSSIALSPNVSGQ  333

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            I +GLMVNPPKPGDISY Q+  ESK I  SLRKRA IMTDGFN+C NVVCNFTEGAMYSF
Sbjct  334  IMMGLMVNPPKPGDISYPQYEAESKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMYSF  393

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQ++LP  A+  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+
Sbjct  394  PQVKLPQAAVAAAKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEK  453

Query  217  DMPAIMESFKKFNDEFMDQYEDHR  146
            DMP IMESFKKFN +FM QY D +
Sbjct  454  DMPGIMESFKKFNQDFMAQYADAK  477



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGP  S  L+LVSFHTVSKG+ GECGQRGGYFEMTN  P++VEE+YKVASI+LSPNV GQ
Sbjct  274  MGPRYSSALELVSFHTVSKGFLGECGQRGGYFEMTNFHPKTVEELYKVASIALSPNVTGQ  333

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            I +GLMV PP+PGD+S+  +  ES  I++SLRKRA IMTDGFN+C NVVCNFTEGAMYSF
Sbjct  334  IMMGLMVKPPRPGDVSFPLYAAESAAIMQSLRKRAHIMTDGFNACENVVCNFTEGAMYSF  393

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQ++LP  AI  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+
Sbjct  394  PQVKLPKAAIAAARQAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEK  453

Query  217  DMPAIMESFKKFNDEFMDQYEDHR  146
            DMPAIMESFK FN +FM QY D +
Sbjct  454  DMPAIMESFKMFNADFMAQYSDSK  477



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPP+SKE+QLVSFH+VSKGY+GECGQRGGYFEMTNI P +V+EIYKVASISLSPNVP 
Sbjct  272  DIGPPLSKEVQLVSFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLM+NPPKPGDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMINPPKPGDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  248
            FPQI+LPP+A+ETA+  GKA DVYYCLKLLEATGISTVPGSGFGQKEG  H
Sbjct  392  FPQIKLPPKALETAKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGYVH  442



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   314 bits (804),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGPP+S+ L+LVSFHTVSKG+ GECGQRGGYFEMTNI P++V+E+YKV+SI+LSPNV GQ
Sbjct  274  MGPPVSEALELVSFHTVSKGFLGECGQRGGYFEMTNIHPKTVDELYKVSSIALSPNVTGQ  333

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            I +GLMV+PPKPGDISY  +  ES+ I  SLRKRA IMTDGFN+C N+VCNFTEGAMYSF
Sbjct  334  IMMGLMVSPPKPGDISYPLYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMYSF  393

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQ++LP  AI  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E 
Sbjct  394  PQVKLPQAAIAAAKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSER  453

Query  217  DMPAIMESFKKFNDEFMDQYEDHR  146
            DMP IMESFKKFN +FM Q+ D +
Sbjct  454  DMPGIMESFKKFNADFMAQHSDTK  477



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+GPP+SKE+QLVSFH+VSKGY+GECGQRGGYFEM NI+P +V+EIYKVASISLSPNVP 
Sbjct  272  DIGPPLSKEVQLVSFHSVSKGYYGECGQRGGYFEMVNISPETVDEIYKVASISLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  257
            FPQI LPP+A+ETA+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  392  FPQIVLPPKALETAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPP+S+E+QL+SFHTVSKGYWGECGQRGGYFEMTNI P++V+EIYKVASI+LSPNVPG
Sbjct  272  DMGPPVSREVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  257
            FPQIRLP RA++ A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEG
Sbjct  392  FPQIRLPQRAMDVAKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  439



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P SKE+QLVSFHTVSKGYWGECGQRGGYFEMTN+ PR VEEIYKVASI+LSPNV  
Sbjct  272  EMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPPKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  257
            FPQIRLP  A++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  392  FPQIRLPTGALQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 173/210 (82%), Gaps = 0/210 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P S  ++LVSFH+VSKG+ GECGQRGGYFEMTNI P++VEE+YKVASISLSPNV G
Sbjct  272  DMGAPYSNTVELVSFHSVSKGFLGECGQRGGYFEMTNIHPQTVEELYKVASISLSPNVVG  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI +GLMV PP+P DISY Q+  ESK I+ES+R+RA IMTDGFN C +VVCNFTEGAMYS
Sbjct  332  QIMMGLMVTPPRPFDISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYS  391

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I+L   A++ A   GKA DV+YCLKLLEATGISTVPGSGFGQKEG  HLRTTILP E
Sbjct  392  FPRIKLSKAAMDAAAQAGKAADVFYCLKLLEATGISTVPGSGFGQKEGTLHLRTTILPLE  451

Query  220  EDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            +DMP IM  F+KF+ +FM QY D+   SR+
Sbjct  452  QDMPGIMAKFQKFHADFMAQYSDYSVSSRL  481



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   297 bits (761),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 163/215 (76%), Gaps = 39/215 (18%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGPPISKE+QLVSFHTVSKGYWGECGQRGGYFEMTNI  ++V+EIYKVAS+SLSPNVP 
Sbjct  272  DMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKVASVSLSPNVPA  331

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNP KPGDISY+Q+VRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYS
Sbjct  332  QIFMGLMVNPLKPGDISYEQYVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYS  391

Query  400  FP-----QIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTT  236
            F      +I    RA+                                     VFHLRTT
Sbjct  392  FLXXSWFRIWTERRALPCR----------------------------------VFHLRTT  417

Query  235  ILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  131
            ILPAEEDMPAIM SFKKFNDEFM++YEDHRGYSRM
Sbjct  418  ILPAEEDMPAIMASFKKFNDEFMEEYEDHRGYSRM  452



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   286 bits (732),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -2

Query  640  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  461
            ++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMT
Sbjct  2    QTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMT  61

Query  460  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  281
            DGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPG
Sbjct  62   DGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPG  121

Query  280  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  179
            SGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN
Sbjct  122  SGFGQKEGVFHLRTTILPAEEEMPLIMESFKKFN  155



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  1    QIFMGLMVNPPKPGDISYLKYATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  60

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP RA++TA+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  61   FPQIRLPQRAMDTAKSAGKAPDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  120

Query  220  EDMPAIMESFKKFNDEFMDQYEDH  149
            EDMPAIM SFKKFND FM+QY+D+
Sbjct  121  EDMPAIMSSFKKFNDSFMEQYQDY  144



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  640  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  461
            ++V+EIYKVASI+LSPNVPGQIF+GLM+N PKPGDISY +F  ESK IL+SLR+RA+IMT
Sbjct  4    QTVDEIYKVASIALSPNVPGQIFMGLMMNHPKPGDISYLKFATESKSILDSLRRRAQIMT  63

Query  460  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  281
            DGFNSC+NVVCNFTEGAMYS+ QI LP RAI+TA+  GK PDV+YCLKLLEAT ISTVPG
Sbjct  64   DGFNSCQNVVCNFTEGAMYSYFQICLPKRAIDTAKSAGKEPDVFYCLKLLEATRISTVPG  123

Query  280  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  179
            SGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFN
Sbjct  124  SGFGQKEGVFHLRTTILPAEEDMPAIMLSFKKFN  157



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P S E +LVSFHT+SKG  GECG RGG  E TNI P +++++YK+ASI+LSPN  G
Sbjct  323  DMGAPYS-EQELVSFHTISKGALGECGMRGGMLEATNIHPDTIDQLYKIASINLSPNTFG  381

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q  L LMVNPPK GD S++Q   E+ GI+ S+R+RAR+MTDGFN+C  + CN+TEGAMYS
Sbjct  382  QAGLALMVNPPKEGDPSHEQHEAEAAGIIASMRRRARMMTDGFNACEGITCNYTEGAMYS  441

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP++ LPP+A++ A+  GKAPD +YCLKLL+ATG+ TVPGSGFGQ+EG FHLRTTILP E
Sbjct  442  FPRLNLPPKALQAAKKAGKAPDTWYCLKLLDATGVLTVPGSGFGQEEGTFHLRTTILPQE  501

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++ SF+KF+  FMD+Y
Sbjct  502  DKIKDVIASFQKFHASFMDEY  522



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P    ++L+SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  G
Sbjct  321  EMGEPYRSHVELLSFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMG  380

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  +VNPPKPGD SY+ + +E    L SLR+RA ++TDGFNS   V CNFTEGAMYS
Sbjct  381  QIALSCLVNPPKPGDSSYEMYTKEKAAELASLRRRAHMVTDGFNSLDGVTCNFTEGAMYS  440

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LPP+A+E A+  GKA DV+YCLKLLE+TGISTVPGSGFGQ++G FHLRTTILP E
Sbjct  441  FPQIKLPPKALEAAKAAGKAGDVFYCLKLLESTGISTVPGSGFGQEDGTFHLRTTILPRE  500

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E M + +E F+KF+ +FM QY
Sbjct  501  EVMSSFVEKFEKFHKDFMKQY  521



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 158/201 (79%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P    ++L+SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  G
Sbjct  320  EMGEPYRSHVELLSFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMG  379

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L ++VNPPKPGD SYDQ+ +E    L SLR+RA ++TDGFN+   V CNFTEGAMYS
Sbjct  380  QIALSVLVNPPKPGDPSYDQYTKEKASELVSLRRRAHMVTDGFNALDGVTCNFTEGAMYS  439

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +A+E A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP E
Sbjct  440  FPQIKLPAKALEAAKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPRE  499

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E M   +E F KF+ +FM QY
Sbjct  500  EVMTHFVEKFDKFHKDFMKQY  520



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P    ++L+SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  G
Sbjct  320  EMGEPYRSHVELLSFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMG  379

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L ++VNPPKPGD SYDQ+ +E    L SLR+R  ++TDGFN+   V CNFTEGAMYS
Sbjct  380  QIALSVLVNPPKPGDPSYDQYTKEKASELVSLRRRRHMVTDGFNALDGVTCNFTEGAMYS  439

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQI+LP +A+E A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP E
Sbjct  440  FPQIKLPAKALEAAKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPRE  499

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E M   +E F KF+ +FM QY
Sbjct  500  EVMTTFVEKFDKFHKDFMKQY  520



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 161/231 (70%), Gaps = 7/231 (3%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MG P ++ L+L +FHT SKG +GECG RGG  E+ N   R  +E+YK+ASI+LSPNVPGQ
Sbjct  319  MGSPYAQGLELATFHTASKGVYGECGFRGGVMELLNFDERVADELYKLASINLSPNVPGQ  378

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            + LGLMVN P+PGD SY Q+ RE + +L+SLR+RAR +TD FNSC  +VC  TEGAMYSF
Sbjct  379  VILGLMVNGPRPGDESYAQYAREKQDLLDSLRRRARAITDAFNSCEGIVCQETEGAMYSF  438

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            P+I LPP A+  A+  GK+PDV+YCLKLLE TGISTVPGSGF Q++G FH RTTILP E 
Sbjct  439  PKITLPPAAMAAAKAAGKSPDVFYCLKLLETTGISTVPGSGFKQRDGTFHFRTTILPPES  498

Query  217  DMPAIMESFKKFNDEFMDQYE-------DHRGYSRM*QIADNMKQLLKSHK  86
                I++ F  F+  FM +Y+       D R   R  Q    +  ++ +H+
Sbjct  499  KFQDIIQRFLAFHSAFMAEYKGSTGRGTDSRDVKRAEQQESEVNWMIPAHR  549



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 153/201 (76%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P +  ++L+S+HTVSKG  GECG RGGY+EM NI P +V++ YK++SI+LSPN  G
Sbjct  420  DMGEPYASGVELISYHTVSKGTSGECGLRGGYYEMVNIHPATVDQFYKISSINLSPNSIG  479

