BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051F15

Length=786
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601214.1|  PREDICTED: protein EXECUTER 1, chloroplastic       302   2e-94   Nicotiana tomentosiformis
ref|XP_009783985.1|  PREDICTED: protein EXECUTER 1, chloroplastic       300   2e-93   Nicotiana sylvestris
ref|XP_004241496.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    293   8e-91   Solanum lycopersicum
emb|CDP12382.1|  unnamed protein product                                293   1e-90   Coffea canephora [robusta coffee]
ref|XP_011071839.1|  PREDICTED: protein EXECUTER 1, chloroplastic       292   3e-90   Sesamum indicum [beniseed]
gb|EYU42561.1|  hypothetical protein MIMGU_mgv1a002602mg                288   9e-89   Erythranthe guttata [common monkey flower]
gb|EYU17659.1|  hypothetical protein MIMGU_mgv1a002899mg                285   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_008453096.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    281   3e-87   
ref|XP_002318039.2|  hypothetical protein POPTR_0012s08110g             284   3e-87   
ref|XP_011044311.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    282   1e-86   Populus euphratica
ref|XP_004298937.1|  PREDICTED: protein EXECUTER 2, chloroplastic       281   2e-86   Fragaria vesca subsp. vesca
ref|XP_002511410.1|  EXECUTER1 protein, chloroplast precursor, pu...    281   3e-86   Ricinus communis
ref|XP_007210299.1|  hypothetical protein PRUPE_ppa002543mg             281   3e-86   Prunus persica
ref|XP_008239756.1|  PREDICTED: LOW QUALITY PROTEIN: protein EXEC...    281   3e-86   
ref|XP_011028578.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    281   3e-86   Populus euphratica
ref|XP_008453095.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    281   4e-86   Cucumis melo [Oriental melon]
ref|XP_002321589.2|  hypothetical protein POPTR_0015s08620g             280   6e-86   Populus trichocarpa [western balsam poplar]
ref|XP_004138282.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    275   4e-84   
ref|XP_006439803.1|  hypothetical protein CICLE_v10019209mg             271   6e-84   
ref|XP_004166493.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    275   1e-83   
ref|XP_002279734.3|  PREDICTED: protein EXECUTER 1, chloroplastic       275   1e-83   Vitis vinifera
gb|KGN63586.1|  hypothetical protein Csa_1G004980                       275   1e-83   Cucumis sativus [cucumbers]
ref|XP_010037568.1|  PREDICTED: protein EXECUTER 1, chloroplastic       274   1e-83   Eucalyptus grandis [rose gum]
ref|XP_008374445.1|  PREDICTED: protein EXECUTER 1, chloroplastic       274   2e-83   
ref|XP_004501935.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    273   3e-83   Cicer arietinum [garbanzo]
ref|XP_010536627.1|  PREDICTED: protein EXECUTER 1, chloroplastic       273   4e-83   Tarenaya hassleriana [spider flower]
ref|XP_010251274.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    272   8e-83   Nelumbo nucifera [Indian lotus]
gb|KDP31109.1|  hypothetical protein JCGZ_11485                         273   9e-83   Jatropha curcas
ref|XP_006439802.1|  hypothetical protein CICLE_v10019209mg             272   1e-82   
ref|XP_006476766.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    272   1e-82   Citrus sinensis [apfelsine]
ref|XP_009363034.1|  PREDICTED: protein EXECUTER 1, chloroplastic       272   1e-82   
ref|XP_008787983.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    260   3e-82   Phoenix dactylifera
ref|XP_003522373.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    270   6e-82   Glycine max [soybeans]
ref|XP_003528152.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    269   1e-81   Glycine max [soybeans]
ref|XP_007138087.1|  hypothetical protein PHAVU_009G179300g             269   1e-81   Phaseolus vulgaris [French bean]
gb|KJB53139.1|  hypothetical protein B456_008G294800                    265   3e-81   Gossypium raimondii
ref|XP_003601283.1|  Protein EXECUTER                                   267   5e-81   Medicago truncatula
ref|XP_010940041.1|  PREDICTED: protein EXECUTER 1, chloroplastic       266   1e-80   Elaeis guineensis
ref|XP_007036192.1|  EXECUTER1 protein, chloroplast, putative iso...    266   2e-80   
ref|XP_010678752.1|  PREDICTED: protein EXECUTER 1, chloroplastic       267   2e-80   
gb|KJB53138.1|  hypothetical protein B456_008G294800                    266   3e-80   Gossypium raimondii
ref|XP_008367525.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    265   7e-80   
ref|XP_010243014.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    263   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006304413.1|  hypothetical protein CARUB_v10010978mg             261   8e-79   Capsella rubella
ref|XP_009380345.1|  PREDICTED: protein EXECUTER 1, chloroplastic       261   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY11792.1|  BnaC03g57860D                                          260   2e-78   Brassica napus [oilseed rape]
ref|XP_002893472.1|  predicted protein                                  260   4e-78   Arabidopsis lyrata subsp. lyrata
emb|CDX90093.1|  BnaA08g18910D                                          258   2e-77   
ref|XP_006415752.1|  hypothetical protein EUTSA_v10007043mg             258   3e-77   Eutrema salsugineum [saltwater cress]
ref|XP_009109798.1|  PREDICTED: protein EXECUTER 1, chloroplastic       257   4e-77   Brassica rapa
ref|NP_564287.1|  protein EXECUTER 2                                    257   6e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KDO69684.1|  hypothetical protein CISIN_1g0061462mg                  240   3e-76   Citrus sinensis [apfelsine]
ref|NP_001041785.1|  Os01g0107900                                       237   1e-73   
tpg|DAA53815.1|  TPA: hypothetical protein ZEAMMB73_854553              234   3e-72   
ref|XP_010499237.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    243   7e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010460515.1|  PREDICTED: protein EXECUTER 1, chloroplastic       243   1e-71   Camelina sativa [gold-of-pleasure]
dbj|BAJ99356.1|  predicted protein                                      235   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002455331.1|  hypothetical protein SORBIDRAFT_03g008590          232   3e-71   
ref|XP_006645432.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    240   4e-71   
ref|XP_010478095.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    241   6e-71   Camelina sativa [gold-of-pleasure]
gb|EAY72221.1|  hypothetical protein OsI_00074                          240   6e-71   Oryza sativa Indica Group [Indian rice]
sp|Q657X6.1|EXEC2_ORYSJ  RecName: Full=Protein EXECUTER 2, chloro...    240   9e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565224.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    238   4e-70   Brachypodium distachyon [annual false brome]
ref|XP_010230337.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    238   5e-70   Brachypodium distachyon [annual false brome]
ref|NP_001182951.1|  hypothetical protein                               237   1e-69   Zea mays [maize]
ref|XP_009415819.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    238   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146198.1|  hypothetical protein                               236   3e-69   Zea mays [maize]
ref|XP_004967955.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    234   2e-68   Setaria italica
ref|XP_010322554.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    231   3e-67   Solanum lycopersicum
gb|KFK28712.1|  hypothetical protein AALP_AA7G037200                    223   4e-64   Arabis alpina [alpine rockcress]
emb|CAN68093.1|  hypothetical protein VITISV_012750                     203   3e-62   Vitis vinifera
gb|KCW49291.1|  hypothetical protein EUGRSUZ_K02848                     216   1e-61   Eucalyptus grandis [rose gum]
ref|XP_001758844.1|  predicted protein                                  211   5e-60   
ref|XP_001764388.1|  predicted protein                                  211   7e-60   
gb|KDO37022.1|  hypothetical protein CISIN_1g033722mg                   195   2e-59   Citrus sinensis [apfelsine]
ref|XP_006844970.1|  hypothetical protein AMTR_s00058p00181770          208   9e-59   
gb|KDO37020.1|  hypothetical protein CISIN_1g033722mg                   191   2e-57   Citrus sinensis [apfelsine]
gb|KDO69688.1|  hypothetical protein CISIN_1g0061462mg                  184   6e-55   Citrus sinensis [apfelsine]
gb|AER62104.1|  hypothetical protein                                    189   7e-55   Dasypyrum villosum
gb|AER62098.1|  hypothetical protein                                    189   7e-55   Aegilops longissima
gb|AER62101.1|  hypothetical protein                                    189   7e-55   Aegilops longissima
gb|AER62107.1|  hypothetical protein                                    189   8e-55   Pseudoroegneria spicata [beardless wheatgrass]
gb|AER62099.1|  hypothetical protein                                    189   8e-55   Aegilops tauschii
gb|AER62097.1|  hypothetical protein                                    189   8e-55   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AER62110.1|  hypothetical protein                                    189   8e-55   Dasypyrum villosum
gb|AER62119.1|  hypothetical protein                                    189   8e-55   Hordeum marinum subsp. marinum
gb|AER62116.1|  hypothetical protein                                    189   9e-55   Henrardia persica
gb|AER62106.1|  hypothetical protein                                    189   9e-55   Psathyrostachys juncea
gb|AER62118.1|  hypothetical protein                                    189   1e-54   Hordeum bogdanii
gb|AER62111.1|  hypothetical protein                                    189   1e-54   Agropyron mongolicum
gb|AER62115.1|  hypothetical protein                                    189   1e-54   Henrardia persica
gb|AER62122.1|  hypothetical protein                                    188   1e-54   Secale cereale
dbj|BAD94192.1|  hypothetical protein                                   183   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007036194.1|  EXECUTER1 protein, chloroplast, putative iso...    194   1e-53   
gb|AFW56323.1|  hypothetical protein ZEAMMB73_718082                    185   8e-53   
gb|EMS51015.1|  hypothetical protein TRIUR3_01679                       191   1e-52   Triticum urartu
ref|XP_002967707.1|  hypothetical protein SELMODRAFT_227764             192   2e-52   Selaginella moellendorffii
ref|XP_002964327.1|  hypothetical protein SELMODRAFT_166436             191   2e-52   
ref|XP_008662557.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    177   2e-52   Zea mays [maize]
gb|EMT33306.1|  hypothetical protein F775_23580                         188   8e-52   
ref|XP_002980519.1|  hypothetical protein SELMODRAFT_178249             186   6e-51   
ref|XP_002976793.1|  hypothetical protein SELMODRAFT_175826             186   7e-51   
ref|XP_009415820.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    185   3e-50   
ref|XP_006852930.1|  hypothetical protein AMTR_s00033p00235330          177   2e-47   Amborella trichopoda
gb|KCW63352.1|  hypothetical protein EUGRSUZ_G009902                    173   3e-47   Eucalyptus grandis [rose gum]
gb|KCW63353.1|  hypothetical protein EUGRSUZ_G009902                    173   4e-47   Eucalyptus grandis [rose gum]
ref|XP_010254545.1|  PREDICTED: protein EXECUTER 1, chloroplastic       176   6e-47   Nelumbo nucifera [Indian lotus]
ref|XP_004980176.1|  PREDICTED: uncharacterized protein LOC101756047    176   9e-47   
gb|AES90588.2|  executer 1                                              175   1e-46   Medicago truncatula
ref|XP_003608391.1|  Protein EXECUTER                                   176   1e-46   
gb|AER62102.1|  hypothetical protein                                    167   2e-46   Elymus libanoticus
ref|XP_002532765.1|  EXECUTER1 protein, chloroplast precursor, pu...    174   2e-46   Ricinus communis
ref|XP_007042827.1|  Executer 1 isoform 1                               173   5e-46   
ref|XP_010065730.1|  PREDICTED: protein EXECUTER 1, chloroplastic       173   5e-46   Eucalyptus grandis [rose gum]
dbj|BAH56774.1|  AT4G33630                                              169   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373217.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    172   1e-45   Malus domestica [apple tree]
gb|KDP29991.1|  hypothetical protein JCGZ_18758                         172   1e-45   Jatropha curcas
ref|XP_004504847.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    172   1e-45   
ref|XP_010432534.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    172   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010691393.1|  PREDICTED: protein EXECUTER 1, chloroplastic       172   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008644778.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    159   3e-45   Zea mays [maize]
ref|XP_006412332.1|  hypothetical protein EUTSA_v10024585mg             171   3e-45   
ref|XP_004290412.1|  PREDICTED: protein EXECUTER 1, chloroplastic       171   4e-45   Fragaria vesca subsp. vesca
ref|XP_004508896.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    170   4e-45   
ref|XP_009366321.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    171   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_006283255.1|  hypothetical protein CARUB_v10004291mg             170   6e-45   Capsella rubella
ref|XP_010437740.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    170   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008237129.1|  PREDICTED: protein EXECUTER 1, chloroplastic       170   8e-45   Prunus mume [ume]
ref|NP_567929.1|  protein EXECUTER 1                                    170   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009766666.1|  PREDICTED: protein EXECUTER 1, chloroplastic       170   9e-45   Nicotiana sylvestris
ref|XP_010447214.1|  PREDICTED: protein EXECUTER 1, chloroplastic       170   9e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002869202.1|  hypothetical protein ARALYDRAFT_913050             169   1e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009400393.1|  PREDICTED: protein EXECUTER 1, chloroplastic       169   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527017.1|  PREDICTED: LOW QUALITY PROTEIN: protein EXEC...    169   2e-44   Tarenaya hassleriana [spider flower]
gb|KJB79577.1|  hypothetical protein B456_013G055300                    169   2e-44   Gossypium raimondii
ref|XP_003528395.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    169   2e-44   Glycine max [soybeans]
ref|XP_009108781.1|  PREDICTED: protein EXECUTER 1, chloroplastic       169   2e-44   Brassica rapa
ref|XP_007199722.1|  hypothetical protein PRUPE_ppa002360mg             168   3e-44   Prunus persica
ref|XP_004230540.1|  PREDICTED: protein EXECUTER 1, chloroplastic       168   3e-44   Solanum lycopersicum
ref|XP_008776947.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    168   4e-44   Phoenix dactylifera
ref|XP_008776948.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    168   4e-44   Phoenix dactylifera
ref|XP_006351723.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    168   5e-44   Solanum tuberosum [potatoes]
ref|XP_009138201.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    167   7e-44   Brassica rapa
ref|XP_011043046.1|  PREDICTED: protein EXECUTER 1, chloroplastic       167   9e-44   Populus euphratica
ref|XP_009368302.1|  PREDICTED: protein EXECUTER 1, chloroplastic       167   1e-43   Pyrus x bretschneideri [bai li]
gb|KHG21655.1|  Protein EXECUTER 1, chloroplastic                       166   1e-43   Gossypium arboreum [tree cotton]
ref|XP_007159151.1|  hypothetical protein PHAVU_002G213200g             166   2e-43   Phaseolus vulgaris [French bean]
gb|KJB77570.1|  hypothetical protein B456_012G144000                    166   2e-43   Gossypium raimondii
ref|XP_003541783.2|  PREDICTED: protein EXECUTER 1, chloroplastic...    166   2e-43   Glycine max [soybeans]
emb|CDY28313.1|  BnaC03g66460D                                          166   3e-43   Brassica napus [oilseed rape]
ref|XP_002323934.2|  hypothetical protein POPTR_0017s07060g             165   3e-43   
gb|KHN19019.1|  Protein EXECUTER 1, chloroplastic                       165   3e-43   Glycine soja [wild soybean]
ref|XP_009602483.1|  PREDICTED: protein EXECUTER 1, chloroplastic       165   3e-43   Nicotiana tomentosiformis
emb|CDY46102.1|  BnaA03g52660D                                          165   4e-43   Brassica napus [oilseed rape]
ref|XP_011087954.1|  PREDICTED: protein EXECUTER 1, chloroplastic       164   6e-43   Sesamum indicum [beniseed]
ref|XP_008382213.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    164   8e-43   
ref|XP_006494691.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    164   1e-42   Citrus sinensis [apfelsine]
ref|XP_007148360.1|  hypothetical protein PHAVU_006G201700g             162   2e-42   Phaseolus vulgaris [French bean]
ref|XP_007148361.1|  hypothetical protein PHAVU_006G201700g             163   2e-42   Phaseolus vulgaris [French bean]
gb|AER62113.1|  hypothetical protein                                    156   2e-42   Australopyrum retrofractum
emb|CDO97385.1|  unnamed protein product                                163   3e-42   Coffea canephora [robusta coffee]
gb|AER62109.1|  hypothetical protein                                    156   3e-42   Taeniatherum caput-medusae
gb|KDO53998.1|  hypothetical protein CISIN_1g0056622mg                  160   3e-42   Citrus sinensis [apfelsine]
ref|XP_010943896.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    162   4e-42   Elaeis guineensis
ref|XP_003532602.2|  PREDICTED: protein EXECUTER 1, chloroplastic...    162   4e-42   Glycine max [soybeans]
ref|XP_010943895.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    162   4e-42   Elaeis guineensis
ref|XP_002271011.1|  PREDICTED: protein EXECUTER 1, chloroplastic       161   1e-41   Vitis vinifera
ref|XP_004165367.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    160   2e-41   
ref|XP_004137062.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    160   3e-41   Cucumis sativus [cucumbers]
emb|CDX72417.1|  BnaC07g44390D                                          159   4e-41   
ref|XP_008455152.1|  PREDICTED: protein EXECUTER 1, chloroplastic       159   6e-41   
ref|XP_001762431.1|  predicted protein                                  147   1e-40   
gb|KJB53137.1|  hypothetical protein B456_008G294800                    156   3e-40   Gossypium raimondii
gb|KHG21654.1|  Protein EXECUTER 1, chloroplastic                       157   5e-40   Gossypium arboreum [tree cotton]
ref|XP_010101202.1|  hypothetical protein L484_015006                   156   6e-40   
ref|XP_001771979.1|  predicted protein                                  145   6e-40   
ref|XP_003084183.1|  unnamed protein product                            154   2e-39   
emb|CEG00751.1|  Protein of unknown function DUF3506                    154   5e-39   Ostreococcus tauri
gb|EPS72739.1|  hypothetical protein M569_02016                         153   6e-39   Genlisea aurea
emb|CAA20576.1|  hypothetical protein                                   153   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001422141.1|  predicted protein                                  152   1e-38   Ostreococcus lucimarinus CCE9901
gb|KDO37024.1|  hypothetical protein CISIN_1g033722mg                   140   3e-38   Citrus sinensis [apfelsine]
gb|KJB79578.1|  hypothetical protein B456_013G055300                    150   8e-38   Gossypium raimondii
ref|XP_002954035.1|  hypothetical protein VOLCADRAFT_106212             152   1e-37   Volvox carteri f. nagariensis
ref|XP_001703381.1|  predicted protein                                  147   1e-36   Chlamydomonas reinhardtii
gb|EAZ16473.1|  hypothetical protein OsJ_31943                          145   4e-36   Oryza sativa Japonica Group [Japonica rice]
sp|Q7XD99.1|EXEC1_ORYSJ  RecName: Full=Protein EXECUTER 1, chloro...    145   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662456.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    144   7e-36   
ref|XP_002500729.1|  hypothetical protein MICPUN_57395                  146   1e-35   Micromonas commoda
dbj|BAJ87615.1|  predicted protein                                      143   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004982803.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    144   2e-35   Setaria italica
ref|XP_003574086.1|  PREDICTED: protein EXECUTER 1, chloroplastic       144   3e-35   Brachypodium distachyon [annual false brome]
dbj|BAJ89988.1|  predicted protein                                      142   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005650349.1|  RNB-domain-containing protein                      143   2e-34   Coccomyxa subellipsoidea C-169
gb|EMT28755.1|  hypothetical protein F775_09989                         139   3e-34   
dbj|BAJ92734.1|  predicted protein                                      140   3e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AER62114.1|  hypothetical protein                                    132   8e-34   Eremopyrum triticeum
gb|EMS61090.1|  hypothetical protein TRIUR3_15831                       137   2e-33   Triticum urartu
ref|NP_001159303.1|  uncharacterized protein LOC100304395               138   2e-33   Zea mays [maize]
ref|XP_007511043.1|  predicted protein                                  138   6e-33   Bathycoccus prasinos
ref|XP_008664851.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    135   2e-32   Zea mays [maize]
gb|AFW79778.1|  hypothetical protein ZEAMMB73_469165                    124   8e-32   
ref|XP_008662558.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    123   1e-31   Zea mays [maize]
ref|XP_008644779.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    123   1e-31   Zea mays [maize]
gb|AFW68071.1|  hypothetical protein ZEAMMB73_464170                    130   6e-31   
gb|AFW68072.1|  hypothetical protein ZEAMMB73_464170                    130   2e-30   
ref|XP_003064419.1|  predicted protein                                  117   5e-29   Micromonas pusilla CCMP1545
ref|XP_010101203.1|  hypothetical protein L484_015007                   116   6e-29   
ref|XP_011395457.1|  Protein EXECUTER 1, chloroplastic                  122   2e-28   Auxenochlorella protothecoides
ref|XP_005849264.1|  hypothetical protein CHLNCDRAFT_51231              122   2e-27   Chlorella variabilis
gb|KCW49292.1|  hypothetical protein EUGRSUZ_K02848                     119   8e-27   Eucalyptus grandis [rose gum]
gb|EPS59467.1|  hypothetical protein M569_15340                         116   4e-26   Genlisea aurea
gb|AAD45989.1|AC005916_1  EST gb|N65787 comes from this gene            116   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AFW73863.1|  hypothetical protein ZEAMMB73_070018                    109   8e-26   
ref|XP_008644780.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    105   8e-25   Zea mays [maize]
ref|XP_007042829.1|  Executer 1 isoform 3                               107   1e-22   
gb|KJB79580.1|  hypothetical protein B456_013G055300                    103   1e-21   Gossypium raimondii
gb|AEB22069.1|  executer 1                                            82.4    1e-16   Solanum tuberosum [potatoes]
emb|CAN67007.1|  hypothetical protein VITISV_020409                   81.3    4e-15   Vitis vinifera
emb|CAN67006.1|  hypothetical protein VITISV_020408                   73.2    3e-11   Vitis vinifera
emb|CBI21738.3|  unnamed protein product                              66.6    5e-11   Vitis vinifera
ref|XP_006423690.1|  hypothetical protein CICLE_v100298791mg          68.6    8e-11   
gb|KIZ02757.1|  hypothetical protein MNEG_5197                        56.2    4e-07   Monoraphidium neglectum
gb|KIY91410.1|  hypothetical protein MNEG_16554                       56.2    4e-07   Monoraphidium neglectum
gb|AFW68070.1|  hypothetical protein ZEAMMB73_464170                  55.5    7e-07   
gb|KIL85769.1|  hypothetical protein FAVG1_10738                      58.9    1e-06   Fusarium avenaceum
gb|EGZ69627.1|  hypothetical protein NEUTE2DRAFT_152230               57.8    3e-06   Neurospora tetrasperma FGSC 2509
ref|XP_009853025.1|  hypothetical protein NEUTE1DRAFT_123663          57.8    3e-06   Neurospora tetrasperma FGSC 2508
ref|XP_957999.2|  F-box domain-containing protein                     57.0    6e-06   Neurospora crassa OR74A
gb|AAF99740.1|AC004557_19  F17L21.29                                  55.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|WP_007415956.1|  hypothetical protein                             52.4    2e-05   Pedosphaera parvula
ref|XP_003345472.1|  hypothetical protein SMAC_07459                  54.7    3e-05   Sordaria macrospora k-hell
gb|EXM07624.1|  hypothetical protein FOIG_02612                       54.7    4e-05   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXA50992.1|  hypothetical protein FOVG_03487                       54.7    4e-05   Fusarium oxysporum f. sp. pisi HDV247
gb|EXM07625.1|  hypothetical protein FOIG_02612                       54.3    4e-05   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXA50994.1|  hypothetical protein FOVG_03487                       54.3    4e-05   Fusarium oxysporum f. sp. pisi HDV247
gb|EXM35568.1|  hypothetical protein FOTG_00029                       54.3    4e-05   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXM35570.1|  hypothetical protein FOTG_00029                       54.3    4e-05   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EGU87599.1|  hypothetical protein FOXB_01884                       54.3    4e-05   Fusarium oxysporum Fo5176
gb|EXK99618.1|  hypothetical protein FOQG_00083                       54.3    4e-05   Fusarium oxysporum f. sp. raphani 54005
emb|CCT65466.1|  uncharacterized protein FFUJ_02409                   54.3    5e-05   Fusarium fujikuroi IMI 58289
ref|XP_001556545.1|  hypothetical protein BC1G_05314                  53.1    6e-05   
ref|XP_001905694.1|  hypothetical protein                             53.5    8e-05   Podospora anserina S mat+
emb|CCD43037.1|  similar to F-box domain-containing protein           53.1    1e-04   Botrytis cinerea T4
gb|EWZ45717.1|  hypothetical protein FOZG_05951                       53.1    1e-04   Fusarium oxysporum Fo47
gb|EXL63069.1|  hypothetical protein FOCG_01457                       53.1    1e-04   Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|XP_002288494.1|  predicted protein                                52.8    1e-04   Thalassiosira pseudonana CCMP1335
gb|EXL63071.1|  hypothetical protein FOCG_01457                       52.8    1e-04   Fusarium oxysporum f. sp. radicis-lycopersici 26381
gb|EWZ45719.1|  hypothetical protein FOZG_05951                       52.8    1e-04   Fusarium oxysporum Fo47
gb|EYE99676.1|  hypothetical protein EURHEDRAFT_446032                52.8    1e-04   Aspergillus ruber CBS 135680
gb|EWY99691.1|  hypothetical protein FOYG_03660                       52.8    2e-04   Fusarium oxysporum FOSC 3-a
gb|EXK43137.1|  hypothetical protein FOMG_05802                       52.8    2e-04   Fusarium oxysporum f. sp. melonis 26406
ref|XP_009262524.1|  hypothetical protein FPSE_11132                  52.4    2e-04   Fusarium pseudograminearum CS3096
gb|EWY99693.1|  hypothetical protein FOYG_03660                       52.4    2e-04   Fusarium oxysporum FOSC 3-a
gb|EXK43139.1|  hypothetical protein FOMG_05802                       52.4    2e-04   Fusarium oxysporum f. sp. melonis 26406
dbj|GAA85504.1|  F-box domain protein                                 52.0    2e-04   Aspergillus kawachii IFO 4308
gb|ENH63933.1|  hypothetical protein FOC1_g10008076                   52.0    2e-04   Fusarium oxysporum f. sp. cubense race 1
ref|XP_008077612.1|  F-box                                            52.0    3e-04   Glarea lozoyensis ATCC 20868
ref|XP_002181768.1|  predicted protein                                51.6    3e-04   Phaeodactylum tricornutum CCAP 1055/1
gb|EMR82261.1|  putative f-box domain protein                         51.6    3e-04   Botrytis cinerea BcDW1
gb|EWG54615.1|  hypothetical protein FVEG_12787                       51.2    4e-04   Fusarium verticillioides 7600
gb|EMT72921.1|  hypothetical protein FOC4_g10004413                   51.2    5e-04   Fusarium oxysporum f. sp. cubense race 4
gb|KFY52990.1|  hypothetical protein V496_08008                       51.2    5e-04   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|EWG54617.1|  hypothetical protein FVEG_12787                       51.2    5e-04   Fusarium verticillioides 7600
ref|XP_011327290.1|  hypothetical protein FGSG_07514                  51.2    5e-04   Fusarium graminearum PH-1
gb|KFY96642.1|  hypothetical protein V498_02572                       51.2    5e-04   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|EPS30236.1|  hypothetical protein PDE_05186                        50.8    6e-04   Penicillium oxalicum 114-2
ref|XP_002113360.1|  hypothetical protein TRIADDRAFT_57437            50.4    7e-04   Trichoplax adhaerens
gb|KFY81441.1|  hypothetical protein V500_11418                       50.4    8e-04   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ24746.1|  hypothetical protein V502_00778                       50.4    0.001   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY79335.1|  hypothetical protein V499_01669                       50.1    0.001   Pseudogymnoascus sp. VKM F-103