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  MVNPP  GD S++ +++E +G L SL +RA+++ DGFNS + V CN TEGAMY+
Sbjct  480  QIALSCMVNPPAAGDPSHELWIQEQQGELASLNRRAKMVVDGFNSLQGVSCNATEGAMYA  539

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP++ LPPRA+E A+  G+APD +YCL+LLEATGI  VPGSGFGQ EG FHLRTTILP E
Sbjct  540  FPRLSLPPRALEAARKAGRAPDAFYCLRLLEATGIVAVPGSGFGQAEGSFHLRTTILPRE  599

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E M   ++ F+ F+  FM ++
Sbjct  600  ERMAEFVQKFRTFHQSFMAEF  620



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 148/202 (73%), Gaps = 1/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG   + +L++VSFH+VSKG+ GECG+RGGY E+  IT     EIYK+ASI L PNV G
Sbjct  330  DMGGEYA-DLEMVSFHSVSKGFVGECGKRGGYMELNGITSDVKAEIYKLASIGLCPNVIG  388

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ + LMV PP PGD SY+ +++E  GI +SL+KRA ++    NS   V CN +EGAMY+
Sbjct  389  QLVVDLMVRPPTPGDSSYELYIKERDGIYDSLKKRANLLNKALNSLEGVTCNPSEGAMYA  448

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP +A+E AQ +GKAPD YYC++LLE TGI  VPGSGFGQK+G +H RTT LP+E
Sbjct  449  FPQIRLPKKAVEYAQSIGKAPDAYYCIQLLEHTGICVVPGSGFGQKDGTYHFRTTFLPSE  508

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            E +  + E    F+ +FM++Y+
Sbjct  509  EAIEGVCERIADFHKQFMNKYK  530



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 142/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +LQLVS H+VSKGY+GECG+RGGY E+T  +    E++YK+AS++L  N+ GQI   L++
Sbjct  60   DLQLVSLHSVSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIM  119

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            +PPK GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP 
Sbjct  120  DPPKAGDASYDLYEEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQ  179

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AIE A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++ 
Sbjct  180  KAIEAARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIS  239

Query  196  SFKKFNDEFMDQYED  152
             F++F++EFM QY D
Sbjct  240  RFREFHEEFMSQYRD  254



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 145/196 (74%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++LQLVSFH+VSKGY+GECG+RGGY E+T  +    E++YK+AS++L  N+ GQI   L+
Sbjct  287  EDLQLVSFHSVSKGYYGECGKRGGYMEVTGFSAPVREQLYKIASVNLCSNITGQILSSLI  346

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SYD ++ E  GIL+SL +RA+ M   FNS   + CN TEGAMY FPQI LP
Sbjct  347  MNPPKAGDGSYDLYMEEKDGILKSLARRAKAMESAFNSIDGITCNKTEGAMYLFPQIYLP  406

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ + KAPD +Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++
Sbjct  407  HKAIEAARAVNKAPDAFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMI  466

Query  199  ESFKKFNDEFMDQYED  152
              F++F++EFM QY D
Sbjct  467  ARFREFHEEFMAQYRD  482



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 147/194 (76%), Gaps = 0/194 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K ++L+SFHTVSKG +GECG+RGGY E TNI P +++++YKV SI LS NV GQ+ +GLM
Sbjct  282  KNVELISFHTVSKGVFGECGRRGGYLEATNIHPGALDQLYKVFSIGLSSNVDGQLMMGLM  341

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
             NPPKPGD SY+Q+ +E   I +SL++RA ++++ FN+   V C   EGA+Y+FP++RLP
Sbjct  342  CNPPKPGDASYEQYEQECDAIFQSLKRRAEMISNAFNALPGVSCQNVEGALYAFPRVRLP  401

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
              A++ A+     PD++YCL+LL ATGI  VPGSGFGQ+EG FH RTTILPAEE MP ++
Sbjct  402  EAAVKEAEKKDMGPDLFYCLELLHATGICAVPGSGFGQEEGTFHFRTTILPAEEQMPRVI  461

Query  199  ESFKKFNDEFMDQY  158
            + F  F+ +F+ ++
Sbjct  462  DLFTSFHKDFLQRF  475



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  NV GQI   L++
Sbjct  135  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVM  194

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  195  NPPKAGDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  254

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  255  KAIGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVS  314

Query  196  SFKKFNDEFMDQYED  152
              K+F+++FMD++ D
Sbjct  315  RLKEFHEKFMDEFRD  329



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  NV GQI   L++
Sbjct  135  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIM  194

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP 
Sbjct  195  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQ  254

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  255  KAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  314

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD++ D
Sbjct  315  KFKEFHEKFMDEFRD  329



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+G PIS  ++L SFHTVSKG  GECG RGGY E+TN  P +V+E+YK  SI+LSPN  G
Sbjct  328  DLGKPISDSVELASFHTVSKGVLGECGLRGGYVELTNFHPGTVDELYKAVSINLSPNTTG  387

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ + LMVNPPKPGD SY Q+  E    L SLR+RA  MTDGFN+   V C FTEGAMYS
Sbjct  388  QVAMSLMVNPPKPGDESYAQWKAEHDEGLASLRRRAHAMTDGFNALDGVTCTFTEGAMYS  447

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP++ LPP+AI  A   GK  D +YCL+LLEATGI TVPGSGFGQ+EG FHLRTTILP E
Sbjct  448  FPRLHLPPKAIAAAAAAGKPADTFYCLQLLEATGIVTVPGSGFGQEEGTFHLRTTILPPE  507

Query  220  EDMPAIMESFKKFNDEFMDQY  158
              +   ++ F+ F+  FM +Y
Sbjct  508  AKIGEFVKLFQDFHKAFMAKY  528



>emb|CDX91589.1| BnaC02g15710D [Brassica napus]
 emb|CDX88411.1| BnaC06g38550D [Brassica napus]
 emb|CDX86159.1| BnaA06g28760D [Brassica napus]
Length=131

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 8/133 (6%)
 Frame = -2

Query  640  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  461
            ++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE        R+RARIMT
Sbjct  2    QTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRE--------RRRARIMT  53

Query  460  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  281
            DGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKL EATGISTVPG
Sbjct  54   DGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLFEATGISTVPG  113

Query  280  SGFGQKEGVFHLR  242
            SGFGQKEGVFHLR
Sbjct  114  SGFGQKEGVFHLR  126



>gb|ETK83815.1| hypothetical protein L915_11053 [Phytophthora parasitica]
Length=200

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 139/193 (72%), Gaps = 0/193 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M 
Sbjct  7    DVELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMT  66

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP
Sbjct  67   NPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPP  126

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +A+E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E
Sbjct  127  KAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIE  186

Query  196  SFKKFNDEFMDQY  158
               KF+  FMD+Y
Sbjct  187  KTSKFHARFMDKY  199



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 143/196 (73%), Gaps = 0/196 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF ++SKGY+GECG+RGGY E+T  +P+  ++IYK+ASI+L  N+ GQI   L++
Sbjct  135  DLPLVSFQSISKGYYGECGKRGGYMEITGFSPQVRDQIYKMASINLCSNITGQILASLVM  194

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD S++ F  E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  195  NPPKAGDESFESFRLERDGILSSLGRRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPR  254

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H+R+TILP E+ +P I+ 
Sbjct  255  KAIGAAQAAGTAPDAYYAKRLLEATGIVFVPGSGFGQVPGTWHIRSTILPQEDKIPGIVS  314

Query  196  SFKKFNDEFMDQYEDH  149
             FK+F+D+FMD++ D+
Sbjct  315  RFKEFHDKFMDEFRDY  330



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  NV GQI   L++
Sbjct  259  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIM  318

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP 
Sbjct  319  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQ  378

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  379  KAIGAAQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  438

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD+Y D
Sbjct  439  KFKEFHEKFMDEYRD  453



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  NV GQI   L++
Sbjct  297  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIM  356

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP 
Sbjct  357  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQ  416

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  417  KAIGAAQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  476

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD+Y D
Sbjct  477  KFKEFHEKFMDEYRD  491



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  NV GQI   L++
Sbjct  292  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIM  351

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP 
Sbjct  352  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQ  411

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  412  KAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  471

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD++ D
Sbjct  472  KFKEFHEKFMDEFRD  486



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  NV GQI   L++
Sbjct  322  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVM  381

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  382  NPPKAGDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  441

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  442  KAIGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVS  501

Query  196  SFKKFNDEFMDQYED  152
              K+F+++FMD++ D
Sbjct  502  RLKEFHEKFMDEFRD  516



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 142/195 (73%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +LQLVS H+VSKGY+GECG+RGGY E+T  +    E++YK+AS++L  N+ GQI   L++
Sbjct  300  DLQLVSLHSVSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIM  359

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            +PPK GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP 
Sbjct  360  DPPKAGDASYDLYEEERDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQ  419

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AIE A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++ 
Sbjct  420  KAIEAARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIS  479

Query  196  SFKKFNDEFMDQYED  152
             F++F++EFM QY D
Sbjct  480  RFREFHEEFMSQYRD  494



>gb|ETL37230.1| hypothetical protein L916_10951 [Phytophthora parasitica]
 gb|ETM43674.1| hypothetical protein L914_10886 [Phytophthora parasitica]
Length=200

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 138/193 (72%), Gaps = 0/193 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M 
Sbjct  7    DVELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMT  66

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP
Sbjct  67   NPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPP  126

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +A+E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E
Sbjct  127  KAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIE  186

Query  196  SFKKFNDEFMDQY  158
               KF+  FMD+Y
Sbjct  187  KTSKFHARFMDKY  199



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L++
Sbjct  289  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVM  348

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY  +  E  GIL+SL +RA+ + D FN+   + CN TEGAMY FPQ+ LP 
Sbjct  349  NPPKAGDASYASYKAEKDGILQSLARRAKALEDAFNNLEGITCNKTEGAMYLFPQLLLPR  408

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H+R TILP EE +PAI+ 
Sbjct  409  KAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIIT  468

Query  196  SFKKFNDEFMDQYED  152
             FK F++ FM  Y D
Sbjct  469  RFKTFHESFMAAYRD  483



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  NV GQI   L++
Sbjct  347  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVM  406

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  407  NPPKAGDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  466

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  467  KAIGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVS  526

Query  196  SFKKFNDEFMDQYED  152
              K+F+++FMD++ D
Sbjct  527  RLKEFHEKFMDEFRD  541



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  NV GQI   L++
Sbjct  322  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSPDVREQIYKVASVNLCSNVSGQILASLVM  381

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  382  NPPKAGDESFESFMSERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  441

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  442  KAIGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVS  501

Query  196  SFKKFNDEFMDQYED  152
              K+F+++FMD++ D
Sbjct  502  RLKEFHEKFMDEFRD  516



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L++
Sbjct  289  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVM  348

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP 
Sbjct  349  NPPKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQ  408

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI+ A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+ 
Sbjct  409  KAIDAAKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIIS  468

Query  196  SFKKFNDEFMDQYED  152
             FK F++ FM  Y D
Sbjct  469  RFKAFHEGFMAAYRD  483



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L++
Sbjct  290  DLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVM  349

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP 
Sbjct  350  NPPKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQ  409

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI+ A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+ 
Sbjct  410  KAIDAAKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIIS  469

Query  196  SFKKFNDEFMDQYED  152
             FK F++ FM  Y D
Sbjct  470  RFKAFHEGFMAAYRD  484



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  NV GQI   L++
Sbjct  352  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIM  411