>ref|XP_009601214.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana tomentosiformis]
Length=651

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS  DLDPF+GLYVGAFGPYGTEVVQL+RKYGNWNV D EKSS +EFFEYVEAVK
Sbjct  492  FSRITTSPGDLDPFEGLYVGAFGPYGTEVVQLRRKYGNWNVNDAEKSSDVEFFEYVEAVK  551

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK +R TN+GMYPDELGVVASYKGQGRIAE+GFKNP+WVEGE
Sbjct  552  LTGDINVPAGQVTFRAKIGKASRLTNRGMYPDELGVVASYKGQGRIAEFGFKNPRWVEGE  611

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GPH+KGADLGFLYVIPEHSFLVLF+RLKLPE
Sbjct  612  LLQLNGKGMGPHMKGADLGFLYVIPEHSFLVLFNRLKLPE  651



>ref|XP_009783985.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana sylvestris]
Length=651

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS  DLDPF+GLYVGAFGPYGTEVVQL+RKYGNWNV D EKSS +EFFEYVEAVK
Sbjct  492  FSRITTSLGDLDPFEGLYVGAFGPYGTEVVQLRRKYGNWNVNDAEKSSDVEFFEYVEAVK  551

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK +R TN+GMYPDELGVVA+YKGQGRIAE+GFKNP+WVEGE
Sbjct  552  LTGDINVPAGQVTFRAKIGKASRLTNRGMYPDELGVVANYKGQGRIAEFGFKNPRWVEGE  611

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GPH+KGADLGFLYVIPEHSFLVLF+RLKLPE
Sbjct  612  LLQLNGKGMGPHMKGADLGFLYVIPEHSFLVLFNRLKLPE  651



>ref|XP_004241496.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=651

 Score =   293 bits (750),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RIT+ G DLDPF+GLYVGAFGPYGTEVVQL+RKYGNWNV D EKSS +EFFEYVEAVK
Sbjct  493  FSRITSPG-DLDPFEGLYVGAFGPYGTEVVQLRRKYGNWNVNDAEKSSNVEFFEYVEAVK  551

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+VTFRAKI KG+R +N+GMYPDELGV+A YKGQGRIAEYGFKNP+WVEGE
Sbjct  552  LTGDINVPAGEVTFRAKISKGSRLSNRGMYPDELGVLAGYKGQGRIAEYGFKNPRWVEGE  611

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GPH+KGADLGFLYVIPEHSFLVLF+RLKLPE
Sbjct  612  LLQLNGKGMGPHLKGADLGFLYVIPEHSFLVLFNRLKLPE  651



>emb|CDP12382.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS  DLDPFDGLYVGAFGPYGTEVVQL+RKYGNWN    ++SS MEFFEYVEAVK
Sbjct  516  FSRITTSKGDLDPFDGLYVGAFGPYGTEVVQLRRKYGNWNATSTKESSDMEFFEYVEAVK  575

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRA+IGK +R +N+GMYPDELGVVASYKGQGRIAE+GF+NPKWVEGE
Sbjct  576  LTGDLNVPAGQVTFRARIGKASRISNRGMYPDELGVVASYKGQGRIAEFGFRNPKWVEGE  635

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP+IKGADLGFLYV+PE SFLVLFSRLKLP+
Sbjct  636  LLQLNGKGMGPYIKGADLGFLYVVPEQSFLVLFSRLKLPD  675



>ref|XP_011071839.1| PREDICTED: protein EXECUTER 1, chloroplastic [Sesamum indicum]
Length=664

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RI TS  DLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV ++EKSS MEFFEYVEAVK
Sbjct  505  FSRIITSKGDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVNNDEKSSDMEFFEYVEAVK  564

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGKG+R  N+G+YP ELGVVASY+GQGRIAE+GF+NPKWVEGE
Sbjct  565  LTGDLNVPAGQVTFRAKIGKGSRLANRGLYPHELGVVASYRGQGRIAEFGFRNPKWVEGE  624

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQ+NGKG+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  625  LLQMNGKGLGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  664



>gb|EYU42561.1| hypothetical protein MIMGU_mgv1a002602mg [Erythranthe guttata]
Length=655

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            FTRITTS  DLDPFDGLYVGAFGPYGTEVVQL+RKYGNWN+  ++KSS +EFFEYVEAVK
Sbjct  496  FTRITTSKGDLDPFDGLYVGAFGPYGTEVVQLRRKYGNWNMNKDKKSSDVEFFEYVEAVK  555

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAK+GKGNR +N+G+YP ELGV ASY+GQGRIAE+GF+NP+WVEGE
Sbjct  556  LTGDLNVPAGQVTFRAKVGKGNRLSNRGIYPHELGVAASYRGQGRIAEFGFQNPRWVEGE  615

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RL+LPE
Sbjct  616  LLQLNGKGMGPYVKGADLGFLYVVPEQSFLVLFNRLELPE  655



>gb|EYU17659.1| hypothetical protein MIMGU_mgv1a002899mg [Erythranthe guttata]
Length=627

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F R+TTS  D+D F+GLYVGAFGPYGTEVVQLKRKYGNWNV ++EKSS +EFFEYVEAVK
Sbjct  468  FRRVTTSKGDMDTFNGLYVGAFGPYGTEVVQLKRKYGNWNVNNDEKSSDVEFFEYVEAVK  527

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+VTFRAKIGK NR  N+G+YPDELGVVASY+GQGRIAE+GFKNPKWVEGE
Sbjct  528  LTGDLNVPAGEVTFRAKIGKANRLANRGLYPDELGVVASYRGQGRIAEFGFKNPKWVEGE  587

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+G +++GADLGFLYV+PE SFLVLF RLKLPE
Sbjct  588  LLQLNGKGMGQYVEGADLGFLYVVPEQSFLVLFDRLKLPE  627



>ref|XP_008453096.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Cucumis 
melo]
 ref|XP_008453097.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Cucumis 
melo]
Length=551

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RITT+  DLDPFDGLYVGAFGPYGTEVVQL+RK+G+WN  D +E ++ +EFFEYVEAV
Sbjct  391  FNRITTASGDLDPFDGLYVGAFGPYGTEVVQLRRKFGHWNDLDNKENTTDIEFFEYVEAV  450

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+N+PAGQVTFRAKIG+GNR  N+GMYPDELGVVASYKGQGRIAE+GF+NP+WV+G
Sbjct  451  KLTGDLNLPAGQVTFRAKIGRGNRNANRGMYPDELGVVASYKGQGRIAEFGFRNPQWVDG  510

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNG+G+GP++KGADLGFLYV+PEHSFLVLF+RLKLPE
Sbjct  511  ELLQLNGRGIGPYVKGADLGFLYVVPEHSFLVLFNRLKLPE  551



>ref|XP_002318039.2| hypothetical protein POPTR_0012s08110g [Populus trichocarpa]
 gb|EEE96259.2| hypothetical protein POPTR_0012s08110g [Populus trichocarpa]
Length=648

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+R+TTS S LDPFDGLYVGAFGPYGTE+VQL+RKYG+WN+ D++ SS +EFFEYVEAVK
Sbjct  490  FSRVTTSNSSLDPFDGLYVGAFGPYGTEIVQLRRKYGHWNIEDDQ-SSDVEFFEYVEAVK  548

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRA+IGKG+R +N+G YPDELGVVASYKGQGRIAE+GFKNP+WV+GE
Sbjct  549  LTGDLNVPAGQVTFRARIGKGSRNSNRGKYPDELGVVASYKGQGRIAEFGFKNPQWVDGE  608

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNG+G+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  609  LLQLNGRGIGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  648



>ref|XP_011044311.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Populus euphratica]
Length=648

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 150/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+R+TTS S LDPFDGLYVGAFGPYGTE+VQLKRKYG+WN+ D+   S MEFFEYVEAVK
Sbjct  490  FSRVTTSNSSLDPFDGLYVGAFGPYGTEIVQLKRKYGHWNIEDD-PPSDMEFFEYVEAVK  548

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRA+IGKG+R +N+G YPDELGVVASYKGQGRIAE+GFKNP+WV+GE
Sbjct  549  LTGDLNVPAGQVTFRARIGKGSRNSNRGKYPDELGVVASYKGQGRIAEFGFKNPQWVDGE  608

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNG+G+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  609  LLQLNGRGIGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  648



>ref|XP_004298937.1| PREDICTED: protein EXECUTER 2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=654

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSG-MEFFEYVEAV  597
            F RI+TSG DLDPF+GLYVGAFGPYGTE+VQL+RKYG+WN  D+++ SG +EFFEYVEAV
Sbjct  494  FNRISTSGGDLDPFEGLYVGAFGPYGTEIVQLRRKYGHWNGSDDKEDSGDVEFFEYVEAV  553

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIG+G+R +N+GMYPDELGVVASYKGQGRIAE GF+NPKWVEG
Sbjct  554  KLTGDLNVPAGQVTFRAKIGRGSRLSNRGMYPDELGVVASYKGQGRIAEIGFRNPKWVEG  613

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLN KG+GP+ KGADLGFLY++PE SFLVLF+RLKLPE
Sbjct  614  ELLQLNAKGIGPYAKGADLGFLYIVPEQSFLVLFNRLKLPE  654



>ref|XP_002511410.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF52012.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
Length=658

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RI TS ++ DPFDGLYVGAFGPYGTEVVQL+RK+G+WNV D+ KSS +EFFEYVEAVK
Sbjct  500  FSRINTSNNNFDPFDGLYVGAFGPYGTEVVQLRRKFGHWNVTDD-KSSDVEFFEYVEAVK  558

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGKG+R  N+GMYPDELGVVASYKGQGRIAE+GF+NP+WV+GE
Sbjct  559  LTGDLNVPAGQVTFRAKIGKGSRNPNRGMYPDELGVVASYKGQGRIAEFGFRNPQWVDGE  618

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYVIPE SFLVLF+RLKLPE
Sbjct  619  LLQLNGKGLGPYVKGADLGFLYVIPEQSFLVLFNRLKLPE  658



>ref|XP_007210299.1| hypothetical protein PRUPE_ppa002543mg [Prunus persica]
 gb|EMJ11498.1| hypothetical protein PRUPE_ppa002543mg [Prunus persica]
Length=660

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI TS  DLDPFDGLYVGAFGPYGTEVVQL+RKYG+WN  + ++ S+ +EFFEYVEAV
Sbjct  500  FNRINTSSGDLDPFDGLYVGAFGPYGTEVVQLRRKYGHWNGSEGKDSSADVEFFEYVEAV  559

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIGKGNR +N+GMYPDELGVVASYKGQGRIAE+GF+NP+WVEG
Sbjct  560  KLTGDLNVPAGQVTFRAKIGKGNRLSNRGMYPDELGVVASYKGQGRIAEFGFRNPQWVEG  619

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLN KG+GP++KGADLGFLY++PE SFLVLF+RLKLPE
Sbjct  620  ELLQLNAKGIGPYVKGADLGFLYIVPEQSFLVLFNRLKLPE  660



>ref|XP_008239756.1| PREDICTED: LOW QUALITY PROTEIN: protein EXECUTER 1, chloroplastic 
[Prunus mume]
Length=660

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI TS  DLDPFDGLYVGAFGPYGTEVVQL+RKYG+WN  + ++ S+ +EFFEYVEAV
Sbjct  500  FNRINTSSGDLDPFDGLYVGAFGPYGTEVVQLRRKYGHWNGSEGKDSSADVEFFEYVEAV  559

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIGKGNR +N+GMYPDELGVVASYKGQGRIAE+GF+NP+WVEG
Sbjct  560  KLTGDLNVPAGQVTFRAKIGKGNRLSNRGMYPDELGVVASYKGQGRIAEFGFRNPQWVEG  619

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLN KG+GP++KGADLGFLY++PE SFLVLF+RLKLPE
Sbjct  620  ELLQLNAKGIGPYVKGADLGFLYIVPEQSFLVLFNRLKLPE  660



>ref|XP_011028578.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Populus euphratica]
Length=653

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 152/160 (95%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+R+TTS S LDPFDGLYVGAFGPYGTE+VQL+RKYG+WN+ D++ SS +EFFEYVEAVK
Sbjct  495  FSRVTTSNSSLDPFDGLYVGAFGPYGTEIVQLRRKYGHWNIGDDQ-SSDVEFFEYVEAVK  553

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRA+I KG+R +N+GMYPDELGVVASYKGQGRIAE+GFKNP+WV+GE
Sbjct  554  LTGDLNVPAGQVTFRARIEKGSRNSNRGMYPDELGVVASYKGQGRIAEFGFKNPQWVDGE  613

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNG+G+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  614  LLQLNGRGIGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  653



>ref|XP_008453095.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Cucumis 
melo]
Length=653

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RITT+  DLDPFDGLYVGAFGPYGTEVVQL+RK+G+WN  D +E ++ +EFFEYVEAV
Sbjct  493  FNRITTASGDLDPFDGLYVGAFGPYGTEVVQLRRKFGHWNDLDNKENTTDIEFFEYVEAV  552

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+N+PAGQVTFRAKIG+GNR  N+GMYPDELGVVASYKGQGRIAE+GF+NP+WV+G
Sbjct  553  KLTGDLNLPAGQVTFRAKIGRGNRNANRGMYPDELGVVASYKGQGRIAEFGFRNPQWVDG  612

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNG+G+GP++KGADLGFLYV+PEHSFLVLF+RLKLPE
Sbjct  613  ELLQLNGRGIGPYVKGADLGFLYVVPEHSFLVLFNRLKLPE  653



>ref|XP_002321589.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa]
 gb|EEF05716.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa]
Length=655

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 150/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS S LDPFDGLYVGAFGPYGTE+VQLKRKYG+WN  D++ SS +EFFEYVEAVK
Sbjct  497  FSRITTSNSSLDPFDGLYVGAFGPYGTEIVQLKRKYGHWNNGDDQ-SSDVEFFEYVEAVK  555

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRA+I KG R +N+GMYPDELGVVASYKGQGRIAE+GFKNP+WV+GE
Sbjct  556  LTGDLNVPAGQVTFRARIEKGRRNSNRGMYPDELGVVASYKGQGRIAEFGFKNPQWVDGE  615

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNG+G+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  616  LLQLNGRGIGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  655



>ref|XP_004138282.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cucumis sativus]
Length=609

 Score =   275 bits (702),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RITT+  DLDPFDGLYVGAFGPYGTEVVQL+RK+G+WN  D ++ +S +EFFEYVEAV
Sbjct  449  FNRITTASGDLDPFDGLYVGAFGPYGTEVVQLRRKFGHWNDLDNKDDTSDIEFFEYVEAV  508

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+N+PAGQVTFRAKIG+G R  N+G+YPDELGVVASYKGQGRIAE+GF+NP+W++G
Sbjct  509  KLTGDLNLPAGQVTFRAKIGRGIRNANRGIYPDELGVVASYKGQGRIAEFGFRNPQWIDG  568

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNG+G+GP++KGADLGFLYV+PEHSFLVLF+RLKLPE
Sbjct  569  ELLQLNGRGIGPYVKGADLGFLYVVPEHSFLVLFNRLKLPE  609



>ref|XP_006439803.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53043.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
Length=506

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RI TS  DLDPFDGLYVGAFGPYGTEVVQL+RKYG W+  + EKSS MEFFEYVEAVK
Sbjct  348  FSRINTSEGDLDPFDGLYVGAFGPYGTEVVQLRRKYGQWS-GEGEKSSDMEFFEYVEAVK  406

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+VTFRAKIGKG+R  N+G +PDELGVVASY GQGRIA++GF+NPKWV+GE
Sbjct  407  LTGDLNVPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGRIADFGFRNPKWVDGE  466

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  467  LLQLNGKGMGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  506



>ref|XP_004166493.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cucumis sativus]
Length=657

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RITT+  DLDPFDGLYVGAFGPYGTEVVQL+RK+G+WN  D ++ +S +EFFEYVEAV
Sbjct  497  FNRITTASGDLDPFDGLYVGAFGPYGTEVVQLRRKFGHWNDLDNKDDTSDIEFFEYVEAV  556

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+N+PAGQVTFRAKIG+G R  N+G+YPDELGVVASYKGQGRIAE+GF+NP+W++G
Sbjct  557  KLTGDLNLPAGQVTFRAKIGRGIRNANRGIYPDELGVVASYKGQGRIAEFGFRNPQWIDG  616

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNG+G+GP++KGADLGFLYV+PEHSFLVLF+RLKLPE
Sbjct  617  ELLQLNGRGIGPYVKGADLGFLYVVPEHSFLVLFNRLKLPE  657



>ref|XP_002279734.3| PREDICTED: protein EXECUTER 1, chloroplastic [Vitis vinifera]
 emb|CBI15040.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F+RITTS   LDPFDGLYVGAFGPYGTEVVQL+ K+GNWN  D+ +KSS +EFFEYVEAV
Sbjct  496  FSRITTSKGSLDPFDGLYVGAFGPYGTEVVQLRCKFGNWNGGDDNDKSSDVEFFEYVEAV  555

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIGKG+R  N+GMYPDELGVVASY GQGRIAE+GF+NP+WV+G
Sbjct  556  KLTGDLNVPAGQVTFRAKIGKGSRIPNRGMYPDELGVVASYSGQGRIAEFGFRNPQWVDG  615

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQL+GKG+GP+++GADLGFLYV+PE SFLVLF+RLKLPE
Sbjct  616  ELLQLSGKGMGPYVRGADLGFLYVVPEQSFLVLFNRLKLPE  656



>gb|KGN63586.1| hypothetical protein Csa_1G004980 [Cucumis sativus]
Length=657

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RITT+  DLDPFDGLYVGAFGPYGTEVVQL+RK+G+WN  D ++ +S +EFFEYVEAV
Sbjct  497  FNRITTASGDLDPFDGLYVGAFGPYGTEVVQLRRKFGHWNDLDNKDDTSDIEFFEYVEAV  556

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+N+PAGQVTFRAKIG+G R  N+G+YPDELGVVASYKGQGRIAE+GF+NP+W++G
Sbjct  557  KLTGDLNLPAGQVTFRAKIGRGIRNANRGIYPDELGVVASYKGQGRIAEFGFRNPQWIDG  616

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNG+G+GP++KGADLGFLYV+PEHSFLVLF+RLKLPE
Sbjct  617  ELLQLNGRGIGPYVKGADLGFLYVVPEHSFLVLFNRLKLPE  657



>ref|XP_010037568.1| PREDICTED: protein EXECUTER 1, chloroplastic [Eucalyptus grandis]
 gb|KCW49290.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=649

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS  DLDPFDGLYVGAFGPYGTEVVQL+RK+G WN  D   SS +EFFEYVEAVK
Sbjct  491  FSRITTSKGDLDPFDGLYVGAFGPYGTEVVQLRRKFGQWNGSDN-GSSEVEFFEYVEAVK  549

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK  R +N+GM+PDELGVVASYKGQGRIAE+GF+NPKWV+GE
Sbjct  550  LTGDLNVPAGQVTFRAKIGKRGRTSNRGMFPDELGVVASYKGQGRIAEFGFRNPKWVDGE  609

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RLKLPE
Sbjct  610  LLQLNGKGMGPYLKGADLGFLYVVPERSFLVLFNRLKLPE  649



>ref|XP_008374445.1| PREDICTED: protein EXECUTER 1, chloroplastic [Malus domestica]
Length=660

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+R+ TS  DLDPF+GLYVGAFGPYG EVVQL+RKYG+WN  + + SS +EFFEYVEAVK
Sbjct  501  FSRLNTSRGDLDPFEGLYVGAFGPYGNEVVQLRRKYGHWNSSEGKDSSDVEFFEYVEAVK  560

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIG+GNR +N+G+YPDELGVVASYKGQGRIAE+GF+NP+WVEGE
Sbjct  561  LTGDLNVPAGQVTFRAKIGRGNRQSNRGLYPDELGVVASYKGQGRIAEFGFRNPQWVEGE  620

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQL+ KG+GP+IK ADLGFLY++PE SFLVLF+RLKLPE
Sbjct  621  LLQLSNKGIGPYIKSADLGFLYIVPEQSFLVLFNRLKLPE  660



>ref|XP_004501935.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cicer arietinum]
Length=640

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWN-VRDEEKSSGMEFFEYVEAV  597
            F+RIT+S  D DPFDGLYVGAFGPYG E+VQL+RK+G+WN V +E  +S +EFFEYVEAV
Sbjct  480  FSRITSSKGDFDPFDGLYVGAFGPYGIEIVQLRRKFGHWNDVDNEGNTSNIEFFEYVEAV  539

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIGK NR  N+G+YPDELGV ASYKGQGRIA++GF+NPKWV+G
Sbjct  540  KLTGDLNVPAGQVTFRAKIGKVNRNANRGLYPDELGVNASYKGQGRIADFGFRNPKWVDG  599

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNGKG+GPH+KGADLGFLYV+PE SFLVLF+RLKLPE
Sbjct  600  ELLQLNGKGLGPHMKGADLGFLYVVPEQSFLVLFNRLKLPE  640



>ref|XP_010536627.1| PREDICTED: protein EXECUTER 1, chloroplastic [Tarenaya hassleriana]
Length=644

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI  S  +LDPFDGLYVGAFGPYGTE+VQL RKYG WN  + + SS +EFFEYVEAVK
Sbjct  485  FNRINISEGNLDPFDGLYVGAFGPYGTEIVQLTRKYGRWNDEESDNSSDVEFFEYVEAVK  544

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRAKIG+GNR  N+GMYP++LGVVA YKGQGRIA++GFKNPKWVEGE
Sbjct  545  LTGDPNVPAGQVTFRAKIGRGNRLNNRGMYPEDLGVVAGYKGQGRIADFGFKNPKWVEGE  604

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RL+LPE
Sbjct  605  LLQLNGKGMGPYVKGADLGFLYVVPEQSFLVLFNRLRLPE  644



>ref|XP_010251274.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Nelumbo nucifera]
Length=629

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWN-VRDEEKSSGMEFFEYVEAV  597
            FT ITT  +DLDPFDGLYVGAFGPYGTEVVQL+RK+G+WN V D +K S +EFFEYVEAV
Sbjct  469  FTWITTPRNDLDPFDGLYVGAFGPYGTEVVQLRRKFGDWNGVDDTDKRSDVEFFEYVEAV  528

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIGKG+R  N GMYPDELGVVASYKGQGRIAE+GFKNP+WV+G
Sbjct  529  KLTGDLNVPAGQVTFRAKIGKGSRIPNSGMYPDELGVVASYKGQGRIAEFGFKNPQWVDG  588

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQL+G+G+ P+ +GADLGFLYV+P+ SFLVLF+RLKLPE
Sbjct  589  ELLQLSGRGMEPYARGADLGFLYVVPQQSFLVLFNRLKLPE  629



>gb|KDP31109.1| hypothetical protein JCGZ_11485 [Jatropha curcas]
Length=663

 Score =   273 bits (697),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RITTS ++ DPF+GLY+GAFGP+GTE+VQL+RK+G+WN  D+ KSS +EFFEYVEAVK
Sbjct  505  FNRITTSNNNFDPFEGLYIGAFGPFGTEIVQLRRKFGHWNGSDD-KSSDVEFFEYVEAVK  563

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK +R  N+GMYPDELGVVASYKGQGRIAE GF+NP+WV+GE
Sbjct  564  LTGDLNVPAGQVTFRAKIGKASRNPNRGMYPDELGVVASYKGQGRIAEVGFQNPQWVDGE  623

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYVIPE SFLVLF+RLKLPE
Sbjct  624  LLQLNGKGMGPYVKGADLGFLYVIPEQSFLVLFNRLKLPE  663



>ref|XP_006439802.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 ref|XP_006439804.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 ref|XP_006439805.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53042.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53044.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53045.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
Length=659

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RI TS  DLDPFDGLYVGAFGPYGTEVVQL+RKYG W+  + EKSS MEFFEYVEAVK
Sbjct  501  FSRINTSEGDLDPFDGLYVGAFGPYGTEVVQLRRKYGQWS-GEGEKSSDMEFFEYVEAVK  559

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+VTFRAKIGKG+R  N+G +PDELGVVASY GQGRIA++GF+NPKWV+GE
Sbjct  560  LTGDLNVPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGRIADFGFRNPKWVDGE  619

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  620  LLQLNGKGMGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  659



>ref|XP_006476766.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Citrus sinensis]
Length=661

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 147/160 (92%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RI TS  DLDPFDGLYVGAFGPYGTEVVQL+RKYG W+  + EKSS MEFFEYVEAVK
Sbjct  503  FSRINTSEGDLDPFDGLYVGAFGPYGTEVVQLRRKYGQWS-GEGEKSSDMEFFEYVEAVK  561

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+VTFRAKIGKG+R  N+G +PDELGVVASY GQGRIA++GF+NPKWV+GE
Sbjct  562  LTGDLNVPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGRIADFGFRNPKWVDGE  621

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  622  LLQLNGKGMGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  661



>ref|XP_009363034.1| PREDICTED: protein EXECUTER 1, chloroplastic [Pyrus x bretschneideri]
Length=660

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+R+ T   DLDPF+GLYVGAFGPYG EVVQL+RKYG+WN  + ++S+ MEFFEYVEAVK
Sbjct  501  FSRLNTLRGDLDPFEGLYVGAFGPYGKEVVQLRRKYGHWNSSEGKESADMEFFEYVEAVK  560

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGKGNR +N+G+YPDELGVVASYKGQGRIAE+GF+NP+WVEGE
Sbjct  561  LTGDLNVPAGQVTFRAKIGKGNRQSNRGLYPDELGVVASYKGQGRIAEFGFQNPRWVEGE  620

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQL+ KG+GP++K ADLGFLY++PE SFLVLF+RLKLPE
Sbjct  621  LLQLSNKGIGPYVKSADLGFLYIVPEQSFLVLFNRLKLPE  660



>ref|XP_008787983.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Phoenix dactylifera]
Length=292

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T    LDPFDGLYVGAFGPYGTEVVQL+RKYG+WN  +E     +EFFEYVEAVK
Sbjct  134  FNRIITDNVGLDPFDGLYVGAFGPYGTEVVQLRRKYGHWNTTNETDPD-IEFFEYVEAVK  192

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGKGN+  N+G+YP+ELGVVASYKGQGRIAE GFKNP+WV+GE
Sbjct  193  LTGDLNVPAGQVTFRAKIGKGNQLRNRGLYPEELGVVASYKGQGRIAEPGFKNPQWVDGE  252

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG GPH++G +LGFLYVIP+ SFLVLF RLKLP+
Sbjct  253  LLQLNGKGFGPHVRGTELGFLYVIPDQSFLVLFERLKLPD  292



>ref|XP_003522373.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=632

 Score =   270 bits (689),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWN-VRDEEKSSGMEFFEYVEAV  597
            F+RI  S  D DPFDGLYVGAFGPYG E+V L+RK+G+WN V +E  +S + FFEYVEAV
Sbjct  472  FSRIICSRGDSDPFDGLYVGAFGPYGMEIVHLRRKFGHWNEVNNENNTSDVGFFEYVEAV  531

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIG+GNR TN+GMYPD+LGVVASYKGQGRIA+YG++NPKWVEG
Sbjct  532  KLTGDLNVPAGQVTFRAKIGRGNRNTNRGMYPDDLGVVASYKGQGRIADYGYRNPKWVEG  591

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNGKG+GP++KGADLGFLYV+PE SFLVLF RLKLPE
Sbjct  592  ELLQLNGKGMGPYMKGADLGFLYVVPEQSFLVLFHRLKLPE  632



>ref|XP_003528152.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=634

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWN-VRDEEKSSGMEFFEYVEAV  597
            F+RI  S  D DPFDGLYVGAFGPYG E+V L+RK+G+WN V +E K+S + FFEYVEAV
Sbjct  474  FSRIICSRGDSDPFDGLYVGAFGPYGMEIVHLRRKFGHWNEVDNENKTSDVGFFEYVEAV  533