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP 
Sbjct  412  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQ  471

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  472  KAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  531

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD++ D
Sbjct  532  KFKEFHEKFMDEFRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 140/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  NV GQI   L++
Sbjct  352  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIM  411

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP 
Sbjct  412  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQ  471

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  472  KAIGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  531

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD++ D
Sbjct  532  KFKEFHEKFMDEFRD  546



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 141/202 (70%), Gaps = 1/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG  + + L+LVSFH+VSKG+ GECG+RGGY E+  IT     EIYK+ASI L PNV G
Sbjct  399  DMGKEV-EGLELVSFHSVSKGFVGECGKRGGYMELHGITNEVKAEIYKLASIGLCPNVTG  457

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI + LMV PP  G+ SYD +V+E   I +SL++RA ++    N    V CN  EGAMY+
Sbjct  458  QIVVDLMVRPPVAGEQSYDTYVKERDTIFDSLKRRANLLAAALNGLEGVTCNQPEGAMYA  517

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP RAIE A+  GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+E
Sbjct  518  FPQIRLPARAIEEAKANGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTYHFRTTFLPSE  577

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            + +  +      F+  FM +Y+
Sbjct  578  QAIQGVCTRIADFHKNFMAKYK  599



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKG++GECG+RGGY E+T  +P   E+IYKVAS++L  NV GQI   L++
Sbjct  347  DLPLVSFQSVSKGFYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVM  406

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  407  NPPKAGDESFESFMLERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  466

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  467  KAIGAAQAAGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIS  526

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD++ D
Sbjct  527  RFKEFHEKFMDEFRD  541



>ref|XP_010490704.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=202

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 129/190 (68%), Gaps = 25/190 (13%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG P SKE+QLVSFHTVSKGYW    +RGGYFEMTNI PR VEEIYKVASI+ SPNV  
Sbjct  9    DMGSPFSKEVQLVSFHTVSKGYWT--ARRGGYFEMTNIPPRVVEEIYKVASIAFSPNVSA  66

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEG----  413
            QIF+GLMV+PPKPGDI YDQF RESKGILESLR+RA+I+TDGFNSC+ VVC   +     
Sbjct  67   QIFMGLMVSPPKPGDILYDQFARESKGILESLRRRAKIVTDGFNSCKTVVCQRNKAIKAV  126

Query  412  -------------------AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGIST  290
                               AMYSFPQIRLP  A++ A+  GK PDV+YCL L   T    
Sbjct  127  QFRDFDTVLDDSCVSQMLIAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLWLCIWTERRC  186

Query  289  VPGSGFGQKE  260
            VP     ++ 
Sbjct  187  VPSEDTSRRR  196



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  340  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  399

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + DG NS   V CN  EGAMY FP+I LP
Sbjct  400  MSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLP  459

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  460  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIV  519

Query  199  ESFKKFNDEFMDQYED  152
                +F+  FMD++ D
Sbjct  520  NRLTEFHKSFMDEFRD  535



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 137/203 (67%), Gaps = 0/203 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P +  ++L SFHTVSKG  GECG RGGY E  NI P +  E+YKVAS++L PN  G
Sbjct  285  EMGEPWASSVELASFHTVSKGMLGECGLRGGYVEWVNIHPGAQAELYKVASVNLCPNTVG  344

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q  + LMV PP     +  Q+ ++ +  L SLR+RA +MTD FN      CNFTEGAMYS
Sbjct  345  QATVSLMVAPPTGDSEAARQYAKQYEDSLASLRRRAHVMTDAFNGLEGASCNFTEGAMYS  404

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP++ LP +AI+ A+  GK PD +YCL LL  TGI TVPGSGFGQ EG FHLRTTILP E
Sbjct  405  FPRLHLPAKAIQAAKEAGKDPDTFYCLALLADTGIVTVPGSGFGQVEGTFHLRTTILPQE  464

Query  220  EDMPAIMESFKKFNDEFMDQYED  152
            + M   ++  + F+  FM +Y+D
Sbjct  465  DVMHEFVDKLRTFHKSFMAKYKD  487



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T ++P   E+IYKVAS++L  N+ GQI   L++
Sbjct  336  DLSLVSFQSVSKGYYGECGKRGGYMEVTGLSPDVKEQIYKVASVNLCSNISGQILASLVM  395

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ ++ E   IL SL +RA+ + D FNS   V CN  EGAMY FP++ LP 
Sbjct  396  NPPKVGDESYESYIAERDEILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQ  455

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI+ A+ +  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R+TILP E+ +PAI+ 
Sbjct  456  KAIKAAEAVKTAPDAYYAHRLLDATGIVVVPGSGFGQVPGTWHIRSTILPQEDKIPAILS  515

Query  196  SFKKFNDEFMDQYED  152
              K F++ FMD++ D
Sbjct  516  RLKAFHEAFMDEFRD  530



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+G  + + L++VSFH+VSKG+ GECG+RGGY E+  I+P    EIYK++SI L PNV G
Sbjct  331  DLGTKV-EGLEMVSFHSVSKGFVGECGKRGGYMELFGISPEVKSEIYKLSSIGLCPNVIG  389

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ + LMVNPP+ G+ S+ Q++ E   I  SL++RA ++    NS   V CN  EGAMY+
Sbjct  390  QLVVDLMVNPPQEGEASHKQYIEERDAIYNSLKRRANLLATALNSLEGVTCNAPEGAMYA  449

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLPP+A+E A+  GK PD +YC++LLEATGI  VPGSGFGQ++G +H RTT LP+E
Sbjct  450  FPQIRLPPKAVEEAKQNGKQPDAHYCIQLLEATGICVVPGSGFGQRDGTYHFRTTFLPSE  509

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            + +  + +    F+  FM +Y+
Sbjct  510  QAIEGVCKKVADFHKAFMAKYK  531



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 142/201 (71%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG     +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ G
Sbjct  299  DMGKEYD-DVELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDG  357

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+
Sbjct  358  QLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYT  417

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E
Sbjct  418  FPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPE  477

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++E   KF+  FMD+Y
Sbjct  478  DAVDDVIEKTSKFHARFMDKY  498



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 142/201 (71%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG     +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ G
Sbjct  299  DMGKEYD-DVELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDG  357

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+
Sbjct  358  QLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYT  417

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E
Sbjct  418  FPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPE  477

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++E   KF+  FMD+Y
Sbjct  478  DAVDDVIEKTSKFHARFMDKY  498



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 142/201 (71%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG     +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ G
Sbjct  299  DMGKEYD-DVELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDG  357

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+
Sbjct  358  QLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYT  417

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E
Sbjct  418  FPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPE  477

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++E   KF+  FMD+Y
Sbjct  478  DAVDDVIEKTSKFHARFMDKY  498



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  331  KDISLVSFQSVSKGYHGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLV  390

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP
Sbjct  391  MNPPKVGDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLP  450

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  451  QKAIEAAKAVNVAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAII  510

Query  199  ESFKKFNDEFMDQYED  152
               K F++ FM+++ D
Sbjct  511  SHLKAFHESFMEEFHD  526



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  TP   E+IYK+AS++L  N+ GQI   L+
Sbjct  353  KDMSLVSFQSVSKGYYGECGKRGGYMEVTGFTPDVREQIYKMASVNLCSNISGQILASLV  412

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP
Sbjct  413  MSPPKPGDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRISLP  472

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  473  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  532

Query  199  ESFKKFNDEFMDQYED  152
            +    F+  FMD++ D
Sbjct  533  DRLTAFHKSFMDEFRD  548



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 148/201 (74%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P S  ++LVSFHTVSKG +GECG RGGY E+TNI  R  +E+YK+ SI+LSPNV G
Sbjct  275  EMGYPYSSSVELVSFHTVSKGVYGECGLRGGYMELTNIDQRVSDEMYKLCSINLSPNVTG  334

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPPKPG  SY   +RE + +L+SL +RAR + D FN    V C  TEGA+Y+
Sbjct  335  QVAMGIMCNPPKPGSESYALHMREKEVLLQSLIRRARSIVDAFNGLDGVTCEETEGALYA  394

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LP  AI+ A+  GKAPDV+YCL+LL+ TG+S VPGSGFGQ EG +H RTTILPAE
Sbjct  395  FPKIDLPRAAIDAAKAAGKAPDVFYCLELLKETGLSCVPGSGFGQAEGTYHFRTTILPAE  454

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            +   ++++ F  F+  FM +Y
Sbjct  455  DTFQSVVDGFTSFHRGFMAKY  475



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K+L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYK+AS++L  N+ GQI   L+
Sbjct  134  KDLSLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLV  193

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +N PK GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP
Sbjct  194  MNTPKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLP  253

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+
Sbjct  254  QKAIEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAII  313

Query  199  ESFKKFNDEFMDQYED  152
               K F++ F+ ++ D
Sbjct  314  ARLKAFHESFLGEFRD  329



>ref|XP_004342401.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20285.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=514

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 141/203 (69%), Gaps = 1/203 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGP   K+++L+SFH+VSKG  GECG RGG+ E+  I     ++ YK+ASISL PN+PG
Sbjct  313  DMGPKY-KDVELISFHSVSKGVIGECGHRGGFMELVGIDEEVKQQFYKLASISLCPNLPG  371

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ + LMV PP  G+ SYD + +E+ GI ESL++RA  +T+ FN    V CN  EGAMY 
Sbjct  372  QVVVDLMVRPPVAGEPSYDLYHQETTGIFESLKRRALRLTEAFNKLEGVTCNEAEGAMYL  431

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP++RLP +A+  A    K PD +YCL LL+ TGI  VPGSGFGQK+G +H RTT LP E
Sbjct  432  FPRVRLPAKAVHEAVKQKKTPDSFYCLALLDQTGICVVPGSGFGQKDGTYHFRTTFLPPE  491

Query  220  EDMPAIMESFKKFNDEFMDQYED  152
            + + A+ +S  KF+ +FM +Y D
Sbjct  492  DKIDAVAKSIAKFHHDFMQKYRD  514



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  745  ISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLG  566
            +   ++L+S+H+VSKG  GECG+RGGY E+ NI P  VE+IYK+ SISL  N+ GQI + 
Sbjct  277  MKSNVELISYHSVSKGMIGECGRRGGYMELINIDPVVVEQIYKLFSISLCSNIAGQIIVD  336

Query  565  LMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIR  386
            LMVNPP  GD S+DQ+ RE K + ESL++R++ +    NS +N+ C    GAMY+FP I 
Sbjct  337  LMVNPPAKGDPSHDQYEREMKDLFESLKRRSQKLHAALNSMKNITCTEIGGAMYAFPSIH  396

Query  385  LPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPA  206
            LPP A++ A+  G  PD +Y ++LL+ATGI  VPGSGF QK+G FH RTT LP+E  M  
Sbjct  397  LPPSAVQAAKEAGMTPDTFYAVELLDATGICVVPGSGFRQKQGSFHFRTTFLPSESKMDD  456

Query  205  IMESFKKFNDEFMDQY  158
            +++  +KFN  FMD+Y
Sbjct  457  VIDKLRKFNQSFMDKY  472



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  337  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  396

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP
Sbjct  397  MSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLP  456

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  457  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  516