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAG VTFRAKIG+GNR TN+GMYPD+LGVVASYKGQGRIA+YG++NPKWVEG
Sbjct  534  KLTGDLNVPAGLVTFRAKIGRGNRITNQGMYPDDLGVVASYKGQGRIADYGYRNPKWVEG  593

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNGKG+GP++KGADLGFLYV+PE SFLVLF RLKLPE
Sbjct  594  ELLQLNGKGMGPYMKGADLGFLYVVPEQSFLVLFHRLKLPE  634



>ref|XP_007138087.1| hypothetical protein PHAVU_009G179300g [Phaseolus vulgaris]
 gb|ESW10081.1| hypothetical protein PHAVU_009G179300g [Phaseolus vulgaris]
Length=645

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWN-VRDEEKSSGMEFFEYVEAV  597
            F RI  S  D DPFDGLYVGAFGPYG E+V L+RK+G+WN V  E  +S + FFEYVEAV
Sbjct  485  FNRIICSRGDSDPFDGLYVGAFGPYGMEIVHLRRKFGHWNEVNSENNTSDVGFFEYVEAV  544

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIG+GNR TN+GMYPD+LGVVASYKGQGRIA+YGF+NPKWV+G
Sbjct  545  KLTGDLNVPAGQVTFRAKIGRGNRNTNRGMYPDDLGVVASYKGQGRIADYGFRNPKWVDG  604

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNGKG+GP++KGADLGFLYV+PE SFLVLF RLKLPE
Sbjct  605  ELLQLNGKGMGPYMKGADLGFLYVVPEQSFLVLFHRLKLPE  645



>gb|KJB53139.1| hypothetical protein B456_008G294800 [Gossypium raimondii]
Length=516

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI++   +LDPF+GLYVGAFGPYGTE+VQL+RKYG W+  D+E SS +EFFEYVEAVK
Sbjct  358  FNRISSDNGNLDPFEGLYVGAFGPYGTEIVQLRRKYGRWSDADDE-SSDVEFFEYVEAVK  416

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIG+ +R +N+G+YPDELGVVA YKGQGRIAE+GF+NP+WV+GE
Sbjct  417  LTGDLNVPAGQVTFRAKIGRESRLSNRGLYPDELGVVACYKGQGRIAEFGFRNPRWVDGE  476

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLY++PE SFLVLF+RL LP+
Sbjct  477  LLQLNGKGIGPYVKGADLGFLYIVPEQSFLVLFNRLILPD  516



>ref|XP_003601283.1| Protein EXECUTER [Medicago truncatula]
 gb|AES71534.1| executer 1 [Medicago truncatula]
Length=630

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWN-VRDEEKSSGMEFFEYVEAV  597
            F+RI     D DPFDGLYVGAFGPYG E+VQL+RK+G+WN V  E  +S +EFFEYVEAV
Sbjct  470  FSRIACPRGDFDPFDGLYVGAFGPYGIEIVQLRRKFGHWNDVDSENNTSDIEFFEYVEAV  529

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAKIGK NR  N+G+YPDELGV ASYKGQGRIA++GF+NPKWV+G
Sbjct  530  KLTGDLNVPAGQVTFRAKIGKVNRNANRGLYPDELGVNASYKGQGRIADFGFRNPKWVDG  589

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNGKG+GPH+KGADLGFLY +PE SFLVLF+RLKLPE
Sbjct  590  ELLQLNGKGMGPHMKGADLGFLYAVPEQSFLVLFNRLKLPE  630



>ref|XP_010940041.1| PREDICTED: protein EXECUTER 1, chloroplastic [Elaeis guineensis]
Length=656

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T    LDPFDGLYVGAFGPYGTEVVQL+RKYG+WN  DE     +EFFEYVEAVK
Sbjct  498  FNRIITDNDGLDPFDGLYVGAFGPYGTEVVQLQRKYGHWNSTDE-TDQDIEFFEYVEAVK  556

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGKGN+  N+G+YP+ELGVVASYKGQGRIAE GFKNP+WV+GE
Sbjct  557  LTGDLNVPAGQVTFRAKIGKGNQLRNRGLYPEELGVVASYKGQGRIAEPGFKNPQWVDGE  616

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG GPH++G +LGFLYVIP+ SFLVLF RLKLP+
Sbjct  617  LLQLNGKGFGPHVRGTELGFLYVIPDQSFLVLFERLKLPD  656



>ref|XP_007036192.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007036193.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20693.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20694.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
Length=647

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI++   +LDPF+GLYVGAFGPYGTE+VQL+RKYG WN  D+E +S +EFFEYVEAVK
Sbjct  489  FNRISSDNGNLDPFEGLYVGAFGPYGTEIVQLRRKYGRWNDADDE-TSDVEFFEYVEAVK  547

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIG+ +R  N+GMYPDELGVVA YKGQGRIAE+ F+NP+WV+GE
Sbjct  548  LTGDLNVPAGQVTFRAKIGRESRLPNRGMYPDELGVVACYKGQGRIAEFSFRNPRWVDGE  607

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLY++PE SFLVLF+RL+LP+
Sbjct  608  LLQLNGKGIGPYVKGADLGFLYIVPEQSFLVLFNRLRLPD  647



>ref|XP_010678752.1| PREDICTED: protein EXECUTER 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=707

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F R+     +LDPFDGLYVGAFGPYGTE+VQL+RK+G+WN  +E E SS +EFFEYVEAV
Sbjct  547  FNRVQIPRGNLDPFDGLYVGAFGPYGTEIVQLRRKFGHWNSGNELEGSSDVEFFEYVEAV  606

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRAK+G+G+RF+N+ MYPDELGV  SYKGQGRIAE+GFKNPKWVEG
Sbjct  607  KLTGDLNVPAGQVTFRAKLGRGSRFSNRSMYPDELGVATSYKGQGRIAEFGFKNPKWVEG  666

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ELLQLNGKGVGP+ +GADLGFLY++PE SFLVLF+RL LPE
Sbjct  667  ELLQLNGKGVGPYFRGADLGFLYIVPEQSFLVLFNRLNLPE  707



>gb|KJB53138.1| hypothetical protein B456_008G294800 [Gossypium raimondii]
Length=654

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 146/160 (91%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI++   +LDPF+GLYVGAFGPYGTE+VQL+RKYG W+  D+E SS +EFFEYVEAVK
Sbjct  496  FNRISSDNGNLDPFEGLYVGAFGPYGTEIVQLRRKYGRWSDADDE-SSDVEFFEYVEAVK  554

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIG+ +R +N+G+YPDELGVVA YKGQGRIAE+GF+NP+WV+GE
Sbjct  555  LTGDLNVPAGQVTFRAKIGRESRLSNRGLYPDELGVVACYKGQGRIAEFGFRNPRWVDGE  614

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQLNGKG+GP++KGADLGFLY++PE SFLVLF+RL LP+
Sbjct  615  LLQLNGKGIGPYVKGADLGFLYIVPEQSFLVLFNRLILPD  654



>ref|XP_008367525.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=660

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  770  TRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKL  591
            +R+ T   DLDPF+GLYVGAFGPYG EVVQL+RKYG+WN  + ++S  MEFFEYVEAVKL
Sbjct  502  SRLNTFRGDLDPFEGLYVGAFGPYGKEVVQLRRKYGHWNSSEGKESVDMEFFEYVEAVKL  561

Query  590  TGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGEL  411
            TGD+NVPAGQVTFRAKIGKGNR +N G+YPDELGVVASYKGQGRIAE+GF+NP+WVEGEL
Sbjct  562  TGDLNVPAGQVTFRAKIGKGNRQSNXGLYPDELGVVASYKGQGRIAEFGFRNPQWVEGEL  621

Query  410  LQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LQL+ KG+GP++K ADLGFLY++PE SFLVLF+RLKLP+
Sbjct  622  LQLSNKGIGPYVKSADLGFLYIVPEQSFLVLFNRLKLPD  660



>ref|XP_010243014.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Nelumbo nucifera]
Length=632

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = -2

Query  755  SGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNW-NVRDEEKSSGMEFFEYVEAVKLTGDM  579
            S  +LDPFDGLYVGAFGPYGTEVVQL+RK+G+W +V D +  S +EFFEYVEAVKLTGD+
Sbjct  478  SRDNLDPFDGLYVGAFGPYGTEVVQLRRKFGHWHSVDDTDNWSDVEFFEYVEAVKLTGDL  537

Query  578  NVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLN  399
            NVPAGQVTFRAKIGKGNR  N+GMYPDELGVV+SYKGQGRIAE+GFKNP+WV+GELLQL+
Sbjct  538  NVPAGQVTFRAKIGKGNRVPNRGMYPDELGVVSSYKGQGRIAEFGFKNPQWVDGELLQLS  597

Query  398  GKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            GKG+GP+ +GADLGFLY+IPE SFLVLF+RLKLPE
Sbjct  598  GKGMGPYARGADLGFLYIIPEQSFLVLFNRLKLPE  632



>ref|XP_006304413.1| hypothetical protein CARUB_v10010978mg [Capsella rubella]
 gb|EOA37311.1| hypothetical protein CARUB_v10010978mg [Capsella rubella]
Length=646

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG WN  +   SS +EFFEYVEAVK
Sbjct  487  FNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWNDAEGSNSSDIEFFEYVEAVK  546

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IG G+R TN G++P+ELGV+ASY+GQGRIA++GFKNPKWVEG+
Sbjct  547  LTGDPNVPAGQVTFRARIGNGSRMTNHGLFPEELGVLASYRGQGRIADFGFKNPKWVEGK  606

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+ PE SFLV+F+RL+LPE
Sbjct  607  LLKLNGKGMGPYVKGADLGFLYIGPEQSFLVVFNRLRLPE  646



>ref|XP_009380345.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T    LDPFDGLYVGAFGPYG EVVQ++RKYG+WN  DE   S +EFFEYVEAVK
Sbjct  500  FNRIITDNKSLDPFDGLYVGAFGPYGVEVVQIQRKYGHWNGTDE-LGSDIEFFEYVEAVK  558

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGKGNR +N+GMYP+ELGVVASYKGQGRIAE GFKNP+WV+GE
Sbjct  559  LTGDLNVPAGQVTFRAKIGKGNRRSNRGMYPEELGVVASYKGQGRIAEPGFKNPQWVDGE  618

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQ NGKG+GP+++G +LGFLYV+PE  FLVLF RLKLP+
Sbjct  619  LLQFNGKGLGPYVRGTELGFLYVVPEQKFLVLFERLKLPD  658



>emb|CDY11792.1| BnaC03g57860D [Brassica napus]
Length=620

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RITT  SDLDPFDGLYVGAFGPYGTE+VQLKRKYGNWN  +E  SS +EFFEYVEAVK
Sbjct  461  FNRITTPESDLDPFDGLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSSDIEFFEYVEAVK  520

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IGKG+R  ++GMYP+E+GV+ASY G+GRIA++GFKNP+WV G+
Sbjct  521  LTGDPNVPAGQVTFRARIGKGSRMRDRGMYPEEMGVLASYMGEGRIADFGFKNPRWVGGQ  580

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++ G DLGFLY+ PE SF+V+F+RL+LPE
Sbjct  581  LLKLNGKGMGPYVTGGDLGFLYIGPEKSFMVVFNRLRLPE  620



>ref|XP_002893472.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69731.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG WN  +   SS +EFFEYVEAVK
Sbjct  488  FNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWNDAEGSNSSDIEFFEYVEAVK  547

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAG+VTFRA+IG G+R TN G++P+ELGV+ASY+GQGRIA++GFKNPKWVEG+
Sbjct  548  LTGDPNVPAGEVTFRARIGNGSRMTNHGLFPEELGVLASYRGQGRIADFGFKNPKWVEGK  607

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+ PE SFLV+F+RL+LPE
Sbjct  608  LLKLNGKGMGPYVKGADLGFLYIGPEQSFLVVFNRLRLPE  647



>emb|CDX90093.1| BnaA08g18910D [Brassica napus]
Length=640

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  SDLDPFDGLYVGAFGPYGTE+VQLKRKYGNWN  +E  S+ +EFFEYVEAVK
Sbjct  481  FNRIITPESDLDPFDGLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSTDIEFFEYVEAVK  540

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IGKG+R  ++GMYP+E+GV+ASY G+GRIA++GFKNP+WV G+
Sbjct  541  LTGDPNVPAGQVTFRARIGKGSRMRDRGMYPEEMGVLASYMGEGRIADFGFKNPRWVGGQ  600

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++ G DLGFLYV PE SF+V+F+RL+LPE
Sbjct  601  LLKLNGKGMGPYVTGGDLGFLYVGPEKSFMVVFNRLRLPE  640



>ref|XP_006415752.1| hypothetical protein EUTSA_v10007043mg [Eutrema salsugineum]
 gb|ESQ34105.1| hypothetical protein EUTSA_v10007043mg [Eutrema salsugineum]
Length=638

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  SDLDPFDGLYVGAFGPYGTE+VQLKRKYG+W   +E  +S +EFFEYVEAVK
Sbjct  479  FNRIITPESDLDPFDGLYVGAFGPYGTEIVQLKRKYGHWIDAEESNTSDIEFFEYVEAVK  538

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IGKG+R  ++G++P+E+GV+ASY G+GRIA++GFKNPKWVEG+
Sbjct  539  LTGDPNVPAGQVTFRARIGKGSRMRDRGLFPEEMGVLASYMGEGRIADFGFKNPKWVEGQ  598

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+ PE SFLV+F+RL+LPE
Sbjct  599  LLKLNGKGMGPYVKGADLGFLYIGPEKSFLVVFNRLRLPE  638



>ref|XP_009109798.1| PREDICTED: protein EXECUTER 1, chloroplastic [Brassica rapa]
Length=640

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  SDLDPFDGLYVGAFGPYGTE+VQLKRKYGNWN  +E  S+ +EFFEYVEAVK
Sbjct  481  FNRIITPESDLDPFDGLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSTDIEFFEYVEAVK  540

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IGKG+R  ++GMYP+E+GV+ASY G+GRIA++GFKNP+WV G+
Sbjct  541  LTGDPNVPAGQVTFRARIGKGSRMRDRGMYPEEMGVLASYMGEGRIADFGFKNPRWVGGQ  600

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++ G DLGFLY+ PE SF+V+F+RL+LPE
Sbjct  601  LLKLNGKGMGPYVTGGDLGFLYIGPEKSFMVVFNRLRLPE  640



>ref|NP_564287.1| protein EXECUTER 2 [Arabidopsis thaliana]
 sp|Q94AT5.1|EXEC2_ARATH RecName: Full=Protein EXECUTER 2, chloroplastic; Short=AtEX2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76486.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45133.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30840.1| uncharacterized protein AT1G27510 [Arabidopsis thaliana]
Length=651

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG W+  +   SS +EFFEYVEAVK
Sbjct  492  FNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWDDAEGSNSSDIEFFEYVEAVK  551

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IG G+R TN G++P+ELGV+ASY+GQG+IA++GFK P+WVEG+
Sbjct  552  LTGDPNVPAGQVTFRARIGNGSRMTNHGLFPEELGVLASYRGQGKIADFGFKKPRWVEGK  611

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+ PE SFLVLF+RL+LPE
Sbjct  612  LLKLNGKGMGPYVKGADLGFLYIGPEQSFLVLFNRLRLPE  651



>gb|KDO69684.1| hypothetical protein CISIN_1g0061462mg, partial [Citrus sinensis]
 gb|KDO69685.1| hypothetical protein CISIN_1g0061462mg, partial [Citrus sinensis]
 gb|KDO69686.1| hypothetical protein CISIN_1g0061462mg, partial [Citrus sinensis]
 gb|KDO69687.1| hypothetical protein CISIN_1g0061462mg, partial [Citrus sinensis]
Length=143

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = -2

Query  725  LYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQVTFRA  546
            LYVGAFGPYGTEVVQL+RKYG W+  + EKSS MEFFEYVEAVKLTGD+NVPAG+VTFRA
Sbjct  1    LYVGAFGPYGTEVVQLRRKYGQWS-GEGEKSSDMEFFEYVEAVKLTGDLNVPAGEVTFRA  59

Query  545  KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGPHIKGA  366
            KIGKG+R  N+G +PDELGVVASY GQGRIA++GF+NPKWV+GELLQLNGKG+GP++KGA
Sbjct  60   KIGKGSRLPNRGKFPDELGVVASYSGQGRIADFGFRNPKWVDGELLQLNGKGMGPYVKGA  119

Query  365  DLGFLYVIPEHSFLVLFSRLKLPE  294
            DLGFLYV+PE SFLVLF+RLKLP+
Sbjct  120  DLGFLYVVPEQSFLVLFNRLKLPD  143



>ref|NP_001041785.1| Os01g0107900 [Oryza sativa Japonica Group]
 dbj|BAF03699.1| Os01g0107900, partial [Oryza sativa Japonica Group]
Length=257

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF GLYVGAF PYG EVVQL+RK+G+WN  DE     +EFFEYVEAVK
Sbjct  103  FNRIITDSNGSDPFSGLYVGAFSPYGPEVVQLRRKFGHWNSTDE-----VEFFEYVEAVK  157

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  158  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  217

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RLKLPE
Sbjct  218  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLKLPE  257



>tpg|DAA53815.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
Length=277

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI    + +DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  122  FNRIIMDTNSMDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSSDD-----VEFFEYVEAVK  176

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  177  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  236

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  237  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLNLPE  276



>ref|XP_010499237.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=647

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            + RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG W   +   +S +EFFEYVEAVK
Sbjct  486  YNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWENAEGSNASDIEFFEYVEAVK  545

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IG G+R T+ G++P+ELGV+ASY GQGR+A+ GF+NPKWV G+
Sbjct  546  LTGDPNVPAGQVTFRARIGNGSRMTDHGLFPEELGVLASYGGQGRVADVGFENPKWVAGK  605

Query  413  LLQLNGKGVGPHIKGADLGFLYV--IPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+   PE SFLVLF+RL+LPE
Sbjct  606  LLKLNGKGMGPYVKGADLGFLYIGPDPEKSFLVLFNRLRLPE  647



>ref|XP_010460515.1| PREDICTED: protein EXECUTER 1, chloroplastic [Camelina sativa]
Length=648

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            + RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG W   +   SS +EFFEYVEAVK
Sbjct  487  YNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWEDAEGSTSSDIEFFEYVEAVK  546

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IG G+R T+ G++P+ELGV+ASY GQGR+A+  FKNPKWV G+
Sbjct  547  LTGDPNVPAGQVTFRARIGNGSRMTDHGLFPEELGVLASYGGQGRVADIEFKNPKWVAGK  606

Query  413  LLQLNGKGVGPHIKGADLGFLYV--IPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+   PE SFLVLF+RL+LPE
Sbjct  607  LLKLNGKGMGPYVKGADLGFLYIGPDPEKSFLVLFNRLRLPE  648



>dbj|BAJ99356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 129/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  227  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  281

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  282  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  341

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PHI GA+LGFLY +PE SFLVLF RL LPE
Sbjct  342  LLVLNGKSAIPHIGGAELGFLYSVPEQSFLVLFDRLTLPE  381



>ref|XP_002455331.1| hypothetical protein SORBIDRAFT_03g008590 [Sorghum bicolor]
 gb|EES00451.1| hypothetical protein SORBIDRAFT_03g008590 [Sorghum bicolor]
Length=276

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 129/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI    +  DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  122  FNRIIMDTNSTDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSTDD-----VEFFEYVEAVK  176

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GVVASYKGQGRIA+ GFKNP+WV+GE
Sbjct  177  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVVASYKGQGRIAQPGFKNPRWVDGE  236

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL L+GK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  237  LLVLSGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLNLPE  276



>ref|XP_006645432.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Oryza brachyantha]
Length=577

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF GLYVGAF PYG EVVQL+RK+G+WN  DE     +EFFEYVEA+K
Sbjct  423  FNRIITDSNGSDPFSGLYVGAFSPYGPEVVQLRRKFGHWNSTDE-----VEFFEYVEALK  477

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  478  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  537

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RLKLPE
Sbjct  538  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLKLPE  577



>ref|XP_010478095.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=644

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            + RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG W   +   SS +EFFEYVEAVK
Sbjct  483  YNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWEDAEGSDSSDIEFFEYVEAVK  542

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRA+IG G+R T+ G++P+ELGV+ASY GQGR+A+  F+NPKWV G+
Sbjct  543  LTGDPNVPAGQVTFRARIGNGSRMTDHGLFPEELGVLASYGGQGRVADIEFRNPKWVAGK  602

Query  413  LLQLNGKGVGPHIKGADLGFLYV--IPEHSFLVLFSRLKLPE  294
            LL+LNGKG+GP++KGADLGFLY+   P+ SFLVLF+RL+LPE
Sbjct  603  LLKLNGKGMGPYVKGADLGFLYIGPDPQKSFLVLFNRLRLPE  644



>gb|EAY72221.1| hypothetical protein OsI_00074 [Oryza sativa Indica Group]
Length=625

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF GLYVGAF PYG EVVQL+RK+G+WN  DE     +EFFEYVEAVK
Sbjct  471  FNRIITDSNGSDPFSGLYVGAFSPYGPEVVQLRRKFGHWNSTDE-----VEFFEYVEAVK  525

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  526  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  585

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RLKLPE
Sbjct  586  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLKLPE  625



>sp|Q657X6.1|EXEC2_ORYSJ RecName: Full=Protein EXECUTER 2, chloroplastic; Short=OsEX2; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD44852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD44891.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ10235.1| hypothetical protein OsJ_00066 [Oryza sativa Japonica Group]
 dbj|BAG91905.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF GLYVGAF PYG EVVQL+RK+G+WN  DE     +EFFEYVEAVK
Sbjct  473  FNRIITDSNGSDPFSGLYVGAFSPYGPEVVQLRRKFGHWNSTDE-----VEFFEYVEAVK  527

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  528  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  587

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RLKLPE
Sbjct  588  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLKLPE  627



>ref|XP_003565224.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=632

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  DE     +EFFEYVEAVK
Sbjct  478  FNRIITDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDE-----VEFFEYVEAVK  532

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAK+GKG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  533  LTGDLSVPAGQITFRAKVGKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  592

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  593  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLTLPE  632



>ref|XP_010230337.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=638

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  DE     +EFFEYVEAVK
Sbjct  484  FNRIITDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDE-----VEFFEYVEAVK  538

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAK+GKG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  539  LTGDLSVPAGQITFRAKVGKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  598

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  599  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLTLPE  638



>ref|NP_001182951.1| hypothetical protein [Zea mays]
 gb|ACR35247.1| unknown [Zea mays]
 tpg|DAA53812.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
 tpg|DAA53813.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
Length=622

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI    + +DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  467  FNRIIMDTNSMDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSSDD-----VEFFEYVEAVK  521

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  522  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  581

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  582  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLNLPE  621



>ref|XP_009415819.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=654

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI +    LDPF+GLY GAFGPYGTEVV L+RKYGNWN  +   +S M FFEYVEA+K
Sbjct  496  FNRIISDNRGLDPFEGLYAGAFGPYGTEVVHLRRKYGNWNDVNG-LNSDMNFFEYVEAIK  554

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK     NKG+YP+ELGVV+ YKGQGRIAE GFKNP+WV+GE
Sbjct  555  LTGDLNVPAGQVTFRAKIGKKYHLPNKGLYPEELGVVSIYKGQGRIAEPGFKNPRWVDGE  614

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LLQL+GKG+GPHI+   LGFLYV+PE SFLVLF  L+LP+
Sbjct  615  LLQLSGKGLGPHIRDMLLGFLYVVPEKSFLVLFQPLRLPD  654



>ref|NP_001146198.1| hypothetical protein [Zea mays]
 gb|ACL53452.1| unknown [Zea mays]
 gb|AFW79777.1| hypothetical protein ZEAMMB73_469165 [Zea mays]
Length=627

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 129/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI    +  DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  473  FKRIIMDTNSTDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSTDD-----VEFFEYVEAVK  527

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  528  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  587

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  588  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLNLPE  627



>ref|XP_004967955.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Setaria italica]
Length=627

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 128/160 (80%), Gaps = 5/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI    +  DPF GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  473  FNRIVMDTNSTDPFSGLYVGAFSPYGPEIVQLRRKFGHWNSTDD-----VEFFEYVEAVK  527

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+AS+KGQGRIA+ GFKNP+WV+GE
Sbjct  528  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASFKGQGRIAQPGFKNPRWVDGE  587

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LNGK   PH+ GA+LGFLY +PE SFLVLF RL LPE
Sbjct  588  LLVLNGKSTIPHLGGAELGFLYSVPEQSFLVLFDRLNLPE  627



>ref|XP_010322554.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=670

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RIT+ G DLDPF+GLYVGAFGPYGTEVVQL+RKYGNWNV D EKSS +EFFEYVEAVK
Sbjct  493  FSRITSPG-DLDPFEGLYVGAFGPYGTEVVQLRRKYGNWNVNDAEKSSNVEFFEYVEAVK  551

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+VTFRAKI KG+R +N+GMYPDELGV+A YKGQGRIAEYGFKNP+WVEGE
Sbjct  552  LTGDINVPAGEVTFRAKISKGSRLSNRGMYPDELGVLAGYKGQGRIAEYGFKNPRWVEGE  611

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSR  309
            LLQLNGK     +K   L  L +   H  L + S+
Sbjct  612  LLQLNGKSTH-SVKSQFLRLLNLKKIHQILGIVSQ  645



>gb|KFK28712.1| hypothetical protein AALP_AA7G037200 [Arabis alpina]
Length=659

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI +  S++DPFDGLYVGAFGPYGTE+VQ+KRKYG W+  DE  SS +E +EYVEAVK
Sbjct  498  FNRIISPDSNIDPFDGLYVGAFGPYGTEIVQIKRKYGRWDDDDESDSSDVEPYEYVEAVK  557

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD NVPAGQVTFRAKIGKG+ + +   YP+ELGV+A+Y GQGRIAE GFKNPKWV G+
Sbjct  558  LTGDPNVPAGQVTFRAKIGKGSTWRSGTRYPEELGVLATYGGQGRIAEIGFKNPKWVAGK  617

Query  413  LLQLNGKGVGPHIKGADLGFLYVIP--EHSFLVLFSRLKLPE  294
            LL+LNGKG+ P+  GADLGF+Y+ P  E SFLVLF+RL+LPE
Sbjct  618  LLKLNGKGMEPYTNGADLGFVYMGPDSEQSFLVLFNRLRLPE  659



>emb|CAN68093.1| hypothetical protein VITISV_012750 [Vitis vinifera]
Length=116

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  638  KSSGMEFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGR  459
            KSS +EFFEYVEAVKLTGD+NVPAGQVTFRAKIGKG+R  N+GMYPDELGVVASY GQGR
Sbjct  2    KSSDVEFFEYVEAVKLTGDLNVPAGQVTFRAKIGKGSRIPNRGMYPDELGVVASYSGQGR  61

Query  458  IAEYGFKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            IAE+GF+NP+WV+GELLQL+GKG+GP+++GADLGFLYV+PE SFLVLF+RLKLPE
Sbjct  62   IAEFGFRNPQWVDGELLQLSGKGMGPYVRGADLGFLYVVPEQSFLVLFNRLKLPE  116



>gb|KCW49291.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=630

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS  DLDPFDGLYVGAFGPYGTEVVQL+RK+G WN  D   SS +EFFEYVEAVK
Sbjct  491  FSRITTSKGDLDPFDGLYVGAFGPYGTEVVQLRRKFGQWNGSDN-GSSEVEFFEYVEAVK  549

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK  R +N+GM+PDELGVVASYKGQGRIAE+GF+NPKWV+GE
Sbjct  550  LTGDLNVPAGQVTFRAKIGKRGRTSNRGMFPDELGVVASYKGQGRIAEFGFRNPKWVDGE  609

Query  413  LLQLNGK  393
            LLQLNGK
Sbjct  610  LLQLNGK  616



>ref|XP_001758844.1| predicted protein [Physcomitrella patens]
 gb|EDQ76350.1| predicted protein [Physcomitrella patens]
Length=588

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 123/159 (77%), Gaps = 2/159 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI  S S  DP  GLY+GAFGPY +EVVQL+RKYG+W   D   S   +EFFEYVEAV
Sbjct  428  FRRINVSDSSTDPLCGLYIGAFGPYTSEVVQLQRKYGHWETGDSGSSGQNLEFFEYVEAV  487

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD+NVPAGQVTFRA+ G+ +R +++G YP+ELGVV  YKGQGR+AE GF+NP+W++G
Sbjct  488  KLTGDLNVPAGQVTFRARTGRESRLSHRGAYPEELGVVTRYKGQGRLAEPGFRNPQWIDG  547

Query  416  ELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GKG G H  GA LGF+Y +PE  FLVLF RL L
Sbjct  548  ELVLLDGKG-GGHTNGAALGFVYSVPERHFLVLFKRLNL  585



>ref|XP_001764388.1| predicted protein [Physcomitrella patens]
 gb|EDQ70655.1| predicted protein [Physcomitrella patens]
Length=638

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSG--MEFFEYVEA  600
            F RI    S  DP  GLY+GAFGPY +EVVQL+RKYG+W   DE  +SG  +EFFEYVEA
Sbjct  478  FRRINVLESSTDPLCGLYIGAFGPYTSEVVQLQRKYGHWE-SDEASASGQNLEFFEYVEA  536

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
            VKLTGD+NVPAGQVTFRA+ G+ +R +++G YP+ELGVV  YKGQGR+AE GF+NP+W++
Sbjct  537  VKLTGDLNVPAGQVTFRARTGRESRLSHRGAYPEELGVVTRYKGQGRLAEPGFRNPQWID  596

Query  419  GELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            GEL+ L+GKG G H  GA LGF+Y +PE  FLVLF RL L
Sbjct  597  GELVLLDGKG-GGHTNGAALGFVYSVPERHFLVLFKRLNL  635



>gb|KDO37022.1| hypothetical protein CISIN_1g033722mg [Citrus sinensis]
 gb|KDO37023.1| hypothetical protein CISIN_1g033722mg [Citrus sinensis]
Length=111

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  626  MEFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEY  447
            MEFFEYVEAVKLTGD+NVPAG+VTFRAKIGKG+R  N+G +PDELGVVASY GQGRIA++
Sbjct  1    MEFFEYVEAVKLTGDLNVPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGRIADF  60

Query  446  GFKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            GF+NPKWV+GELLQLNGKG+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  61   GFRNPKWVDGELLQLNGKGMGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  111



>ref|XP_006844970.1| hypothetical protein AMTR_s00058p00181770 [Amborella trichopoda]
 gb|ERN06645.1| hypothetical protein AMTR_s00058p00181770 [Amborella trichopoda]
Length=634

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 121/162 (75%), Gaps = 3/162 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE--EKSSGMEFFEYVEA  600
            F RI       DP DGLYVGAFGP+ +EVVQL+ K G W   DE  E  S  EF +YVEA
Sbjct  474  FHRIKNGNESTDPLDGLYVGAFGPFESEVVQLRCKVGPWPRLDENDESFSNFEFCQYVEA  533

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
            VKLTGD+NVPAGQVTF AK+G+ NR  N G YP+ELGVV  YKG+GRIAE GF+NP+WV+
Sbjct  534  VKLTGDLNVPAGQVTFLAKVGQENRLVNNGSYPEELGVVMRYKGRGRIAEPGFQNPRWVD  593

Query  419  GELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            GELL  NGKG+GP + GA+LGFLY +P+ S LVLF RL LPE
Sbjct  594  GELLLFNGKGMGP-LSGAELGFLYAVPKQSLLVLFDRLILPE  634



>gb|KDO37020.1| hypothetical protein CISIN_1g033722mg [Citrus sinensis]
 gb|KDO37021.1| hypothetical protein CISIN_1g033722mg [Citrus sinensis]
Length=112

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 106/112 (95%), Gaps = 1/112 (1%)
 Frame = -2

Query  626  MEFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEY  447
            MEFFEYVEAVKLTGD+NVPAG+VTFRAKIGKG+R  N+G +PDELGVVASY GQGRIA++
Sbjct  1    MEFFEYVEAVKLTGDLNVPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGRIADF  60

Query  446  GFKNPKWVEGELLQLNGK-GVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            GF+NPKWV+GELLQLNGK G+GP++KGADLGFLYV+PE SFLVLF+RLKLP+
Sbjct  61   GFRNPKWVDGELLQLNGKVGMGPYVKGADLGFLYVVPEQSFLVLFNRLKLPD  112



>gb|KDO69688.1| hypothetical protein CISIN_1g0061462mg, partial [Citrus sinensis]
Length=112

 Score =   184 bits (467),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = -2

Query  725  LYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQVTFRA  546
            LYVGAFGPYGTEVVQL+RKYG W+  + EKSS MEFFEYVEAVKLTGD+NVPAG+VTFRA
Sbjct  1    LYVGAFGPYGTEVVQLRRKYGQWS-GEGEKSSDMEFFEYVEAVKLTGDLNVPAGEVTFRA  59

Query  545  KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGV  387
            KIGKG+R  N+G +PDELGVVASY GQGRIA++GF+NPKWV+GELLQLNGK V
Sbjct  60   KIGKGSRLPNRGKFPDELGVVASYSGQGRIADFGFRNPKWVDGELLQLNGKVV  112



>gb|AER62104.1| hypothetical protein, partial [Dasypyrum villosum]
 gb|AER62105.1| hypothetical protein, partial [Dasypyrum villosum]
Length=284

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  159  FNRIVTDSNGADPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  213

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  214  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  273

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  274  LLVLNGKSAIP  284



>gb|AER62098.1| hypothetical protein, partial [Aegilops longissima]
 gb|AER62120.1| hypothetical protein, partial [Aegilops speltoides var. ligustica]
 gb|AER62121.1| hypothetical protein, partial [Aegilops speltoides var. speltoides]
Length=282

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  271

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  272  LLVLNGKSAIP  282



>gb|AER62101.1| hypothetical protein, partial [Aegilops longissima]
Length=278

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  153  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  207

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  208  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  267

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  268  LLVLNGKSAIP  278



>gb|AER62107.1| hypothetical protein, partial [Elymus spicatus]
 gb|AER62108.1| hypothetical protein, partial [Taeniatherum caput-medusae]
 gb|AER62117.1| hypothetical protein, partial [Triticum monococcum subsp. aegilopoides]
Length=282

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  271

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  272  LLVLNGKSAIP  282



>gb|AER62099.1| hypothetical protein, partial [Aegilops tauschii]
 gb|AER62100.1| hypothetical protein, partial [Aegilops tauschii]
Length=282

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  271

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  272  LLVLNGKSAIP  282



>gb|AER62097.1| hypothetical protein, partial [Hordeum vulgare subsp. spontaneum]
Length=282

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  271

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  272  LLVLNGKSAIP  282



>gb|AER62110.1| hypothetical protein, partial [Dasypyrum villosum]
Length=284

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  159  FNRIITDSNGADPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  213

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  214  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  273

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  274  LLVLNGKSAIP  284



>gb|AER62119.1| hypothetical protein, partial [Hordeum marinum subsp. marinum]
Length=283

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  158  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  212

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  213  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  272

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  273  LLVLNGKSAIP  283



>gb|AER62116.1| hypothetical protein, partial [Henrardia persica]
Length=283

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  158  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  212

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  213  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  272

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  273  LLVLNGKSAIP  283



>gb|AER62106.1| hypothetical protein, partial [Psathyrostachys juncea]
 gb|AER62112.1| hypothetical protein, partial [Psathyrostachys juncea]
Length=282

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  271

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  272  LLVLNGKSAIP  282



>gb|AER62118.1| hypothetical protein, partial [Hordeum bogdanii]
Length=283

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  158  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  212

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  213  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  272

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  273  LLVLNGKSAIP  283



>gb|AER62111.1| hypothetical protein, partial [Agropyron mongolicum]
Length=282

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  271

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  272  LLVLNGKSAIP  282



>gb|AER62115.1| hypothetical protein, partial [Henrardia persica]
Length=283

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  158  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  212

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  213  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  272

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  273  LLVLNGKSAIP  283



>gb|AER62122.1| hypothetical protein, partial [Secale cereale]
Length=244

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  +PF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  119  FNRIVTDSNGSBPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  173

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  174  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  233

Query  413  LLQLNGKGVGP  381
            LL LNGK   P
Sbjct  234  LLVLNGKSAIP  244



>dbj|BAD94192.1| hypothetical protein [Arabidopsis thaliana]
Length=113

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  632  SGMEFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIA  453
            S +EFFEYVEAVKLTGD NVPAGQVTFRA+IG G+R TN G++P+ELGV+ASY+GQG+IA
Sbjct  1    SDIEFFEYVEAVKLTGDPNVPAGQVTFRARIGNGSRMTNHGLFPEELGVLASYRGQGKIA  60

Query  452  EYGFKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            ++GFK P+WVEG+LL+LNGKG+GP++KGADLGFLY+ PE SFLVLF+RL+LPE
Sbjct  61   DFGFKKPRWVEGKLLKLNGKGMGPYVKGADLGFLYIGPEQSFLVLFNRLRLPE  113