Query  199  ESFKKFNDEFMDQYED  152
                +F+  FMD++ +
Sbjct  517  NRLTEFHKSFMDEFRN  532



>ref|NP_001086104.1| alanine aminotransferase 2 [Xenopus laevis]
 sp|Q6GM82.1|ALAT2_XENLA RecName: Full=Alanine aminotransferase 2; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Xenopus laevis]
 gb|AAH74194.1| Gpt2 protein [Xenopus laevis]
Length=540

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGP  S+ L+L SFH+ SKGY GECG RGGY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  339  EMGPKYSETLELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPG  398

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ L ++VNPPKPG+ SY QF+ E + +L +L ++AR+  +  N    + CN  +GAMYS
Sbjct  399  QVLLDVIVNPPKPGEPSYKQFISEKQAVLNNLAEKARLTEEILNQAPGIRCNPVQGAMYS  458

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I +P +AI+ AQ  G+APD+++C+KLLE TGI  VPGSGFGQ+EG  H R TILP  
Sbjct  459  FPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPT  518

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + + +++E  K F+ +FMD+Y
Sbjct  519  DKLKSLLERLKDFHQKFMDEY  539



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP S+ ++L SFH+VSKG+ GECG R GY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  221  EMGPPYSEVVELASFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPG  280

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  +V+PP+PGD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYS
Sbjct  281  QILLDTVVDPPQPGDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYS  340

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA+  A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  
Sbjct  341  FPRIELPPRALAAAKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPT  400

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E    F  +F+ +Y
Sbjct  401  EKLQVLLEKLSSFYTKFVKEY  421



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  345  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  404

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP
Sbjct  405  MSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLP  464

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  465  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  524

Query  199  ESFKKFNDEFMDQYED  152
                +F+  FMD++ +
Sbjct  525  NRLTEFHKSFMDEFRN  540



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  358  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  417

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP
Sbjct  418  MSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLP  477

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  478  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  537

Query  199  ESFKKFNDEFMDQYED  152
                +F+  FMD++ +
Sbjct  538  NRLTEFHKSFMDEFRN  553



>gb|ESA18192.1| hypothetical protein GLOINDRAFT_334935 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            +  +L SFH+VSKG  GECG+RGGY+E TNI  R +EE+YK+AS+SL PNV GQI + LM
Sbjct  301  ERFELFSFHSVSKGMIGECGRRGGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLM  360

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            V PPK GD SY  + +E   I ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP
Sbjct  361  VQPPKRGDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLP  420

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H R+T LP EE +    
Sbjct  421  QKAIEAAHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFC  480

Query  199  ESFKKFNDEFMDQYED  152
               +KF++EF+++Y D
Sbjct  481  IKLQKFHNEFLEKYCD  496



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP S+ ++L SFH+VSKG+ GECG R GY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  235  EMGPPYSEVVELASFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPG  294

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  +V+PP+PGD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYS
Sbjct  295  QILLDTVVDPPQPGDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYS  354

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA+  A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  
Sbjct  355  FPRIELPPRALAAAKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPT  414

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E    F  +F+ +Y
Sbjct  415  EKLQVLLEKLSSFYTKFIKEY  435



>gb|EXX69945.1| alanine transaminase ALT1 [Rhizophagus irregularis DAOM 197198w]
Length=528

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            +  +L SFH+VSKG  GECG+RGGY+E TNI  R +EE+YK+AS+SL PNV GQI + LM
Sbjct  333  ERFELFSFHSVSKGMIGECGRRGGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLM  392

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            V PPK GD SY  + +E   I ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP
Sbjct  393  VQPPKRGDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLP  452

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H R+T LP EE +    
Sbjct  453  QKAIEAAHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFC  512

Query  199  ESFKKFNDEFMDQYED  152
               +KF++EF+++Y D
Sbjct  513  IKLQKFHNEFLEKYCD  528



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG     +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ G
Sbjct  299  DMGKEYD-DVELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDG  357

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+
Sbjct  358  QLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYT  417

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP + LPP+A+E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E
Sbjct  418  FPNLTLPPKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPE  477

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++E   KF+  FMD+Y
Sbjct  478  DAVDDVIEKTSKFHARFMDKY  498



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K+L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  335  KDLSLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLV  394

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP
Sbjct  395  MNPPKVGDESYESFAAEKNGILSSLARRAKALEDAFNGLVGVTCNKAEGAMYLFPRLHLP  454

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  455  QKAIEAAKAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAII  514

Query  199  ESFKKFNDEFMDQYED  152
               K F++ FM ++ D
Sbjct  515  ARLKAFHESFMGEFRD  530



>ref|XP_002969652.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
 gb|EFJ29740.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
Length=503

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L +VSFH+VSKGY+GECG+RGGY E+T +     E+IYK+AS++L  N+ GQI + L+ 
Sbjct  309  DLSIVSFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVS  368

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP 
Sbjct  369  NPPKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPE  428

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            RA++ A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++ 
Sbjct  429  RALKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALIT  488

Query  196  SFKKFNDEFMDQYED  152
                F+  FMD++ D
Sbjct  489  RLTSFHQRFMDEFRD  503



>ref|XP_002970914.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
 gb|EFJ28240.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
Length=503

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L +VSFH+VSKGY+GECG+RGGY E+T +     E+IYK+AS++L  N+ GQI + L+ 
Sbjct  309  DLSIVSFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVS  368

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP 
Sbjct  369  NPPKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPE  428

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            RA++ A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++ 
Sbjct  429  RALKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALIT  488

Query  196  SFKKFNDEFMDQYED  152
                F+  FMD++ D
Sbjct  489  RLTSFHQRFMDEFRD  503



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            +++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  354  QDMSLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  413

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP
Sbjct  414  MSPPKPGDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRINLP  473

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  474  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  533

Query  199  ESFKKFNDEFMDQYED  152
            E    F+  FMD++ D
Sbjct  534  ERLTAFHKSFMDEFRD  549



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG     +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ G
Sbjct  299  DMGKEYD-DVELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEG  357

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPP+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+
Sbjct  358  QLVVGMMTNPPQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYT  417

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP + LPP+A+E A+  G APD +YC ++L+ TGI  VPGSGFGQKEG +H RTTILP E
Sbjct  418  FPNLTLPPKAVEAAKEAGMAPDAFYCTQMLDDTGIVVVPGSGFGQKEGTWHFRTTILPPE  477

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++E   KF+ +FMD Y
Sbjct  478  DAVDDVIEMTSKFHAKFMDTY  498



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P +  ++L SFHTVSKG  GECG RGGY E  N  P ++ ++YK+ASI+L PN  G
Sbjct  284  EMGEPYAHGVELASFHTVSKGVTGECGLRGGYVEWVNFHPDTIAQLYKIASINLCPNTVG  343

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q  +GL VNPP  G  +  +   E++ I ES+++RA  +T  FN+   V CN TEGAMY+
Sbjct  344  QACVGLAVNPPSQGTKAGKEHATETRAIHESMQRRAAKVTAAFNALPGVTCNPTEGAMYA  403

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP++ LPP+A+E A+  GKAPD +YCL LL+ TGI TVPG+GFGQ +G +H+RTTILP E
Sbjct  404  FPRLHLPPKAVEAARAAGKAPDTFYCLALLDYTGIVTVPGTGFGQVDGTWHMRTTILPQE  463

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +      F +F+ +FMD+Y
Sbjct  464  DVLDDFCNRFAEFHQQFMDKY  484



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            +++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  331  QDISLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLV  390

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +N PK GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP
Sbjct  391  MNTPKVGDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLP  450

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  451  QKAIEAAKVVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAII  510

Query  199  ESFKKFNDEFMDQYED  152
               K F++ FM+++ D
Sbjct  511  SRLKAFHESFMEEFHD  526



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 142/198 (72%), Gaps = 1/198 (1%)
 Frame = -2

Query  745  ISKELQLVSFHTVSKGYWGECGQRGGYFEMTN-ITPRSVEEIYKVASISLSPNVPGQIFL  569
            + KEL++VSFH+VSKG+ GECG+RGGYF+++  I P   EE+YK++S++L PN  GQI +
Sbjct  295  LQKELEMVSFHSVSKGFIGECGRRGGYFQLSEAIDPAVKEELYKISSVNLCPNADGQIMV  354

Query  568  GLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQI  389
             LMV PP  G+ SY ++V E   IL SL++RA  +    NS   V C   EGAMY+FPQI
Sbjct  355  DLMVRPPSQGEASYQEYVAERDNILNSLKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQI  414

Query  388  RLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP  209
             LP +AI+ A+ +G APD+ Y L+LLE TGI  VPGSGF QK G +H RTTILP+EE + 
Sbjct  415  TLPEKAIQKAKEMGVAPDLMYVLELLEETGICVVPGSGFQQKPGTYHFRTTILPSEEQIE  474

Query  208  AIMESFKKFNDEFMDQYE  155
             ++++  KF+D+FM QY+
Sbjct  475  GVVQTLAKFHDKFMKQYK  492



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T I+P   E+IYKVAS++L  N+ GQI   L+
Sbjct  349  KDISLVSFQSVSKGYYGECGKRGGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLV  408

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP
Sbjct  409  MSPPKVGDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLP  468

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  469  QKAIKAAEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  528

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ D
Sbjct  529  TRLTDFHKSFMDEFRD  544



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T I+P   E+IYKVAS++L  N+ GQI   L+
Sbjct  349  KDISLVSFQSVSKGYYGECGKRGGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLV  408

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP
Sbjct  409  MSPPKVGDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLP  468

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  469  QKAIKAAEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  528

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ D
Sbjct  529  TRLTDFHKSFMDEFRD  544



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+
Sbjct  136  KDIHLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLV  195

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP
Sbjct  196  MSPPKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLP  255

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  256  KKAIKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIV  315

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ D
Sbjct  316  TRLTDFHKRFMDEFRD  331



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+
Sbjct  134  KDIHLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLV  193

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP
Sbjct  194  MSPPKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLP  253

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  254  KKAIKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIV  313

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ D
Sbjct  314  TRLTDFHKRFMDEFRD  329



>ref|XP_007441690.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Python 
bivittatus]
 ref|XP_007441691.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Python 
bivittatus]
 ref|XP_007441692.1| PREDICTED: alanine aminotransferase 2-like isoform X5 [Python 
bivittatus]
Length=492

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGP  S+ ++L SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V G
Sbjct  287  EMGPKYSRSVELASFHSISKGFMGECGFRGGYMEVINMDPAVQQQLTKLVSVRLCPPVTG  346

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  MVN P+PGD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+
Sbjct  347  QILLDAMVNQPQPGDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYA  406

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA++ A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +
Sbjct  407  FPRIELPPRAVQDAEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQ  466

Query  220  EDMPAIMESFKKFNDEFMDQYEDHR  146
            E +  +++   +F+ +F  +Y   +
Sbjct  467  EKLEILLQKLSQFHAKFTQEYSQRQ  491



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 0/194 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSFH+ SKGY+GECG+RGGY E T  +P   E+IYK+AS++L  N+ GQI   L+
Sbjct  289  KDISLVSFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLI  348

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP
Sbjct  349  MSPPKVGDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLP  408

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+
Sbjct  409  DKAIKAAEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIV  468

Query  199  ESFKKFNDEFMDQY  158
              F +F+ +FMD++
Sbjct  469  SRFTQFHKQFMDEF  482



>ref|XP_010471259.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010471260.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  353  KDMSLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  412

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + D  N+   V CN  EGAMY FP+I LP
Sbjct  413  MSPPKPGDDSYDSYMVERDGILSSMAKRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLP  472

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ + AI+
Sbjct  473  HKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKILAIV  532