>ref|XP_007036194.1| EXECUTER1 protein, chloroplast, putative isoform 3 [Theobroma 
cacao]
 gb|EOY20695.1| EXECUTER1 protein, chloroplast, putative isoform 3 [Theobroma 
cacao]
Length=614

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI++   +LDPF+GLYVGAFGPYGTE+VQL+RKYG WN  D+E +S +EFFEYVEAVK
Sbjct  489  FNRISSDNGNLDPFEGLYVGAFGPYGTEIVQLRRKYGRWNDADDE-TSDVEFFEYVEAVK  547

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            LTGD+NVPAGQVTFRAKIG+ +R  N+GMYPDELGVVA YKGQGRIAE+ F+NP+WV+G
Sbjct  548  LTGDLNVPAGQVTFRAKIGRESRLPNRGMYPDELGVVACYKGQGRIAEFSFRNPRWVDG  606



>gb|AFW56323.1| hypothetical protein ZEAMMB73_718082 [Zea mays]
Length=302

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 5/127 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F  I    + +DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  179  FNWIIMDTNSMDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSFDD-----VEFFEYVEAVK  233

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  234  LTGDLSVPAGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGE  293

Query  413  LLQLNGK  393
            LL LNGK
Sbjct  294  LLVLNGK  300



>gb|EMS51015.1| hypothetical protein TRIUR3_01679 [Triticum urartu]
Length=588

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 112/150 (75%), Gaps = 5/150 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  406  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  460

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  461  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  520

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFL  324
            LL LNGK      + A    L +I   SFL
Sbjct  521  LLVLNGKVAKSRFRMAFSVILILILRGSFL  550



>ref|XP_002967707.1| hypothetical protein SELMODRAFT_227764 [Selaginella moellendorffii]
 gb|EFJ31054.1| hypothetical protein SELMODRAFT_227764 [Selaginella moellendorffii]
Length=693

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 120/158 (76%), Gaps = 2/158 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI  + S  DPF GLYVGAFG    E++QLKRKYG+W+ +       ++F+EYVEA+K
Sbjct  534  FHRIDVTESS-DPFTGLYVGAFGANTPEILQLKRKYGHWDTKRSVPDDKLKFYEYVEAIK  592

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQV+FRA+I K NR +  G+YP+ELGV+A Y+GQG++A+ GFK+PKW +GE
Sbjct  593  LTGDLNVPAGQVSFRARIAKENRMSPLGIYPEELGVIARYRGQGQLADPGFKHPKWTDGE  652

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            L+ L+G+  GP   GA LGF++ +P+H FL+LF RL L
Sbjct  653  LVLLDGRTTGP-TNGARLGFVFYLPDHHFLILFDRLNL  689



>ref|XP_002964327.1| hypothetical protein SELMODRAFT_166436 [Selaginella moellendorffii]
 gb|EFJ34660.1| hypothetical protein SELMODRAFT_166436 [Selaginella moellendorffii]
Length=684

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 120/158 (76%), Gaps = 2/158 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI  + S  DPF GLYVGAFG    E++QLKRKYG+W+ +       ++F+EYVEA+K
Sbjct  525  FHRIDVTESS-DPFTGLYVGAFGANTPEILQLKRKYGHWDTKRSVPDDKLKFYEYVEAIK  583

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQV+FRA+I K NR +  G+YP+ELGV+A Y+GQG++A+ GFK+PKW +GE
Sbjct  584  LTGDLNVPAGQVSFRARIAKENRMSPLGIYPEELGVIARYRGQGQLADPGFKHPKWTDGE  643

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            L+ L+G+  GP   GA LGF++ +P+H FL+LF RL L
Sbjct  644  LVLLDGRTTGP-TNGARLGFVFYLPDHHFLILFDRLNL  680



>ref|XP_008662557.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Zea mays]
Length=119

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 102/119 (86%), Gaps = 5/119 (4%)
 Frame = -2

Query  749  SDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVP  570
            + +DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVKLTGD++VP
Sbjct  4    NSMDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSFDD-----VEFFEYVEAVKLTGDLSVP  58

Query  569  AGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGK  393
            AGQ+TFRAKIGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GELL LNGK
Sbjct  59   AGQITFRAKIGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGELLVLNGK  117



>gb|EMT33306.1| hypothetical protein F775_23580 [Aegilops tauschii]
Length=577

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 5/128 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  424  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  478

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+WV+GE
Sbjct  479  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPRWVDGE  538

Query  413  LLQLNGKG  390
            LL LNGK 
Sbjct  539  LLVLNGKA  546



>ref|XP_002980519.1| hypothetical protein SELMODRAFT_178249 [Selaginella moellendorffii]
 gb|EFJ18170.1| hypothetical protein SELMODRAFT_178249 [Selaginella moellendorffii]
Length=590

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 118/163 (72%), Gaps = 4/163 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK--SSGMEFFEYVEA  600
            F RI  + S  DPF+ LYVG   PY ++V+QL++KYGNW   D+    S   EF EYVEA
Sbjct  426  FQRIRLAKSTADPFNALYVGTLAPYSSQVIQLRQKYGNWQEDDKSNIDSDKFEFTEYVEA  485

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
            VKL GD++VPAGQV FRAK G+G+R  ++G+YPDELGVVA +KG+G++AE GFKNP W++
Sbjct  486  VKLVGDLHVPAGQVIFRAKTGRGSRLPHRGVYPDELGVVARFKGRGKVAEPGFKNPHWID  545

Query  419  GELLQLNGK-GVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            GELL L+GK GVG  + GA L F+Y +P   FL+LF R  + E
Sbjct  546  GELLLLDGKQGVG-FLNGAQLCFVYSVPGQPFLILFRRAMIEE  587



>ref|XP_002976793.1| hypothetical protein SELMODRAFT_175826 [Selaginella moellendorffii]
 gb|EFJ21903.1| hypothetical protein SELMODRAFT_175826 [Selaginella moellendorffii]
Length=590

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 118/163 (72%), Gaps = 4/163 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK--SSGMEFFEYVEA  600
            F RI  + S  DPF+ LYVG   PY ++V+QL++KYGNW   D+    S   EF EYVEA
Sbjct  426  FQRIRLAKSTADPFNALYVGTLAPYSSQVIQLRQKYGNWQEDDKSNIDSDEFEFTEYVEA  485

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
            VKL GD++VPAGQV FRAK G+G+R  ++G+YPDELGVVA +KG+G++AE GFKNP W++
Sbjct  486  VKLVGDLHVPAGQVIFRAKTGRGSRLPHRGVYPDELGVVARFKGRGKVAEPGFKNPHWID  545

Query  419  GELLQLNGK-GVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            GELL L+GK GVG  + GA L F+Y +P   FL+LF R  + E
Sbjct  546  GELLLLDGKQGVG-FLNGAQLCFVYSVPGQPFLILFRRAMIEE  587



>ref|XP_009415820.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=645

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI +    LDPF+GLY GAFGPYGTEVV L+RKYGNWN  +   +S M FFEYVEA+K
Sbjct  496  FNRIISDNRGLDPFEGLYAGAFGPYGTEVVHLRRKYGNWNDVNG-LNSDMNFFEYVEAIK  554

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAGQVTFRAKIGK     NKG+YP+ELGVV+ YKGQGRIAE GFKNP+WV+GE
Sbjct  555  LTGDLNVPAGQVTFRAKIGKKYHLPNKGLYPEELGVVSIYKGQGRIAEPGFKNPRWVDGE  614

Query  413  LLQ  405
            LLQ
Sbjct  615  LLQ  617



>ref|XP_006852930.1| hypothetical protein AMTR_s00033p00235330 [Amborella trichopoda]
 gb|ERN14397.1| hypothetical protein AMTR_s00033p00235330 [Amborella trichopoda]
Length=726

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 6/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F RI    +  DP  GLY+GA GP+ +EV+ L+ ++G W       KS  +EF+EYVEA+
Sbjct  569  FNRIEIPATTSDPLSGLYIGAHGPHSSEVINLRCRFGQWPEDGTISKSRDLEFYEYVEAL  628

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK N+  +KG+ P+E GVVA YKGQGR+AE GFKNP+WV+G
Sbjct  629  KLTGDPYVPAGQVAFRAKIGKRNQMPHKGIIPEEFGVVARYKGQGRLAEPGFKNPRWVDG  688

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    HIK G  +GF+Y  PE+ FLV F+RL+L
Sbjct  689  ELVVLDGK----HIKSGPMVGFVYWAPEYHFLVFFNRLRL  724



>gb|KCW63352.1| hypothetical protein EUGRSUZ_G009902, partial [Eucalyptus grandis]
Length=413

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+QL+RK+G W    + K  + +EF+EYVEA+
Sbjct  257  FNRIEIPSS-FDPLNGLYIGAHGIYSSEVIQLRRKFGQWQEDGQTKDRTELEFYEYVEAL  315

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIGK  +  +KG+ P+ELGV+A YKGQGR+AE GF+NP+WV+G
Sbjct  316  KLTGDRYVPAGKVAFRAKIGKKYQLPHKGIIPEELGVIARYKGQGRLAEPGFQNPRWVDG  375

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RLKL +
Sbjct  376  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLKLQD  413



>gb|KCW63353.1| hypothetical protein EUGRSUZ_G009902, partial [Eucalyptus grandis]
 gb|KCW63354.1| hypothetical protein EUGRSUZ_G009902, partial [Eucalyptus grandis]
Length=423

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+QL+RK+G W    + K  + +EF+EYVEA+
Sbjct  267  FNRIEIPSS-FDPLNGLYIGAHGIYSSEVIQLRRKFGQWQEDGQTKDRTELEFYEYVEAL  325

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIGK  +  +KG+ P+ELGV+A YKGQGR+AE GF+NP+WV+G
Sbjct  326  KLTGDRYVPAGKVAFRAKIGKKYQLPHKGIIPEELGVIARYKGQGRLAEPGFQNPRWVDG  385

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RLKL +
Sbjct  386  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLKLQD  423



>ref|XP_010254545.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nelumbo nucifera]
 ref|XP_010254546.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nelumbo nucifera]
Length=690

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP  GLY+GA G Y +EV+ L+RK+G W      +K   +EF+EYVEA+
Sbjct  534  FNRIEIPTSS-DPLTGLYIGAHGLYTSEVIHLRRKFGQWQEDGGTQKVQNLEFYEYVEAI  592

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+GK N+  +KG+ P+E GVVA Y+GQGR+AE GF+NP+WV+G
Sbjct  593  KLTGDPYVPAGQVAFRAKVGKRNQLPHKGIIPEEFGVVARYRGQGRLAEPGFRNPRWVDG  652

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ LNGK    HIKG   +GF+Y  PE+ FLV F+RL+L E
Sbjct  653  ELVILNGK----HIKGGPVVGFVYWAPEYHFLVFFNRLRLQE  690



>ref|XP_004980176.1| PREDICTED: uncharacterized protein LOC101756047 [Setaria italica]
Length=749

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 14/156 (9%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F +I T  S  DPF+GLYVG +G +G EVV+L RK+G WN+ DEE       FEYVEA+K
Sbjct  579  FNQIVTDTSCTDPFNGLYVGEYGYHGHEVVKLSRKFGKWNITDEES------FEYVEAIK  632

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+NVPAG+ TFRAKIGKGN   N G YP+E GV+ SYKGQGRIA+ GF NP+WV+GE
Sbjct  633  LTGDVNVPAGKTTFRAKIGKGNCLENHGTYPEEFGVIESYKGQGRIADTGFINPQWVDGE  692

Query  413  LLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRL  306
            LL  NGK        + +GF++  P+  F++L+  L
Sbjct  693  LLVFNGK--------SKVGFVWNFPKPVFIILYFSL  720



>gb|AES90588.2| executer 1 [Medicago truncatula]
Length=708

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 120/162 (74%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK-SSGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA+G Y +EV+Q++R+YG W      K +S +EF+EYVEA+
Sbjct  552  FNRIEIPTS-FDPLNGLYIGAYGVYSSEVIQMRRRYGQWQEDGRAKETSDLEFYEYVEAL  610

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            K+TGD  VPAGQV FRAK+GKG +  +KG+ P+E GV+A YKG+GR+AE GF+NP+WV+G
Sbjct  611  KITGDPYVPAGQVAFRAKVGKGYQLPHKGIIPEEFGVIARYKGEGRLAEPGFQNPRWVDG  670

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    HIK G  +GF+Y  PE+ FLV F+RL+L +
Sbjct  671  ELVILDGK----HIKAGPVVGFVYWAPEYHFLVFFNRLRLQQ  708



>ref|XP_003608391.1| Protein EXECUTER [Medicago truncatula]
Length=772

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 120/162 (74%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK-SSGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA+G Y +EV+Q++R+YG W      K +S +EF+EYVEA+
Sbjct  616  FNRIEIPTS-FDPLNGLYIGAYGVYSSEVIQMRRRYGQWQEDGRAKETSDLEFYEYVEAL  674

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            K+TGD  VPAGQV FRAK+GKG +  +KG+ P+E GV+A YKG+GR+AE GF+NP+WV+G
Sbjct  675  KITGDPYVPAGQVAFRAKVGKGYQLPHKGIIPEEFGVIARYKGEGRLAEPGFQNPRWVDG  734

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    HIK G  +GF+Y  PE+ FLV F+RL+L +
Sbjct  735  ELVILDGK----HIKAGPVVGFVYWAPEYHFLVFFNRLRLQQ  772



>gb|AER62102.1| hypothetical protein, partial [Elymus libanoticus]
 gb|AER62103.1| hypothetical protein, partial [Elymus libanoticus]
Length=266

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 93/115 (81%), Gaps = 5/115 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPK  429
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+ GFKNP+
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQPGFKNPR  266



>ref|XP_002532765.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF29622.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
Length=675

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 120/160 (75%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNW-NVRDEEKSSGMEFFEYVEAV  597
            F RI TS S  DP +GLY+GA G Y +EV+ L+RK+G W + R  ++ S +EF+EYVEAV
Sbjct  520  FHRIETSASP-DPLNGLYIGAHGLYTSEVIHLQRKFGQWQDDRGTKEPSNLEFYEYVEAV  578

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+GK  +  ++G+ P+E GV+A YKGQGR+AE GF+NP+WV+G
Sbjct  579  KLTGDPYVPAGQVAFRAKVGKRYQLPHRGIIPEEFGVIARYKGQGRLAEPGFQNPRWVDG  638

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  639  ELVVLDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  674



>ref|XP_007042827.1| Executer 1 isoform 1 [Theobroma cacao]
 ref|XP_007042828.1| Executer 1 isoform 1 [Theobroma cacao]
 gb|EOX98658.1| Executer 1 isoform 1 [Theobroma cacao]
 gb|EOX98659.1| Executer 1 isoform 1 [Theobroma cacao]
Length=685

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 117/159 (74%), Gaps = 6/159 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI  + S  DP +GLY+GA G Y +EV+ L+RK+G W     ++ S +EF+EYVEAVK
Sbjct  530  FHRIEIAASP-DPLNGLYIGAHGLYTSEVIHLRRKFGQWQDSGTKEPSDLEFYEYVEAVK  588

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD  VPAGQV FRA++GK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+GE
Sbjct  589  LTGDPYVPAGQVAFRARVGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDGE  648

Query  413  LLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            L+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  649  LVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  683



>ref|XP_010065730.1| PREDICTED: protein EXECUTER 1, chloroplastic [Eucalyptus grandis]
 ref|XP_010065731.1| PREDICTED: protein EXECUTER 1, chloroplastic [Eucalyptus grandis]
Length=704

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+QL+RK+G W    + K  + +EF+EYVEA+
Sbjct  548  FNRIEIPSS-FDPLNGLYIGAHGIYSSEVIQLRRKFGQWQEDGQTKDRTELEFYEYVEAL  606

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIGK  +  +KG+ P+ELGV+A YKGQGR+AE GF+NP+WV+G
Sbjct  607  KLTGDRYVPAGKVAFRAKIGKKYQLPHKGIIPEELGVIARYKGQGRLAEPGFQNPRWVDG  666

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RLKL +
Sbjct  667  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLKLQD  704



>dbj|BAH56774.1| AT4G33630 [Arabidopsis thaliana]
Length=411

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +K + +EF+EYV
Sbjct  252  LTKFRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKPTDIEFYEYV  310

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  311  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRW  370

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  371  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  409



>ref|XP_008373217.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=681

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S LDP +GLY+GA G Y +EV+ L+RK+G W      ++   +EF+EYVEA+
Sbjct  525  FNRIEMPAS-LDPLNGLYIGAHGLYTSEVIHLRRKFGQWKEDGGTQEPLNLEFYEYVEAL  583

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGKG +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  584  KLTGDPYVPAGQVAFRAKIGKGYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  643

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L E
Sbjct  644  ELVVLDGK----YIKGGPVVGFVYWDPEYHFLVFFNRLRLQE  681



>gb|KDP29991.1| hypothetical protein JCGZ_18758 [Jatropha curcas]
Length=687

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNW-NVRDEEKSSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +EV+QL+RK+G W + R   + S +EF+EYVEAV
Sbjct  531  FHRIEISASP-DPLNGLYIGAHGLYSSEVIQLQRKFGQWQDERGTNQPSNVEFYEYVEAV  589

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  + AGQV FRAK+GK  +  +KG+ P+E GV+A YKGQGR+AE GFKNP+WV+G
Sbjct  590  KLTGDPYIAAGQVAFRAKVGKRYQLPHKGIIPEEFGVIARYKGQGRLAEPGFKNPRWVDG  649

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L +
Sbjct  650  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRLQQ  687



>ref|XP_004504847.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004504848.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Cicer arietinum]
 ref|XP_004504849.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004504850.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X4 
[Cicer arietinum]
 ref|XP_004504851.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X5 
[Cicer arietinum]
 ref|XP_004504852.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X6 
[Cicer arietinum]
Length=696

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVR-DEEKSSGMEFFEYVEAV  597
            F RI    S  DP +GLYVG +G + +EV+Q++RKYG W      E+ S +EF+EYVEA+
Sbjct  540  FNRIQIPTS-FDPLNGLYVGTYGLHSSEVIQMRRKYGQWQEDGRAEEPSDLEFYEYVEAL  598

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GV+A YKG+GR+AE GF+NP+WV+G
Sbjct  599  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVIARYKGEGRLAEPGFQNPRWVDG  658

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    HIK G  +GF+Y  PE+ FLV F+RL+L +
Sbjct  659  ELVILDGK----HIKAGPVVGFVYWAPEYHFLVFFNRLRLQQ  696



>ref|XP_010432534.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=678

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYVEAV  597
            F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   +D +K + +EF+EYVEAV
Sbjct  522  FRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKDSKKPTDIEFYEYVEAV  580

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+WV+G
Sbjct  581  KLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRWVDG  640

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  641  ELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  676



>ref|XP_010691393.1| PREDICTED: protein EXECUTER 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=709

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 115/151 (76%), Gaps = 6/151 (4%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAVKLTGDMNVPAG  564
            DP +GLY+G+ GPY +EV+QLKRK+G W      +++S + F+EYVEAVKLTGD  VPAG
Sbjct  563  DPLNGLYIGSHGPYTSEVIQLKRKFGQWQEDGGTKEASDLHFYEYVEAVKLTGDPYVPAG  622

Query  563  QVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVG  384
            QV FRAKIGK  +  +KG+ P+E GVVA YKGQGR++E GF+NP+WV+GEL+ L+GK   
Sbjct  623  QVAFRAKIGKRYQLPHKGIIPEEFGVVARYKGQGRLSEPGFRNPRWVDGELVILDGK---  679

Query  383  PHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
             +IK G  +GF+Y  PE+ FLV F+RL++ E
Sbjct  680  -YIKAGPVVGFVYWAPEYQFLVFFNRLRIEE  709



>ref|XP_008644778.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Zea mays]
Length=113

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 11/119 (9%)
 Frame = -2

Query  749  SDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVP  570
            + +DPF+GLYVGAF PYG E+VQL++K+G+WN  D+     +EFFEYVEAVKLTGD++VP
Sbjct  4    NSMDPFNGLYVGAFSPYGPEIVQLRQKFGHWNSSDD-----VEFFEYVEAVKLTGDLSVP  58

Query  569  AGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGK  393
            AGQ      IGKG R  N+G YP+E GV+ASYKGQGRIA+ GFKNP+WV+GELL LNGK
Sbjct  59   AGQ------IGKGKRLENRGAYPEEFGVIASYKGQGRIAQPGFKNPRWVDGELLVLNGK  111



>ref|XP_006412332.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
 ref|XP_006412333.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
 gb|ESQ53785.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
 gb|ESQ53786.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
Length=683

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 121/163 (74%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +KS+ +EF+EYV
Sbjct  524  LTKFRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKSTDIEFYEYV  582

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  583  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRW  642

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  643  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  681



>ref|XP_004290412.1| PREDICTED: protein EXECUTER 1, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011458399.1| PREDICTED: protein EXECUTER 1, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=658

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 118/160 (74%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+RK+G W   +  +++S +EF+EYVEA+
Sbjct  502  FNRIEMPVSQ-DPLNGLYIGAHGLYTSEVIHLRRKFGQWKENNGTKEASNLEFYEYVEAL  560

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  561  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  620

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  621  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  656



>ref|XP_004508896.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cicer arietinum]
Length=608

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 114/161 (71%), Gaps = 7/161 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI  + S  DP +GLY+GAFG +G EVVQLKRK+G W+  D+ +      FEYVEAVK
Sbjct  454  FNRINNTSSSGDPLEGLYIGAFGAHGLEVVQLKRKFGRWDDMDDTE------FEYVEAVK  507

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            LTGD+ VPAG+V FRA I + ++  N+    + +GV A+YKGQ +I+++ FKNP+W+ G+
Sbjct  508  LTGDILVPAGEVAFRAIIDRDHKNINRCRLTNTMGVDATYKGQAQISDFDFKNPRWISGD  567

Query  413  LLQLN-GKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            LL LN GKG    ++GAD+GF Y   + SF+VLF RLKLPE
Sbjct  568  LLLLNVGKGPRQILEGADMGFQYSSEDKSFIVLFFRLKLPE  608



>ref|XP_009366321.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009366322.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Pyrus x bretschneideri]
Length=678

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+RK+G W      ++   +EF+EYVEA+
Sbjct  522  FNRIEMPAS-ADPLNGLYIGAHGLYTSEVIHLRRKFGQWKENGGTQEPLNLEFYEYVEAL  580

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGKG +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  581  KLTGDPYVPAGQVAFRAKIGKGYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  640

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L E
Sbjct  641  ELVVLDGK----YIKGGPVVGFVYWDPEYHFLVFFNRLRLQE  678



>ref|XP_006283255.1| hypothetical protein CARUB_v10004291mg [Capsella rubella]
 gb|EOA16153.1| hypothetical protein CARUB_v10004291mg [Capsella rubella]
Length=676

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +K + +EF+EYV
Sbjct  517  LTKFRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKPTDIEFYEYV  575

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIGK     +KG+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  576  EAVKLTGDPYVPAGKVAFRAKIGKRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRW  635

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  636  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  674



>ref|XP_010437740.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
 ref|XP_010437741.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=675

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 118/160 (74%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYVEAV  597
            F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   +D +K + +EF+EYVEAV
Sbjct  519  FRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKDSKKPTDIEFYEYVEAV  577

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+WV+G
Sbjct  578  KLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRWVDG  637

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    + KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  638  ELVILDGK----YAKGGPVVGFVYWAPEYHFVMFFNRLRL  673



>ref|XP_008237129.1| PREDICTED: protein EXECUTER 1, chloroplastic [Prunus mume]
 ref|XP_008237130.1| PREDICTED: protein EXECUTER 1, chloroplastic [Prunus mume]
 ref|XP_008237131.1| PREDICTED: protein EXECUTER 1, chloroplastic [Prunus mume]
Length=682

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+RK+G W      +K S +EF+EYVEA+
Sbjct  526  FNRIEMPDSP-DPLNGLYIGAHGLYTSEVIHLRRKFGQWKEDGGTQKPSNLEFYEYVEAL  584

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  585  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  644

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  645  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  680



>ref|NP_567929.1| protein EXECUTER 1 [Arabidopsis thaliana]
 ref|NP_849488.1| protein EXECUTER 1 [Arabidopsis thaliana]
 sp|Q93YW0.1|EXEC1_ARATH RecName: Full=Protein EXECUTER 1, chloroplastic; Short=AtEX1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24154.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51248.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86257.1| protein EXECUTER 1 [Arabidopsis thaliana]
 gb|AEE86258.1| protein EXECUTER 1 [Arabidopsis thaliana]
Length=684

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +K + +EF+EYV
Sbjct  525  LTKFRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKPTDIEFYEYV  583

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  584  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRW  643

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  644  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  682



>ref|XP_009766666.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana sylvestris]
Length=697

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK-SSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +EV+ L+R++G W      K SS +EF+EYVEAV
Sbjct  541  FNRIEISAS-TDPLNGLYIGAHGLYTSEVIHLRRRFGQWKEEGSPKESSRLEFYEYVEAV  599

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQ+ FRA+IGK  +  +KG+ P+E GV+A Y+GQGR+AE GF+ P+WV+G
Sbjct  600  KLTGDSYVPAGQIAFRARIGKKYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRKPRWVDG  659

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F RL+L E
Sbjct  660  ELVILDGK----YIKGGPVVGFVYWDPEYHFLVFFHRLRLQE  697



>ref|XP_010447214.1| PREDICTED: protein EXECUTER 1, chloroplastic [Camelina sativa]
 ref|XP_010447215.1| PREDICTED: protein EXECUTER 1, chloroplastic [Camelina sativa]
Length=674

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYVEAV  597
            F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +K + +EF+EYVEAV
Sbjct  518  FRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKPTDIEFYEYVEAV  576

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+WV+G
Sbjct  577  KLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRWVDG  636

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  637  ELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  672



>ref|XP_002869202.1| hypothetical protein ARALYDRAFT_913050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45461.1| hypothetical protein ARALYDRAFT_913050 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 121/165 (73%), Gaps = 7/165 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +K + +EF+EYV
Sbjct  521  LTKFRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKPTDIEFYEYV  579

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  580  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRW  639

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L +
Sbjct  640  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRLQD  680



>ref|XP_009400393.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400394.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400395.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400396.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=712

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQ  561
            DP  GLY+G+ G Y + V+ LKRKYG W     +    +EF+EYVEA+KLTGD +VPAGQ
Sbjct  567  DPLSGLYIGSHGMYSSNVLHLKRKYGQWQEDYTQGKMNLEFYEYVEAIKLTGDPSVPAGQ  626

Query  560  VTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGP  381
            V FRAK+GK N+  +KG+ P+E GV+A YKGQGR+A+ GF+NP+WV+GEL+  +GK    
Sbjct  627  VAFRAKVGKQNQLPHKGIIPEEFGVIARYKGQGRLADPGFRNPRWVDGELVIFDGK----  682

Query  380  HIKGAD-LGFLYVIPEHSFLVLFSRLKLP  297
            +I+G   +GF+Y  PE  FL+ F+RLKLP
Sbjct  683  YIRGGPVIGFVYWAPESHFLLFFNRLKLP  711



>ref|XP_010527017.1| PREDICTED: LOW QUALITY PROTEIN: protein EXECUTER 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=709

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNW-NVRDEEKSSGMEFFEYVEAV  597
            F RI    S  DP DGLY+GA G Y +EV+ LKRK+G W + ++ +KS+ +EF+EYVEAV
Sbjct  553  FRRIDVMPSP-DPLDGLYMGAHGLYTSEVIHLKRKFGQWKDDKESKKSTEIEFYEYVEAV  611

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+WV+G
Sbjct  612  KLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRWVDG  671

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    ++KG   +GF+Y  PE+ F+V F+RL+L
Sbjct  672  ELVILDGK----YVKGGPVVGFVYWAPEYHFVVFFNRLRL  707



>gb|KJB79577.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
 gb|KJB79579.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
Length=683

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI TS S  DP +GLYVGA G Y +EV+ L+RK+G W      K  S +EF+EYVEA 
Sbjct  527  FHRIETSASP-DPLNGLYVGAHGLYTSEVIHLRRKFGQWQGDSGTKEPSDLEFYEYVEAE  585

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRA++GK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  586  KLTGDPYVPAGQVAFRARVGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  645

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FL  F+RL+L
Sbjct  646  ELVILDGK----YIKGGPVVGFVYWAPEYHFLAFFNRLRL  681



>ref|XP_003528395.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=699

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+R++G W   +  K  S +EF+EYVEA+
Sbjct  543  FNRIEIPTS-FDPLNGLYIGAHGLYSSEVIHLRRRFGQWQEDNGAKEPSNLEFYEYVEAL  601

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GV+A YKG+GR+AE GF+NP+WV+G
Sbjct  602  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVIARYKGEGRLAEPGFQNPRWVDG  661

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    H+K G  +GF+Y  PE+ FLV F+RL+L +
Sbjct  662  ELVILDGK----HLKAGPVVGFVYWAPEYHFLVFFNRLRLQQ  699



>ref|XP_009108781.1| PREDICTED: protein EXECUTER 1, chloroplastic [Brassica rapa]
 emb|CDY48441.1| BnaA08g11500D [Brassica napus]
Length=696

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S  DP DGLY+GA G Y +EV+ LKRK+G W   ++ +KS+ +EF+EYV
Sbjct  537  LTKFRRIDVTPSP-DPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKSTDIEFYEYV  595

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  596  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRW  655

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  656  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  694



>ref|XP_007199722.1| hypothetical protein PRUPE_ppa002360mg [Prunus persica]
 gb|EMJ00921.1| hypothetical protein PRUPE_ppa002360mg [Prunus persica]
Length=682

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+RK+G W      ++ S +EF+EYVEA+
Sbjct  526  FNRIEMPDSP-DPLNGLYIGAHGLYTSEVIHLRRKFGQWKEDGGTQEPSNLEFYEYVEAL  584

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  585  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  644

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L +
Sbjct  645  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRLQQ  682



>ref|XP_004230540.1| PREDICTED: protein EXECUTER 1, chloroplastic [Solanum lycopersicum]
Length=692

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK-SSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +EV+  +R++G W      K SS +EF+EYVEAV
Sbjct  536  FNRIEISTSP-DPLNGLYIGAHGLYTSEVIHFRRRFGQWKEDGSPKESSRLEFYEYVEAV  594

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQ+ FRA+IGK  +  +KG+ P+E GV+A Y+GQGR+AE GF+NP+WV+G
Sbjct  595  KLTGDSYVPAGQIAFRARIGKKYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRNPRWVDG  654

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F RL+L E
Sbjct  655  ELVILDGK----YIKGGPVVGFVYWDPEYHFLVFFHRLRLQE  692



>ref|XP_008776947.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=705

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F RI    +  DP  GLYVGA G Y +E++ LKRK+G W      +K + +EF+EYVEA+
Sbjct  549  FNRIEIPATS-DPLTGLYVGAHGMYTSEILHLKRKFGQWQEDPATQKQANLEFYEYVEAI  607

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD++VPAGQVTFRAKIGK  +  +KG+ P+E GVVA YKGQGR+A+ GF+NP+WV+G
Sbjct  608  KLTGDLSVPAGQVTFRAKIGKQYQLPHKGIIPEEFGVVARYKGQGRLADPGFRNPRWVDG  667

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +I+G   +GF+Y    ++ L+ F+RLKLP+
Sbjct  668  ELVILDGK----YIRGGPVIGFVYWTSGYNILLFFNRLKLPD  705



>ref|XP_008776948.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=701

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F RI    +  DP  GLYVGA G Y +E++ LKRK+G W      +K + +EF+EYVEA+
Sbjct  545  FNRIEIPATS-DPLTGLYVGAHGMYTSEILHLKRKFGQWQEDPATQKQANLEFYEYVEAI  603

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD++VPAGQVTFRAKIGK  +  +KG+ P+E GVVA YKGQGR+A+ GF+NP+WV+G
Sbjct  604  KLTGDLSVPAGQVTFRAKIGKQYQLPHKGIIPEEFGVVARYKGQGRLADPGFRNPRWVDG  663

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +I+G   +GF+Y    ++ L+ F+RLKLP+
Sbjct  664  ELVILDGK----YIRGGPVIGFVYWTSGYNILLFFNRLKLPD  701



>ref|XP_006351723.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Solanum tuberosum]
Length=691

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK-SSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +E++  +R++G W      K SS +EF+EYVEAV
Sbjct  535  FNRIEISPSP-DPLNGLYIGAHGLYTSEIIHFRRRFGQWKEDGSPKESSRLEFYEYVEAV  593

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQ+ FRA+IGK  +  +KG+ P+E GV+A Y+GQGR+AE GF+NP+WV+G
Sbjct  594  KLTGDSYVPAGQIAFRARIGKKYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRNPRWVDG  653

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F RL+L E
Sbjct  654  ELVILDGK----YIKGGPVVGFVYWDPEYHFLVFFHRLRLQE  691



>ref|XP_009138201.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Brassica rapa]
Length=689

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP +GLY+GA G Y +EV+ LKRK+G W   ++ +K   +EF+EYV
Sbjct  530  LTKFRRIDVTPS-LDPLNGLYIGAHGLYTSEVIHLKRKFGQWKSGKESKKPKDIEFYEYV  588

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  589  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRW  648

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ ++GK    ++KG   +GF+Y  PE+ F++ F+RLKL
Sbjct  649  VDGELVIMDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLKL  687



>ref|XP_011043046.1| PREDICTED: protein EXECUTER 1, chloroplastic [Populus euphratica]
Length=677

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +EV+ L+RK+G W      ++SS +EF+EYVEAV
Sbjct  521  FHRIEISTSP-DPLNGLYIGAHGLYTSEVIHLQRKFGQWQEDHGTKESSNLEFYEYVEAV  579

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+GK  +  ++G+ P+E GV+A YKGQGR+AE GF+N +WV+G
Sbjct  580  KLTGDPYVPAGQVAFRAKVGKRYQLPHRGIIPEEFGVIARYKGQGRLAEPGFRNHRWVDG  639

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L +
Sbjct  640  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRLQQ  677



>ref|XP_009368302.1| PREDICTED: protein EXECUTER 1, chloroplastic [Pyrus x bretschneideri]
Length=708

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP +G+Y+GA G + +EV+ L+RK+G W      E+   +EF+EYVEA+
Sbjct  552  FNRIEMPASP-DPLNGIYIGAHGLHTSEVIHLRRKFGQWKEDGGTEEPLNLEFYEYVEAL  610

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGKG +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  611  KLTGDPYVPAGQVAFRAKIGKGYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  670

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE  FL  F+RL+L E
Sbjct  671  ELVILDGK----YIKGGPVVGFVYWAPEDHFLAFFNRLRLQE  708



>gb|KHG21655.1| Protein EXECUTER 1, chloroplastic [Gossypium arboreum]
Length=679

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI  + S  DP +GLY+G  G Y +EV+ LKRK+G W      K  S +EF+EYVEAV
Sbjct  523  FHRIEIAASP-DPLNGLYIGTHGLYTSEVIHLKRKFGQWQGDSGTKEPSDLEFYEYVEAV  581

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRA++GK  +  + G+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  582  KLTGDPYVPAGQVAFRARVGKRYQLPHNGLIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  641

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  642  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  677



>ref|XP_007159151.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
 ref|XP_007159152.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
 gb|ESW31145.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
 gb|ESW31146.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
Length=684

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+R++G W   +  K  S +EF+EYVEA+
Sbjct  528  FNRIKIPTS-FDPLNGLYIGAHGLYSSEVIHLRRRFGQWEEDNGAKEPSDLEFYEYVEAL  586

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GV+A YKG+GR+AE GF+NP+WV+G
Sbjct  587  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVIARYKGEGRLAEPGFQNPRWVDG  646

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    H+K G  +GF+Y  PE+ FLV F+RL L +
Sbjct  647  ELVVLDGK----HLKAGPVVGFVYWAPEYHFLVFFNRLGLQQ  684



>gb|KJB77570.1| hypothetical protein B456_012G144000 [Gossypium raimondii]
Length=679

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI  + S  DP +GLY+G  G Y +EV+ LKRK+G W      K  S +EF+EYVEAV
Sbjct  523  FHRIEIAASP-DPLNGLYIGTHGLYTSEVIHLKRKFGQWQGDSGTKEPSDLEFYEYVEAV  581

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRA++GK  +  + G+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  582  KLTGDPYVPAGQVAFRARVGKRYQLPHNGLIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  641

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  642  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  677



>ref|XP_003541783.2| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=643

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F+RI    S LDP +GLY+GA G Y +EV+QL+ +YG W      K  S +EF EYVEA+
Sbjct  487  FSRIEIPTS-LDPLNGLYIGAHGLYSSEVIQLRCRYGQWQEDGGPKEPSDLEFCEYVEAL  545