Query  199  ESFKKFNDEFMDQYED  152
            +    F+  FMD++ D
Sbjct  533  DRLTAFHKSFMDEFRD  548



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  328  EDLPLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLV  387

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP
Sbjct  388  MNPPKVGDESYESFDAEKTGILSSLARRAKALEDAFNGLEEVTCNKAEGAMYLFPRLHLP  447

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+
Sbjct  448  KKAIEAAKAVKAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPHEDKIPAII  507

Query  199  ESFKKFNDEFMDQYED  152
               K F++ FM+++ D
Sbjct  508  SRLKAFHEAFMEEFRD  523



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 0/194 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSFH+ SKGY+GECG+RGGY E T  +P   E+IYK+AS++L  N+ GQI   L+
Sbjct  292  KDISLVSFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLI  351

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP
Sbjct  352  MSPPKVGDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLP  411

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+
Sbjct  412  DKAIKAAEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIV  471

Query  199  ESFKKFNDEFMDQY  158
              F +F+ +FMD++
Sbjct  472  SRFTQFHKQFMDEF  485



>gb|KDE04574.1| hypothetical protein MVLG_05042 [Microbotryum violaceum p1A1 
Lamole]
Length=582

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 142/203 (70%), Gaps = 2/203 (1%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+G P S  ++LVSFH++SKG  GECG+RGGYFE+ N  P + EEIYK+ASI L P++ G
Sbjct  382  DLGAPYSNNVELVSFHSISKGQTGECGRRGGYFELCNFAPEAEEEIYKLASIQLCPSLGG  441

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI + ++V PPK G+ SY Q++ E +GI ++L++R+ I+   FN    V CN  EGA+Y 
Sbjct  442  QIGVDVLVCPPKEGEASYAQWIEEREGIAKTLKERSEILHKAFNELEGVECNEAEGALYL  501

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP + LPP+AIE A+    APD +YCL+LL+ATGI  VPGSGFGQKEG FH RTT L   
Sbjct  502  FPTVHLPPKAIEAAKKANLAPDAFYCLELLQATGICVVPGSGFGQKEGTFHFRTTFLAPG  561

Query  220  EDMPAIMESFKKFNDEFMDQYED  152
             D  A  +  ++F++ FM QY D
Sbjct  562  TDKFA--KRLQQFHEGFMKQYRD  582



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K+L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYK+AS++L  N+ GQI   L+
Sbjct  280  KDLSLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLV  339

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +N PK GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP
Sbjct  340  MNTPKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLP  399

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+
Sbjct  400  QKAIEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAII  459

Query  199  ESFKKFNDEFMDQYED  152
               K F++ F+ ++ D
Sbjct  460  ARLKAFHESFLGEFRD  475



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++L LVSF ++SKGY GECG+RGGY E+T  +    E+ YKVAS++L  N+ GQI   L+
Sbjct  292  EDLYLVSFQSISKGYHGECGKRGGYMEVTGFSAEVREQFYKVASVNLCSNISGQIIASLV  351

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY  F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP
Sbjct  352  MNPPKVGDESYKSFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLP  411

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+ +  APD  Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+
Sbjct  412  QKAIDAAKAVIAAPDTLYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPQEDKIPAII  471

Query  199  ESFKKFNDEFMDQYED  152
               K F++ FMD++ D
Sbjct  472  SRLKAFHEAFMDEFRD  487



>ref|XP_007441689.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Python 
bivittatus]
Length=507

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGP  S+ ++L SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V G
Sbjct  302  EMGPKYSRSVELASFHSISKGFMGECGFRGGYMEVINMDPAVQQQLTKLVSVRLCPPVTG  361

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  MVN P+PGD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+
Sbjct  362  QILLDAMVNQPQPGDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYA  421

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA++ A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +
Sbjct  422  FPRIELPPRAVQDAEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQ  481

Query  220  EDMPAIMESFKKFNDEFMDQYEDHR  146
            E +  +++   +F+ +F  +Y   +
Sbjct  482  EKLEILLQKLSQFHAKFTQEYSQRQ  506



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  293  KDISLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLV  352

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP
Sbjct  353  MNPPKDGDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLP  412

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++
Sbjct  413  VKAIKAAEAANTAPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVI  472

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FM++Y D
Sbjct  473  SRLTDFHKAFMNEYRD  488



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 138/195 (71%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            ++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYK+AS++L  N+ GQI   L++
Sbjct  347  DIALVSFQSVSKGYYGECGKRGGYMEVTGFSPEVREQIYKMASVNLCSNISGQILSSLVM  406

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            +PPK GD SY+ ++ E  GIL SL++RA+ + D  NS   V CN  EGAMY FP+I LP 
Sbjct  407  SPPKVGDESYELYLSEKDGILSSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQ  466

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA+++
Sbjct  467  KAIHAAEAAKTAPDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVD  526

Query  196  SFKKFNDEFMDQYED  152
               +F+ +FMD++ D
Sbjct  527  RLTEFHKKFMDEFRD  541



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 136/194 (70%), Gaps = 0/194 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSFH+ SKGY+GECG+RGGY E T  +P   E+IYKVAS++L  N+ GQI   L+
Sbjct  292  KDISLVSFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKVASVNLCSNISGQILASLI  351

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            + PPK GD SY+ F  E + IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP
Sbjct  352  MIPPKVGDESYESFSAEKEAILSSLARRAKILEDAFNSLEGVTCYNAEGALYSFPRINLP  411

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+
Sbjct  412  DKAIKAAEEAKTAPDAFYAWRLLNATGIVIVLGSGFGQRPGTWHFRCTILPQEEKIPAIV  471

Query  199  ESFKKFNDEFMDQY  158
              F +F+ +FMD++
Sbjct  472  SRFTQFHKQFMDEF  485



>ref|XP_003429759.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 1 [Ornithorhynchus 
anatinus]
Length=491

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP S++L+L SFH+ SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  290  EMGPPYSQQLELASFHSTSKGFMGECGFRGGYMEVVNLDPDVKQQLSKLVSVRLCPPVPG  349

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q  L ++V+PP+PGD SY QF  E + +L++L ++AR+    FN    + CN  +GAMYS
Sbjct  350  QALLDVVVSPPQPGDPSYRQFQGEKQAVLKALAEKARLTESVFNQAPGIRCNPVQGAMYS  409

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LP RA+E AQ LG+APD+++C++LLE TGI  VPGSGFGQKEG +H R TILP  
Sbjct  410  FPRISLPARALERAQELGQAPDMFFCMRLLEETGICVVPGSGFGQKEGTYHFRMTILPPL  469

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            + +  ++E   +F+  F  ++
Sbjct  470  DKLRTVLEKLTQFHARFTKEF  490



>ref|XP_007441688.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Python 
bivittatus]
Length=518

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGP  S+ ++L SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V G
Sbjct  313  EMGPKYSRSVELASFHSISKGFMGECGFRGGYMEVINMDPAVQQQLTKLVSVRLCPPVTG  372

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  MVN P+PGD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+
Sbjct  373  QILLDAMVNQPQPGDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYA  432

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA++ A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +
Sbjct  433  FPRIELPPRAVQDAEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQ  492

Query  220  EDMPAIMESFKKFNDEFMDQYEDHR  146
            E +  +++   +F+ +F  +Y   +
Sbjct  493  EKLEILLQKLSQFHAKFTQEYSQRQ  517



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++L LVS+ +VSKGY+GECG+RGGYFE+T  +    E+IYK+AS++L  N+ GQI   L+
Sbjct  287  EDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLV  346

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK  D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP
Sbjct  347  MNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLP  406

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++
Sbjct  407  QKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVI  466

Query  199  ESFKKFNDEFMDQYED  152
              F  F++ FM +Y D
Sbjct  467  SRFTVFHEAFMSEYRD  482



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K+L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYK+AS++L  N+ GQI   L+
Sbjct  323  KDLSLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLV  382

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +N PK GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP
Sbjct  383  MNTPKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLP  442

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+
Sbjct  443  QKAIEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAII  502

Query  199  ESFKKFNDEFMDQYED  152
               K F++ F+ ++ D
Sbjct  503  ARLKAFHESFLGEFRD  518



>ref|XP_005514471.1| PREDICTED: alanine aminotransferase 2-like, partial [Columba 
livia]
Length=416

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP SK ++L SFH++SKG+ GECG RGGY E+ N+ P   E++ K+ S+ L P V G
Sbjct  221  EMGPPYSKTVELASFHSISKGFMGECGFRGGYMEVINMDPEVKEQLVKLVSVRLCPPVSG  280

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI LG +V+PP+PG+ SY+ F+ E K +L +L  +A++  + FN    + CN  +GAMYS
Sbjct  281  QILLGALVDPPQPGEPSYETFMAEKKAVLSTLAHKAQLTQEIFNKTPGIHCNPVQGAMYS  340

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRAI  A+  G+APD ++C++LLE TGI  VPGSGFGQ+EG FH R TILP  
Sbjct  341  FPRIDLPPRAITAAKEKGQAPDTFFCMRLLEETGICVVPGSGFGQREGTFHFRMTILPPT  400

Query  220  EDMPAIMESFKKFNDE  173
            E +  ++E    F  E
Sbjct  401  EKLKVLLEKLSSFYTE  416



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++L LVS+ +VSKGY+GECG+RGGYFE+T  +    E+IYK+AS++L  N+ GQI   L+
Sbjct  305  EDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLV  364

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK  D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP
Sbjct  365  MNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLP  424

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++
Sbjct  425  QKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVI  484

Query  199  ESFKKFNDEFMDQYED  152
              F  F++ FM +Y D
Sbjct  485  SRFTVFHEAFMSEYRD  500



>ref|XP_008460348.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=513

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -2

Query  742  SKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGL  563
            ++++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L
Sbjct  317  NEDIALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASL  376

Query  562  MVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRL  383
            ++NPPK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I L
Sbjct  377  VMNPPKVGDESFESYSAEKDGILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYL  436

Query  382  PPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI  203
            P +AI+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI
Sbjct  437  PAKAIKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAI  496

Query  202  MESFKKFNDEFMDQYED  152
            +    +F+ +FM+++ D
Sbjct  497  VSRLTEFHKQFMEEFRD  513



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG   + +L++VSFH+VSKG+ GECG+RGGY E+  +T     EIYK+ASI L PNV G
Sbjct  334  DMGGDYA-DLEMVSFHSVSKGFVGECGKRGGYMELNGVTQDVKAEIYKLASIGLCPNVIG  392

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ + LMV PP  G+ S+D +++E   I ESL+KRA ++T+  N+   V CN +EGAMY+
Sbjct  393  QLVVDLMVRPPVAGEQSHDLYLKERDNIYESLKKRANLLTNALNNLEGVTCNPSEGAMYA  452

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQIRLP +A+E A  +GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+E
Sbjct  453  FPQIRLPAKAVEYANSIGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTWHFRTTFLPSE  512

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            E +  + +    F+  FM++Y+
Sbjct  513  EAIEGVCKRIADFHQSFMNKYK  534



>ref|XP_004166923.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like, partial 
[Cucumis sativus]
Length=493

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -2

Query  742  SKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGL  563
            ++++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L
Sbjct  297  NEDIALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASL  356

Query  562  MVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRL  383
            ++NPPK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I L
Sbjct  357  VMNPPKVGDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYL  416

Query  382  PPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI  203
            P +AI+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI
Sbjct  417  PAKAIKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAI  476

Query  202  MESFKKFNDEFMDQYED  152
            +    +F+ +FM+++ D
Sbjct  477  VSRLTEFHKQFMEEFRD  493



>ref|XP_006746371.1| PREDICTED: alanine aminotransferase 1 [Leptonychotes weddellii]
Length=295

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 138/201 (69%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP + + +L SFH+VSKGY GECG RGGY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  94   EMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDPAVQQQMQKLMSVRLCPPVPG  153

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ L ++V+PP P D S+ QF  E + +L  L  +A++    FN    + CN  +GAMYS
Sbjct  154  QVLLSMVVSPPAPSDPSFAQFQAERQVVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYS  213

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+++LPPRA++ AQ LG APD+++C+ LLE TGI  VPGSGFGQ+EG +H R TILP  
Sbjct  214  FPRVQLPPRAVQRAQELGLAPDMFFCMSLLEETGICVVPGSGFGQREGTYHFRMTILPPM  273

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E   +F+ +F  +Y
Sbjct  274  EKLRPLLEKLSQFHAKFTREY  294



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -2

Query  742  SKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGL  563
            ++++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L
Sbjct  332  NEDIALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASL  391

Query  562  MVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRL  383
            ++NPPK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I L
Sbjct  392  VMNPPKVGDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYL  451

Query  382  PPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI  203
            P +AI+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI
Sbjct  452  PAKAIKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAI  511

Query  202  MESFKKFNDEFMDQYED  152
            +    +F+ +FM+++ D
Sbjct  512  VSRLTEFHKQFMEEFRD  528



>gb|EMC77259.1| Alanine aminotransferase 2, partial [Columba livia]
Length=451

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP SK ++L SFH++SKG+ GECG RGGY E+ N+ P   E++ K+ S+ L P V G
Sbjct  256  EMGPPYSKTVELASFHSISKGFMGECGFRGGYMEVINMDPEVKEQLVKLVSVRLCPPVSG  315

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI LG +V+PP+PG+ SY+ F+ E K +L +L  +A++  + FN    + CN  +GAMYS
Sbjct  316  QILLGALVDPPQPGEPSYETFMAEKKAVLSTLAHKAQLTQEIFNKTPGIHCNPVQGAMYS  375

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRAI  A+  G+APD ++C++LLE TGI  VPGSGFGQ+EG FH R TILP  
Sbjct  376  FPRIDLPPRAITAAKEKGQAPDTFFCMRLLEETGICVVPGSGFGQREGTFHFRMTILPPT  435

Query  220  EDMPAIMESFKKFNDE  173
            E +  ++E    F  E
Sbjct  436  EKLKVLLEKLSSFYTE  451



>emb|CCI42079.1| unnamed protein product [Albugo candida]
Length=479

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 140/201 (70%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            D+G   +  ++L+SFH+ SKG+ GECG+RGGY E+ NI+  + E++YK+ SI+L  N+ G
Sbjct  279  DLGAAYNN-VELISFHSTSKGFTGECGRRGGYMELVNISECAREQLYKLMSINLCSNIEG  337

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +GLMVNPPK GD SY ++  +   IL SL++RA  +   FN    V CN TEGA+Y+
Sbjct  338  QLMVGLMVNPPKKGDASYQRYCHQRDSILASLKRRALKLVAAFNKLEGVTCNATEGALYT  397

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+IRL  +A++ A G   APD YYC+++LE TGI  VPGSGFGQK+G FH R+TILP E
Sbjct  398  FPRIRLSEKAVQAASGCNMAPDTYYCIQMLEKTGIVVVPGSGFGQKDGTFHFRSTILPPE  457

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            +++  ++     F+  FM+ +
Sbjct  458  DEVNEVITKMSDFHLNFMNAH  478



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   221 bits (564),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L++
Sbjct  259  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVM  318

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  319  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  378

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  379  KAIGAAQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIIS  438

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD+Y +
Sbjct  439  RFKEFHEKFMDEYRE  453



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -2

Query  742  SKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGL  563
            ++++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L
Sbjct  339  NEDIALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASL  398

Query  562  MVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRL  383
            ++NPPK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I L
Sbjct  399  VMNPPKVGDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYL  458

Query  382  PPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI  203
            P +AI+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI
Sbjct  459  PAKAIKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAI  518

Query  202  MESFKKFNDEFMDQYED  152
            +    +F+ +FM+++ D
Sbjct  519  VSRLTEFHKQFMEEFRD  535



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 139/197 (71%), Gaps = 0/197 (0%)
 Frame = -2

Query  742  SKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGL  563
            ++++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L
Sbjct  334  NEDIALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASL  393

Query  562  MVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRL  383
            ++NPPK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I L
Sbjct  394  VMNPPKVGDESFESYSAEKDGILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYL  453

Query  382  PPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI  203
            P +AI+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI
Sbjct  454  PAKAIKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAI  513

Query  202  MESFKKFNDEFMDQYED  152
            +    +F+ +FM+++ D
Sbjct  514  VSRLTEFHKQFMEEFRD  530



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score =   222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L+
Sbjct  352  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLV  411

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY+ +  E   IL SL +RA+ + + FN    V CN  EGAMY FP+I+LP
Sbjct  412  MNPPKVGDESYESYSAEKDAILSSLARRAKKLEEAFNGLEGVTCNRAEGAMYLFPRIQLP  471

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ +  APD +Y  +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  472  KKAIEAAKAVNTAPDAFYARRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDRIPAII  531

Query  199  ESFKKFNDEFMDQYED  152
                +F+  FMD++ D
Sbjct  532  SRLTEFHKGFMDEFRD  547



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 133/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  293  KDISLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLV  352

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP
Sbjct  353  MNPPKDGDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLP  412

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++
Sbjct  413  VKAIKAAEAANTVPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVI  472

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FM++Y D
Sbjct  473  SRLTDFHKAFMNEYRD  488



>ref|XP_004155894.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=488

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 133/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  293  KDISLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLV  352

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP
Sbjct  353  MNPPKDGDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLP  412

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++
Sbjct  413  VKAIKAAEAANTVPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVI  472

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FM++Y D
Sbjct  473  SRLTDFHKAFMNEYRD  488



>ref|XP_009557985.1| PREDICTED: alanine aminotransferase 2-like [Cuculus canorus]
Length=422

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP S+ ++L SFH+VSKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  221  EMGPPYSEVVELASFHSVSKGFMGECGFRGGYVEVVNMDPEVKQQLAKLVSVRLCPPVPG  280

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  ++NPP+PG+ SY+ F++E + +L +L  +A +  + FN    + CN  +GAMYS
Sbjct  281  QILLDTVINPPQPGEPSYELFMKEKQEVLSTLAHKAHLTQEIFNRTPGIRCNPVQGAMYS  340

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA+  A+  G+APD+++C++LLE TGI  VPGSGFGQ++G FH R TILP  
Sbjct  341  FPRIELPPRAVAAAEAQGQAPDMFFCIRLLEETGICVVPGSGFGQRQGTFHFRMTILPPT  400

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E    F  +F+  Y
Sbjct  401  EKLQILLEKLSTFYTKFIKDY  421



>ref|XP_008157904.1| PREDICTED: alanine aminotransferase 1 [Eptesicus fuscus]
Length=496

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP S + +L SFH+VSKGY GECG RGGY E+ N+ P   +++ K+ S+ L P +PG
Sbjct  295  EMGPPYSTQQELASFHSVSKGYMGECGLRGGYVEVVNMDPAVQQQMQKLMSVRLCPPLPG  354

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ L ++V+PP+P D S+ QF  E + +L  L  +A++    FN    + CN  +GAMYS
Sbjct  355  QVVLDMVVSPPEPSDPSFTQFQAEKQAVLAQLAAKAKLTEQVFNEAPGIRCNPVQGAMYS  414

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I+LPPRAI  A+ LG APD+++CL+LLE TGI  VPGSGFGQ+EG +H R TILPA 
Sbjct  415  FPRIQLPPRAIRRAKELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPAM  474

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E   +F+ +F  +Y
Sbjct  475  EKLRPLLEKLSQFHAKFTREY  495



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYK+AS++L  N+ GQI   L+
Sbjct  347  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKLASVNLCSNISGQILASLV  406

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY+ ++ E   IL SL +RA+ + D FNS + V CN  EGAMY FP I LP
Sbjct  407  MNPPKVGDESYESYLAEKDAILSSLARRAKQLEDAFNSLKGVTCNRAEGAMYLFPCIDLP  466

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+ +  APD +Y  +LL ATGI  VPGSGF Q  G +H R TILP E+ +PAI+
Sbjct  467  KKAIEAAKAVSTAPDAFYARRLLNATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIV  526

Query  199  ESFKKFNDEFMDQYED  152
                KF+  FMD++ D
Sbjct  527  SRLTKFHKGFMDEFCD  542



>gb|KFO75258.1| Alanine aminotransferase 2, partial [Cuculus canorus]
Length=442

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP S+ ++L SFH+VSKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  241  EMGPPYSEVVELASFHSVSKGFMGECGFRGGYVEVVNMDPEVKQQLAKLVSVRLCPPVPG  300

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L  ++NPP+PG+ SY+ F++E + +L +L  +A +  + FN    + CN  +GAMYS
Sbjct  301  QILLDTVINPPQPGEPSYELFMKEKQEVLSTLAHKAHLTQEIFNRTPGIRCNPVQGAMYS  360

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I LPPRA+  A+  G+APD+++C++LLE TGI  VPGSGFGQ++G FH R TILP  
Sbjct  361  FPRIELPPRAVAAAEAQGQAPDMFFCIRLLEETGICVVPGSGFGQRQGTFHFRMTILPPT  420

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E    F  +F+  Y
Sbjct  421  EKLQILLEKLSTFYTKFIKDY  441



>ref|XP_006342897.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=545

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 138/194 (71%), Gaps = 0/194 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKG++GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L+
Sbjct  350  KDISLVSFQSVSKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLV  409

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ F  E +GIL SL +RA+ + D F++   V CN  EGAMY FP+I LP
Sbjct  410  MSPPKVGDESYESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLP  469

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +Y  +LL ATGI  VPGSGFGQ+ G +H R TILP EE +PAI+
Sbjct  470  NKAIKAAEEAKTAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIV  529

Query  199  ESFKKFNDEFMDQY  158
                +F+ +FMD++
Sbjct  530  SRLTEFHKQFMDEF  543



>ref|XP_006300438.1| hypothetical protein CARUB_v10020102mg [Capsella rubella]
 gb|EOA33336.1| hypothetical protein CARUB_v10020102mg [Capsella rubella]
Length=543

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  T    E+IYK+AS++L  N+ GQI   L+
Sbjct  348  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLV  407

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP++ LP
Sbjct  408  MSPPKPGDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRMNLP  467

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TIL  E+ +PAI+
Sbjct  468  QKAIEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILSQEDKIPAIV  527

Query  199  ESFKKFNDEFMDQYED  152
                +F+  FMD++ D
Sbjct  528  NRLTEFHKSFMDEFRD  543



>ref|XP_006426797.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40037.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=529

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L+
Sbjct  334  KDISLVSFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLV  393

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP
Sbjct  394  MSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLP  453

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  454  EKAIKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  513

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ +
Sbjct  514  TRLTDFHKSFMDKFRN  529



>ref|XP_006426798.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40038.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=533

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L+
Sbjct  338  KDISLVSFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLV  397

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP
Sbjct  398  MSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLP  457

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  458  EKAIKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  517

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ +
Sbjct  518  TRLTDFHKSFMDKFRN  533



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++L LVS+ +VSKGY+GECG+RGGY E+T  +    E+IYK++S++L  N+ GQI   L+
Sbjct  286  EDLPLVSYQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKISSVNLCSNITGQILASLV  345

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SY  +  E   IL SL +RA+ + D FN+   + CN  EGAMY FP+I LP
Sbjct  346  MNPPKAGDESYASYQAEKDRILTSLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLP  405

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A    KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  406  QKAIDAANAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAII  465

Query  199  ESFKKFNDEFMDQYED  152
              FK F++ FM ++ D
Sbjct  466  SRFKVFHEAFMAEHRD  481



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            ++ LVS  + SKG++GECG+RGGY E+  + P    E+YK+AS+ L PN+ GQ+ +GL++
Sbjct  269  DIPLVSMQSTSKGFYGECGRRGGYMEVCGLDPDVKAELYKLASVGLCPNLSGQVLMGLVM  328

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            +PPKPGD SY+ +  E   IL SL++RA  +  G N+   V CN  +GAMY+FP++ LP 
Sbjct  329  SPPKPGDPSYELYAAERDAILSSLKRRALKLVSGLNALEGVTCNEAQGAMYAFPKVSLPE  388

Query  376  RAIETAQGLGK-APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
            + +  A   GK APD  YC+KLLEATGI  VPGSGFGQ EG +H RTT LP+EED+  ++
Sbjct  389  KFVAEATASGKMAPDALYCMKLLEATGIVVVPGSGFGQVEGTWHFRTTFLPSEEDIGGVV  448

Query  199  ESFKKFNDEFMDQY  158
            E   KF+ EFMD Y
Sbjct  449  EKLAKFHAEFMDTY  462



>gb|EYU45916.1| hypothetical protein MIMGU_mgv1a005454mg [Erythranthe guttata]
Length=483

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 135/194 (70%), Gaps = 0/194 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +P   E+IYK+AS++L  N+ GQI   L+
Sbjct  288  KDIALVSFQSVSKGYYGECGKRGGYMEITGFSPEIREQIYKLASVNLCSNISGQILASLV  347

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD SYD +  E   IL SL +RA+ + D FN    V CN  EGAMY FP+I LP
Sbjct  348  MNPPKVGDESYDSYFAEKNAILSSLARRAQKLEDAFNGLEGVSCNRAEGAMYLFPRIVLP  407

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +A+E A+    APD +Y  +LL ATGI  VPGSGFGQ +G +H+R TILP E+ + AI+
Sbjct  408  NKALEAAKEAKTAPDAFYARRLLNATGIVVVPGSGFGQVDGTWHIRCTILPQEDRISAII  467

Query  199  ESFKKFNDEFMDQY  158
                KF+ EFMD++
Sbjct  468  TRLTKFHTEFMDEF  481



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+
Sbjct  287  KDIHLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLV  346

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP
Sbjct  347  MSPPKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLP  406

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  407  KKAIKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIV  466

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ D
Sbjct  467  TRLTDFHKRFMDEFRD  482



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 135/195 (69%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            ++ LVSF +VSKGY GECG+RGGY E+T  +P   E+IYKV+S++L  N+ GQI   L++
Sbjct  337  DISLVSFQSVSKGYHGECGKRGGYMEVTGFSPDVREQIYKVSSVNLCSNITGQILASLVM  396

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            +PPK GD SY+ F+ E   IL SL  RA+ + +  N    V CN  EGAMY FPQIRLP 
Sbjct  397  SPPKVGDESYESFMAEKGSILSSLATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPK  456

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AIE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  457  KAIEAAEAENTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVT  516

Query  196  SFKKFNDEFMDQYED  152
               +F+++FMD++ D
Sbjct  517  RLTEFHEKFMDEFRD  531



>gb|AIT69922.1| alanine transaminase [Sargassum fusiforme]
Length=501

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 133/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            + LQLVSFH+ SKGY+GECG RGGY E+  I P    E+YK+AS+SL  N  GQ+ +G+M
Sbjct  306  ERLQLVSFHSTSKGYFGECGLRGGYMELHGIGPEVRAEVYKLASLSLCSNTVGQLAMGMM  365

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            VNPPKPGD SY  F +E   IL SLR+R+ ++    N    + CN  +GA+Y+FP+IRLP
Sbjct  366  VNPPKPGDPSYQTFEKERGDILSSLRRRSMMVHKALNEMEGITCNKADGALYAFPRIRLP  425

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +A++ A   G  PD YYCLK+L+ TGI  VPGSGFGQ+EG  H RTT LP+E+ M   +
Sbjct  426  NKAVQAAVDKGIPPDEYYCLKILDETGIILVPGSGFGQEEGTLHFRTTFLPSEDTMEETL  485

Query  199  ESFKKFNDEFMDQYED  152
            +     + EFMD + D
Sbjct  486  KILASAHAEFMDDHRD  501



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  745  ISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLG  566
            ++ +++L SFH+ SKG+ GECG+RGGY E+ N     +EE+YK+ SI+L  N+ GQ+ + 
Sbjct  290  MNSDVELASFHSTSKGFTGECGRRGGYMELVNFDHDVMEELYKLVSINLCSNIEGQLMVA  349

Query  565  LMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIR  386
            LM NPPKPGD SYD +V +   I+ SL++RA  +   FN    V CN TEGAMY+FP+I 
Sbjct  350  LMTNPPKPGDASYDLYVSQRDEIVNSLKRRALKLVASFNELEGVTCNATEGAMYTFPRIT  409

Query  385  LPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPA  206
            +P +A+  A+ +G+APD +Y   LL ATGI  VPGSGFGQ++G FH R+TILP EE +  
Sbjct  410  VPAKAVAEAKKVGQAPDAFYAFALLNATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDE  469

Query  205  IMESFKKFNDEFMDQY  158
            ++    KF+ +FM++Y
Sbjct  470  VIAKTAKFHADFMNKY  485



>ref|XP_007024768.1| Alanine aminotransferase 2 [Theobroma cacao]
 gb|EOY27390.1| Alanine aminotransferase 2 [Theobroma cacao]
Length=539

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 133/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQ+   L+
Sbjct  344  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREQIYKVASVNLCSNISGQVLASLV  403

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL +L +RA+ + D FN    V CN  EGAMY FP+I LP
Sbjct  404  MSPPKVGDESYESYSAERDGILSALARRAKTLEDAFNKLEGVTCNKAEGAMYLFPRIHLP  463

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ AQ    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  464  EKAIKAAQVAKTAPDAFYCRRLLSATGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIV  523

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ D
Sbjct  524  THLTDFHKSFMDEFRD  539



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            +L LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L++
Sbjct  344  DLPLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVM  403

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            NPPK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP 
Sbjct  404  NPPKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQ  463

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI  AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  464  KAIGAAQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIIS  523

Query  196  SFKKFNDEFMDQYED  152
             FK+F+++FMD+Y +
Sbjct  524  RFKEFHEKFMDEYRE  538



>gb|AET06148.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=484

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY GECG+RGGY E+T  +P   E+IYKVAS++L  N+ GQI   L+
Sbjct  289  KDISLVSFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLV  348

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD S++ +  E  GIL SL +RA+ + D FN+   V CN  EGAMY FP+I L 
Sbjct  349  MNPPKVGDESFESYSAEKNGILSSLARRAKALEDAFNNLEGVTCNKAEGAMYLFPRIHLS  408

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+    APD +Y  +LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+
Sbjct  409  QKAIKAAETAKTAPDAFYAKRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAII  468

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FM ++ D
Sbjct  469  TRLTDFHQAFMAEFRD  484



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T       +++YKVAS++L  N+ GQI   L+
Sbjct  134  KDICLVSFQSVSKGYYGECGRRGGYMEVTGFDNNIKDQLYKVASVNLCSNISGQILASLV  193

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK GD S++ F  E  GIL SL +RA+ + D  N    V CN  EGAMY FP+I LP
Sbjct  194  MNPPKSGDESFEMFFAERDGILSSLARRAKTLVDALNQLEGVTCNEAEGAMYVFPRIHLP  253

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+ +   PD +Y  +LLEATGI TVPGSGFGQ  G +H R+TILP E+ +P I+
Sbjct  254  QQAIKAAEAVNMVPDAFYSQRLLEATGIVTVPGSGFGQVPGTWHFRSTILPPEDKIPTIV  313

Query  199  ESFKKFNDEFMDQYED  152
                 F+ +FM+++ D
Sbjct  314  SRMTTFHQKFMEEFHD  329



>emb|CDJ93113.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=505

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 140/202 (69%), Gaps = 1/202 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MG P + +++L SFH+VSKGY GECG RGGY E  N+ P       K+ S  L   + G
Sbjct  305  EMGAPYN-QMELASFHSVSKGYMGECGMRGGYVEFFNLDPEVYVLFKKMISAKLCSTILG  363

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +  +VNPPKPGD SYDQ+++E   +L SL++RA ++ + + S   + CN  +GAMY+
Sbjct  364  QVMMDALVNPPKPGDPSYDQWLKEKNAVLASLKERATLVKEAYGSIEGIKCNEVQGAMYA  423

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FPQ+ LPPRA+E A+ L   PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  
Sbjct  424  FPQLMLPPRAVEKARSLNMEPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQT  483

Query  220  EDMPAIMESFKKFNDEFMDQYE  155
            E M  ++E FK F+ +FM++Y+
Sbjct  484  EMMKDMLERFKSFHTKFMEEYK  505



>ref|XP_006465804.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Citrus 
sinensis]
Length=533

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  338  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLV  397

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP
Sbjct  398  MSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLP  457

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  458  EKAIKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  517

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ +
Sbjct  518  TRLTDFHKNFMDKFRN  533



>gb|KDO53767.1| hypothetical protein CISIN_1g009517mg [Citrus sinensis]
Length=533

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            K++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  338  KDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLV  397

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP
Sbjct  398  MSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLP  457

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+
Sbjct  458  EKAIKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIV  517

Query  199  ESFKKFNDEFMDQYED  152
                 F+  FMD++ +
Sbjct  518  TRLTDFHKNFMDKFRN  533



>ref|XP_004345426.2| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=489

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGP  S  ++L+SFH+VSKG+ GECG+RGGY EM  I     E+IYKVASISL PNV GQ
Sbjct  289  MGPEFSN-VELISFHSVSKGFIGECGKRGGYMEMIGIDAYVREQIYKVASISLCPNVQGQ  347

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            + + LMVNPPK G+ SY+ + RE   IL SL+ R+  + D FN    V C   +GAMY+F
Sbjct  348  VIVDLMVNPPKEGEPSYELYARERDQILGSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTF  407

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLP +A+E A+  GKAPD +YC+ LLEATG+S VPG+GF Q+EG +H R T LP ++
Sbjct  408  PQIRLPKKAVEAAKAAGKAPDSFYCMALLEATGVSVVPGTGFKQREGTYHFRCTFLPPQD  467

Query  217  DMPAIMESFKKFNDEFMDQYED  152
              PA  ++  +F++EFM +Y+D
Sbjct  468  TFPAFTDAIVRFHNEFMAKYKD  489



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 135/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
             ++ LVSF +VSKGY GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  341  NDITLVSFQSVSKGYHGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLV  400

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPK GD SY+ F  E + ILESL +RA+ + D FN    V CN  EGAMY FPQIRL 
Sbjct  401  MSPPKVGDESYESFNAEKENILESLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLS  460

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A     APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  461  QKAIKAAGDANTAPDNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPPEEKIPAIV  520

Query  199  ESFKKFNDEFMDQYED  152
                +F+++FMD++ D
Sbjct  521  TRLTEFHEKFMDEFRD  536



>ref|XP_010096539.1| Alanine aminotransferase 2 [Morus notabilis]
 gb|EXB64659.1| Alanine aminotransferase 2 [Morus notabilis]
Length=537

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 0/195 (0%)
 Frame = -2

Query  736  ELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLMV  557
            ++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L++
Sbjct  343  DIALVSFQSVSKGYYGECGKRGGYMEVTGFSADIREQIYKVASVNLCSNISGQILASLVM  402

Query  556  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  377
            +PPK GD SY+ +  E  GIL SL +RA+ + D FN+   + CN  EGAMY FP+I LP 
Sbjct  403  SPPKVGDESYESYRAERDGILSSLARRAKTLEDAFNNLEGITCNKAEGAMYLFPRINLPQ  462

Query  376  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  197
            +AI+ A+ + +APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+ 
Sbjct  463  KAIKAAEAVKEAPDAFYCHRLLNATGIVFVPGSGFGQAPGTWHFRCTILPQEDKIPAIVS  522

Query  196  SFKKFNDEFMDQYED  152
                F+  FMD++ D
Sbjct  523  RLTDFHKGFMDEFRD  537



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMGP     ++L SFH+ SKG+ GECG+RGGY E+ N    ++E++YK+ SI+L  N+ G
Sbjct  289  DMGPDYDC-VELASFHSTSKGFTGECGRRGGYMELVNFNADAMEQLYKLVSINLCSNIEG  347

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ + LM NPP  GD SY+ ++ +  GIL SL++RA  +   FN    V CN  EGAMY+
Sbjct  348  QLMVALMTNPPVEGDESYELYIAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYT  407

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I +P +A+E A   G APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP E
Sbjct  408  FPRITVPEKAVEEATKRGVAPDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPE  467

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E   KF+ EFMD Y
Sbjct  468  EAIDEVIEKTAKFHAEFMDLY  488



>ref|XP_006828623.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
 gb|ERM96039.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
Length=405

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 136/196 (69%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            +++ LVSF +VSKGY+GECG+RGGY E+T  +    E+IYKVAS++L  N+ GQI   L+
Sbjct  210  EDIALVSFQSVSKGYYGECGKRGGYMEVTGFSRDVKEQIYKVASVNLCSNISGQILASLV  269

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            ++PPKPGD S++ F  E  GIL SL +RA+ +   FNS   V CN  EGAMY FP++ LP
Sbjct  270  MSPPKPGDESFESFTAERDGILSSLARRAKALEKAFNSLEGVTCNRAEGAMYLFPRLHLP  329

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AI+ A+ L  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ + A++
Sbjct  330  AKAIKAAEALNVAPDAYYTHRLLDATGIVAVPGSGFGQVPGTWHVRYTILPQEDKIAAVV  389

Query  199  ESFKKFNDEFMDQYED  152
              F  F++  + ++ D
Sbjct  390  SKFTAFHEALIAEFRD  405



>ref|XP_006634237.1| PREDICTED: alanine aminotransferase 2-like [Lepisosteus oculatus]
Length=489

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGP  S  ++L SFH+ SK Y GECG RGGY E+ N+ P    ++ K+ S+ L P VPG
Sbjct  288  EMGPEFSNTVELASFHSTSKCYMGECGFRGGYMEVINLDPAVKAQLLKLVSVRLCPPVPG  347

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q  + L+VNPP+ G+ S+ QF++E   +L SL +RAR++    NS   + CN  +GAMYS
Sbjct  348  QALMDLVVNPPQEGEPSHPQFIKERTAVLSSLAERARLVEQLLNSIPGISCNPVQGAMYS  407

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I +P RAI+ AQ +G+APD++YCL+LLE TGI  VPGSGFGQK+G +H R TILP  
Sbjct  408  FPRINIPERAIKEAQAMGQAPDMFYCLRLLEETGICLVPGSGFGQKDGTYHFRMTILPPT  467

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++   K+F+  F  +Y
Sbjct  468  EKLEVLLSKLKEFHQRFTREY  488



>emb|CEI91975.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 138/198 (70%), Gaps = 0/198 (0%)
 Frame = -2

Query  751  PPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIF  572
            P + + L+LVSFH++SKG  GECG+RGGYFE  N+  + +E+IYK+AS+SL PNV GQI 
Sbjct  292  PEVRESLELVSFHSISKGMIGECGRRGGYFECVNLDSQVLEQIYKMASVSLCPNVHGQIL  351

Query  571  LGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQ  392
            + LM NPPKPGD SY+ + +E + I ESLR+R++ +   FN    V C   +G+MY FPQ
Sbjct  352  VDLMCNPPKPGDPSYESYKQEIESIYESLRRRSKKLEQVFNRMEGVTCQPAQGSMYLFPQ  411

Query  391  IRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDM  212
            I LP +A+E A+ L  A D YY L +LEATG+  +PGSGFGQKEG +H R+T LP E   
Sbjct  412  ITLPSKAVEKAKELDMAADAYYSLAMLEATGVCVIPGSGFGQKEGTWHFRSTFLPEEHLF  471

Query  211  PAIMESFKKFNDEFMDQY  158
                 + +KF+ +F++++
Sbjct  472  DEFCSALEKFHKDFIEKH  489



>ref|XP_008120969.1| PREDICTED: alanine aminotransferase 1-like [Anolis carolinensis]
Length=504

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGP  S  L+L SFH++SKG+ GECG RGGY E+ N+ P   +++ K+ S+ L P V G
Sbjct  288  EMGPKYSDSLELASFHSISKGFMGECGFRGGYMEIINMDPAVQQQLTKLVSVRLCPPVTG  347

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            QI L ++VN P+ GD SY QF +E + +L +L K+A +    FN    + CN  +GAMY+
Sbjct  348  QILLDVVVNQPQQGDPSYQQFSQEKQAVLGALAKKAHLTEQTFNKAPGIHCNPVQGAMYA  407

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+I+LPPRA++ A+  G+APD+++CL+LLE TGI  VPGSGFGQKEG FH R TILP  
Sbjct  408  FPRIQLPPRAVQEAKAQGQAPDMFFCLRLLEETGICVVPGSGFGQKEGTFHFRMTILPPM  467

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  +++   +F+ +F  +Y
Sbjct  468  EKLEVVLQKLSQFHAKFTQEY  488



>gb|KJE95383.1| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=553

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -2

Query  757  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQ  578
            MGP  S  ++L+SFH+VSKG+ GECG+RGGY EM  I     E+IYKVASISL PNV GQ
Sbjct  353  MGPEFSN-VELISFHSVSKGFIGECGKRGGYMEMIGIDAYVREQIYKVASISLCPNVQGQ  411

Query  577  IFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  398
            + + LMVNPPK G+ SY+ + RE   IL SL+ R+  + D FN    V C   +GAMY+F
Sbjct  412  VIVDLMVNPPKEGEPSYELYARERDQILGSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTF  471

Query  397  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  218
            PQIRLP +A+E A+  GKAPD +YC+ LLEATG+S VPG+GF Q+EG +H R T LP ++
Sbjct  472  PQIRLPKKAVEAAKAAGKAPDSFYCMALLEATGVSVVPGTGFKQREGTYHFRCTFLPPQD  531

Query  217  DMPAIMESFKKFNDEFMDQYED  152
              PA  ++  +F++EFM +Y+D
Sbjct  532  TFPAFTDAIVRFHNEFMAKYKD  553



>gb|ETK88933.1| hypothetical protein L915_06890 [Phytophthora parasitica]
Length=266

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 143/204 (70%), Gaps = 1/204 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            DMG     +++L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ G
Sbjct  59   DMGKEYD-DVELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEG  117

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ +G+M NPP+ GD SY +++ +  G L SL++RA  +   FN+   V CN TEGA+Y+
Sbjct  118  QLMVGMMTNPPQSGDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGVTCNETEGALYT  177

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP I LP +A+E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP E
Sbjct  178  FPSISLPAKAVEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPE  237

Query  220  EDMPAIMESFKKFNDEFMDQYEDH  149
            E +  ++E   KF+ +FMD+Y ++
Sbjct  238  EAVDEVIEKTAKFHAKFMDKYREN  261



>gb|EMT23015.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=508

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 0/196 (0%)
 Frame = -2

Query  739  KELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIFLGLM  560
            ++L LVS+ +VSKGY+GECG+RGGY E+T  +    E+IYK+AS++L  N+ GQI   L+
Sbjct  313  EDLPLVSYQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKIASVNLCSNITGQILASLV  372

Query  559  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  380
            +NPPK  D SY  +  E  GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP
Sbjct  373  MNPPKASDESYASYKAEKDGILASLARRAKALEVAFSKLEGITCNKAEGAMYLFPQICLP  432

Query  379  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  200
             +AIE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+
Sbjct  433  QKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAII  492

Query  199  ESFKKFNDEFMDQYED  152
              F  F++ FM +Y D
Sbjct  493  SRFTVFHETFMAEYRD  508



>emb|CEG73189.1| Putative Alanine transaminase [Rhizopus microsporus]
 emb|CEI95194.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 138/198 (70%), Gaps = 0/198 (0%)
 Frame = -2

Query  751  PPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPGQIF  572
            P + + L+LVSFH++SKG  GECG+RGGYFE  N+  + +E+IYK+AS+SL PNV GQI 
Sbjct  292  PEVRESLELVSFHSISKGMIGECGRRGGYFECVNLDSQVLEQIYKMASVSLCPNVHGQIL  351

Query  571  LGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQ  392
            + LM NPPKPGD SY+ + +E + I ESLR+R++ +   FN    V C   +G+MY FPQ
Sbjct  352  VDLMCNPPKPGDPSYESYKQEIESIYESLRRRSKKLEQVFNRMEGVTCQPAQGSMYLFPQ  411

Query  391  IRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDM  212
            I LP +A+E A+ L  A D YY L +LEATG+  +PGSGFGQKEG +H R+T LP E   
Sbjct  412  ITLPSKAVEKAKELDMAADAYYSLAMLEATGVCVIPGSGFGQKEGTWHFRSTFLPEEHLF  471

Query  211  PAIMESFKKFNDEFMDQY  158
                 + +KF+ +F++++
Sbjct  472  DEFCGALEKFHKDFIEKH  489



>ref|XP_004400797.1| PREDICTED: alanine aminotransferase 1 [Odobenus rosmarus divergens]
Length=496

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = -2

Query  760  DMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNITPRSVEEIYKVASISLSPNVPG  581
            +MGPP + + +L SFH+VSKGY GECG RGGY E+ N+ P   +++ K+ S+ L P VPG
Sbjct  295  EMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDPAVQQQMQKLMSVRLCPPVPG  354

Query  580  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  401
            Q+ L ++V+PP P D S+ QF  E + +L  L  +A++    FN    + CN  +GAMYS
Sbjct  355  QVLLSMVVSPPAPSDPSFAQFQAERQVVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYS  414

Query  400  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  221
            FP+++LPPRA++ AQ LG APD+++C++LLE TGI  VPGSGFGQ+EG +H R TILP  
Sbjct  415  FPRVQLPPRAVQRAQELGLAPDMFFCMRLLEETGICVVPGSGFGQREGTYHFRMTILPPM  474

Query  220  EDMPAIMESFKKFNDEFMDQY  158
            E +  ++E   +F+ +F  +Y
Sbjct  475  EKLRPLLEKLSQFHAKFTREY  495



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470