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VP GQV FRAK+GK  +   KG+ P E GV+A YKGQGR+AE  F+NP+WV+G
Sbjct  546  KLTGDSYVPVGQVAFRAKVGKRYQLPLKGIIPKEFGVIARYKGQGRLAEPRFENPRWVDG  605

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IK G  +GF+Y+ PE+ FLVLF+RL+L
Sbjct  606  ELVILDGK----YIKAGLVIGFMYLTPENPFLVLFNRLRL  641



>emb|CDY28313.1| BnaC03g66460D [Brassica napus]
Length=699

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S  DP  GLY+GA G Y +EV+ LKRK+G W   ++ +KS+ +EF+EYV
Sbjct  540  LTKFRRIDVTPSP-DPLHGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKSTDIEFYEYV  598

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  599  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRW  658

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RL+L
Sbjct  659  VDGELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLRL  697



>ref|XP_002323934.2| hypothetical protein POPTR_0017s07060g [Populus trichocarpa]
 gb|EEF04067.2| hypothetical protein POPTR_0017s07060g [Populus trichocarpa]
Length=677

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 118/162 (73%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +EV+ L+RK+G W      ++SS +EF+EYVEAV
Sbjct  521  FHRIEISTSP-DPLNGLYIGAHGLYTSEVIHLQRKFGQWQEDHGTKESSNLEFYEYVEAV  579

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+GK  +  ++G+ P+E GV+A YKGQG++AE GF+N +WV+G
Sbjct  580  KLTGDPYVPAGQVAFRAKVGKRYQLPHRGIIPEEFGVIARYKGQGKLAEPGFRNHRWVDG  639

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L +
Sbjct  640  ELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRLQQ  677



>gb|KHN19019.1| Protein EXECUTER 1, chloroplastic [Glycine soja]
Length=636

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F+RI    S LDP +GLY+GA G Y +EV+QL+ +YG W      K  S +EF EYVEA+
Sbjct  480  FSRIEIPTS-LDPLNGLYIGAHGLYSSEVIQLRCRYGQWQEDGGPKEPSDLEFCEYVEAL  538

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VP GQV FRAK+GK  +   KG+ P E GV+A YKGQGR+AE  F+NP+WV+G
Sbjct  539  KLTGDSYVPVGQVAFRAKVGKRYQLPLKGIIPKEFGVIARYKGQGRLAEPRFENPRWVDG  598

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IK G  +GF+Y+ PE+ FLVLF+RL+L
Sbjct  599  ELVILDGK----YIKAGLVIGFMYLTPENPFLVLFNRLRL  634



>ref|XP_009602483.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana tomentosiformis]
Length=697

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK-SSGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +EV+ L+R++G W      K SS +EF+EYVEAV
Sbjct  541  FNRIEISASP-DPLNGLYIGAHGLYTSEVIHLRRRFGQWKEDGSPKESSRLEFYEYVEAV  599

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG++ FRA+IG   +  +KG+ P+E GV+A Y+GQGR+AE GF+ P+WV+G
Sbjct  600  KLTGDSYVPAGEIAFRARIGNKYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRKPRWVDG  659

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +IKG   +GF+Y  PE+ FLV F RL+L E
Sbjct  660  ELVILDGK----YIKGGPVVGFVYWDPEYHFLVFFHRLRLQE  697



>emb|CDY46102.1| BnaA03g52660D [Brassica napus]
Length=692

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 118/163 (72%), Gaps = 7/163 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYV  606
            +  F RI  + S LDP +GLY+GA G Y +EV+ LKRK+G W   ++ +K   +EF+EYV
Sbjct  533  LTKFRRIDVTPS-LDPLNGLYIGAHGLYTSEVIHLKRKFGQWKSGKESKKPKDIEFYEYV  591

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+W
Sbjct  592  EAVKLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRW  651

Query  425  VEGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            V+GEL+ ++GK    ++KG   +GF+Y  PE+ F++ F+RL L
Sbjct  652  VDGELVIMDGK----YVKGGPVVGFVYWAPEYQFVMFFNRLML  690



>ref|XP_011087954.1| PREDICTED: protein EXECUTER 1, chloroplastic [Sesamum indicum]
Length=698

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVR-DEEKSSGMEFFEYVEAV  597
            F RI  S S  DP DGLY+GA G Y +EV+ LKR++G W      +K+S ++F+EYVEAV
Sbjct  543  FNRIDVSTSS-DPLDGLYIGAHGLYTSEVIHLKRRFGQWKEDGSTKKASKLKFYEYVEAV  601

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+GK  +  +KG+ P+E GV+A Y+GQGR+AE GF++P+WV+G
Sbjct  602  KLTGDAYVPAGQVAFRAKVGKRYQLPHKGIIPEEFGVIARYRGQGRLAEPGFQDPRWVDG  661

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+  LV F RL+L
Sbjct  662  ELVILDGK----YIKGGPVVGFVYWAPEY-HLVFFHRLRL  696



>ref|XP_008382213.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=598

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI    S  DP +G+Y+GA G + +EV++L+RK+G W      E+   +EF+EY EA+
Sbjct  420  FNRIEMRASP-DPLNGIYIGAHGLHTSEVIRLRRKFGQWKEDGGTEEPLNLEFYEYXEAL  478

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGKG +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  479  KLTGDPYVPAGQVAFRAKIGKGYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVBG  538

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE+ FL  F+RL L
Sbjct  539  ELVILDGK----YIKGGPVVGFVYWAPEYHFLAFFNRLXL  574



>ref|XP_006494691.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006494692.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Citrus sinensis]
 ref|XP_006494693.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Citrus sinensis]
 ref|XP_006494694.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X4 
[Citrus sinensis]
Length=684

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 119/162 (73%), Gaps = 11/162 (7%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE---EKSSGMEFFEYVE  603
            F RI T+ S  D  +GLY+GA G + +EV+ L+RK+G W  +D+   +  S +EF+EYVE
Sbjct  529  FHRIETATSQ-DALNGLYIGAHGLHTSEVINLRRKFGQW--QDDGGIKNPSNLEFYEYVE  585

Query  602  AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
            A+K+TGD  VPAGQV FRAK+GK  +  +KG+ P+E GV+A YKGQGR+AE GF+NP+WV
Sbjct  586  AIKVTGDPYVPAGQVAFRAKVGKRYQLPHKGIIPEEFGVIARYKGQGRLAEPGFQNPRWV  645

Query  422  EGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            +GEL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  646  DGELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  683



>ref|XP_007148360.1| hypothetical protein PHAVU_006G201700g [Phaseolus vulgaris]
 gb|ESW20354.1| hypothetical protein PHAVU_006G201700g [Phaseolus vulgaris]
Length=510

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 116/162 (72%), Gaps = 10/162 (6%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F+RI    S LDP +GLY+ A GPY TEV+QL+ +YG W     +++SS ++F++YVEA+
Sbjct  353  FSRIEIPTS-LDPLNGLYISAHGPYSTEVIQLRCRYGYWQEDGGKKESSDLKFYQYVEAL  411

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+G+ +R    GM   ELG++A Y+GQGRIAE GF+NP+WV+G
Sbjct  412  KLTGDPFVPAGQVAFRAKVGERHRLPPSGMISKELGLIARYRGQGRIAEPGFQNPRWVDG  471

Query  416  ELLQLNGK---GVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK     GP +     GFLY +P+  ++VL+S L+L
Sbjct  472  ELVILDGKFFLKTGPVV-----GFLYWVPKRPYIVLWSPLRL  508



>ref|XP_007148361.1| hypothetical protein PHAVU_006G201700g [Phaseolus vulgaris]
 gb|ESW20355.1| hypothetical protein PHAVU_006G201700g [Phaseolus vulgaris]
Length=629

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 116/162 (72%), Gaps = 10/162 (6%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F+RI    S LDP +GLY+ A GPY TEV+QL+ +YG W     +++SS ++F++YVEA+
Sbjct  472  FSRIEIPTS-LDPLNGLYISAHGPYSTEVIQLRCRYGYWQEDGGKKESSDLKFYQYVEAL  530

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+G+ +R    GM   ELG++A Y+GQGRIAE GF+NP+WV+G
Sbjct  531  KLTGDPFVPAGQVAFRAKVGERHRLPPSGMISKELGLIARYRGQGRIAEPGFQNPRWVDG  590

Query  416  ELLQLNGK---GVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK     GP +     GFLY +P+  ++VL+S L+L
Sbjct  591  ELVILDGKFFLKTGPVV-----GFLYWVPKRPYIVLWSPLRL  627



>gb|AER62113.1| hypothetical protein, partial [Australopyrum retrofractum]
Length=259

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 5/108 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAE  450
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA+
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIAQ  259



>emb|CDO97385.1| unnamed protein product [Coffea canephora]
Length=695

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVR-DEEKSSGMEFFEYVEAV  597
            F+RI   G+  DP +GLY+GA G Y +EV+ L+RK+G W     +E+   + F+EYVEAV
Sbjct  539  FSRIDIPGNQ-DPLNGLYIGAHGLYTSEVIHLRRKFGQWKEDGRKEEPPNVGFYEYVEAV  597

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQ+ FRAK+G   +  +KG+ P+E GVVA Y+GQGR+AE GF+NP+WV+G
Sbjct  598  KLTGDPYVPAGQIAFRAKVGNRYQLPHKGIIPEEFGVVARYRGQGRLAEPGFRNPRWVDG  657

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG   +GF+Y  PE  FLV F+RL+L
Sbjct  658  ELVILDGK----YIKGGPVVGFVYWAPEFHFLVFFNRLRL  693



>gb|AER62109.1| hypothetical protein, partial [Taeniatherum caput-medusae]
Length=258

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  157  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  211

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIA  453
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E GV ASYKGQGRIA
Sbjct  212  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEEFGVTASYKGQGRIA  258



>gb|KDO53998.1| hypothetical protein CISIN_1g0056622mg, partial [Citrus sinensis]
Length=451

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 117/162 (72%), Gaps = 11/162 (7%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE---EKSSGMEFFEYVE  603
            F RI T+ S  D  +GLY+G  G   +EV+ L+RK+G W  +D+   +  S +EF+EYVE
Sbjct  296  FHRIETATSQ-DALNGLYIGVHGLRTSEVINLRRKFGQW--QDDGGIKNPSNLEFYEYVE  352

Query  602  AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
            A+K+TGD  VPAGQV FRAK+GK  +  +KG+ P+E GV+A YKGQGR+AE GF+NP+WV
Sbjct  353  AIKVTGDPYVPAGQVAFRAKVGKRYQLPHKGIIPEEFGVIARYKGQGRLAEPGFQNPRWV  412

Query  422  EGELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            +GEL+ L+GK    +IKG   +GF+Y  PE+ FLV F+RL+L
Sbjct  413  DGELVILDGK----YIKGGPVVGFVYWAPEYHFLVFFNRLRL  450



>ref|XP_010943896.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=702

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F RI    +  DP  GLYVGA G Y +E++ LKRK+G W      +K   +EF+EYVEA+
Sbjct  546  FNRIEIPATS-DPLTGLYVGAHGMYTSEILYLKRKFGQWQEDAAIQKQGNLEFYEYVEAI  604

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD +VPAGQV FRAKIGK  +  +KG+ P+E GVVA YKGQGR+A+ GF+NP+WV+G
Sbjct  605  KLTGDHSVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVVARYKGQGRLADPGFRNPQWVDG  664

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +I+G   +GF+Y    ++ L+ F+RLKLP+
Sbjct  665  ELVILDGK----YIRGGPVIGFVYWTSGYNILLFFNRLKLPD  702



>ref|XP_003532602.2| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Glycine max]
Length=699

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+GA G Y +EV+ L+R++G W   +  K  S +EF+EYVEA+
Sbjct  543  FNRIEIPAS-FDPLNGLYIGAHGLYSSEVIHLRRRFGQWQEDNGAKEPSNIEFYEYVEAL  601

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAKIGK  +  +KG+ P+E GV+A YKG+GR+AE GF+N +WV+G
Sbjct  602  KLTGDPYVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVIARYKGEGRLAEPGFQNARWVDG  661

Query  416  ELLQLNGKGVGPHIK-GADLGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    H+K G  +GF+Y  P + FLV F+RL+L +
Sbjct  662  ELVILDGK----HLKAGPVVGFVYWAPGYHFLVFFNRLRLQQ  699



>ref|XP_010943895.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=706

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 7/162 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAV  597
            F RI    +  DP  GLYVGA G Y +E++ LKRK+G W      +K   +EF+EYVEA+
Sbjct  550  FNRIEIPATS-DPLTGLYVGAHGMYTSEILYLKRKFGQWQEDAAIQKQGNLEFYEYVEAI  608

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD +VPAGQV FRAKIGK  +  +KG+ P+E GVVA YKGQGR+A+ GF+NP+WV+G
Sbjct  609  KLTGDHSVPAGQVAFRAKIGKRYQLPHKGIIPEEFGVVARYKGQGRLADPGFRNPQWVDG  668

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            EL+ L+GK    +I+G   +GF+Y    ++ L+ F+RLKLP+
Sbjct  669  ELVILDGK----YIRGGPVIGFVYWTSGYNILLFFNRLKLPD  706



>ref|XP_002271011.1| PREDICTED: protein EXECUTER 1, chloroplastic [Vitis vinifera]
 emb|CBI38225.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+G+ G Y +E++ L+RK+G W      K  S +EF+EYVEA+
Sbjct  546  FNRIEIPASP-DPLNGLYIGSHGLYTSEIIHLRRKFGQWKEDAGAKEPSNLEFYEYVEAL  604

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRAK+GK  +  +KG+ P+E GV+A Y+GQGR+AE GF+NP+WV+G
Sbjct  605  KLTGDPYVPAGQVAFRAKVGKRYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRNPRWVDG  664

Query  416  ELLQLNGKGVGPHIKGADL-GFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    +IKG  + GF+Y  P + FLV F+RL L
Sbjct  665  ELVILDGK----YIKGGPIVGFVYWAPGYHFLVFFNRLML  700



>ref|XP_004165367.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cucumis sativus]
Length=685

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD--EEKSSGMEFFEYVEA  600
            F RI    S  DP +GLY+GA G Y +E++ L+R++G W      +++ S +EF+EYVEA
Sbjct  528  FNRIEIPASS-DPLNGLYIGAHGIYTSEIIHLRRRFGRWQEDGGGDKEPSKLEFYEYVEA  586

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
             K+ GD  VPAG+V FRAK+GK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+
Sbjct  587  WKVIGDPYVPAGKVAFRAKVGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVD  646

Query  419  GELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            GEL+ L+GK    +IKG   +GF+Y  PE  FLV F+RL+L E
Sbjct  647  GELVILDGK----YIKGGPVVGFVYWAPEFHFLVFFNRLRLQE  685



>ref|XP_004137062.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cucumis sativus]
 gb|KGN43753.1| hypothetical protein Csa_7G065120 [Cucumis sativus]
Length=700

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD--EEKSSGMEFFEYVEA  600
            F RI    S  DP +GLY+GA G Y +E++ L+R++G W      +++ S +EF+EYVEA
Sbjct  543  FNRIEIPASS-DPLNGLYIGAHGIYTSEIIHLRRRFGRWQEDGGGDKEPSKLEFYEYVEA  601

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
             K+ GD  VPAG+V FRAK+GK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+
Sbjct  602  WKVIGDPYVPAGKVAFRAKVGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVD  661

Query  419  GELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            GEL+ L+GK    +IKG   +GF+Y  PE  FLV F+RL+L E
Sbjct  662  GELVILDGK----YIKGGPVVGFVYWAPEFHFLVFFNRLRLQE  700



>emb|CDX72417.1| BnaC07g44390D [Brassica napus]
Length=683

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 116/160 (73%), Gaps = 7/160 (4%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSS-GMEFFEYVEAV  597
            F RI  + S LDP +GLY+GA G   +EV+ LKRK+G W    E K S  +EF+EYVEAV
Sbjct  527  FRRIDVTPS-LDPLNGLYIGAHGLNTSEVIHLKRKFGQWKGGKESKKSKDIEFYEYVEAV  585

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIG+     ++G+ P+E GV+A YKGQGR+A+ GF+NP+WV+G
Sbjct  586  KLTGDPYVPAGKVAFRAKIGRRYELPHRGLIPEEFGVIARYKGQGRLADPGFRNPRWVDG  645

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKL  300
            EL+ L+GK    ++KG   +GF+Y  PE+ F++ F+RLKL
Sbjct  646  ELVILDGK----YVKGGPVVGFVYWAPEYHFVMFFNRLKL  681



>ref|XP_008455152.1| PREDICTED: protein EXECUTER 1, chloroplastic [Cucumis melo]
Length=695

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD--EEKSSGMEFFEYVEA  600
            F RI    S  DP +GLY+GA G Y +E++ L+R++G W      +++ S +EF+EYVEA
Sbjct  538  FDRIEIPTSS-DPLNGLYIGAHGIYTSEIIHLRRRFGRWQEDGGGDKEPSKLEFYEYVEA  596

Query  599  VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVE  420
             K+ GD  VPAG+V FRAK+GK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+
Sbjct  597  WKVIGDPYVPAGKVAFRAKVGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVD  656

Query  419  GELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLVLFSRLKLPE  294
            GEL+ L+GK    +IKG   +GF+Y  PE  FLV F+RL+L E
Sbjct  657  GELVILDGK----YIKGGPVVGFVYWAPEFHFLVFFNRLRLQE  695



>ref|XP_001762431.1| predicted protein [Physcomitrella patens]
 gb|EDQ72898.1| predicted protein, partial [Physcomitrella patens]
Length=112

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = -2

Query  623  EFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYG  444
            E FEYVEAVKLTGD+NVPAGQV+FRAK+GKG+R  ++G+YP+ELGV A YKGQ R+AE G
Sbjct  1    ECFEYVEAVKLTGDVNVPAGQVSFRAKVGKGSRLPHRGVYPEELGVTARYKGQARMAEPG  60

Query  443  FKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            FKNP+WV+GEL+ LNGKG GP   GA+LGF+ + P   FLVLF RLKL
Sbjct  61   FKNPQWVDGELVLLNGKG-GP-TSGAELGFVCLGPGSHFLVLFGRLKL  106



>gb|KJB53137.1| hypothetical protein B456_008G294800 [Gossypium raimondii]
Length=593

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI++   +LDPF+GLYVGAFGPYGTE+VQL+RKYG W+  D+E SS +EFFEYVEAVK
Sbjct  496  FNRISSDNGNLDPFEGLYVGAFGPYGTEIVQLRRKYGRWSDADDE-SSDVEFFEYVEAVK  554

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVA  480
            LTGD+NVPAGQVTFRAKIG+ +R +N+G+YPDELGVVA
Sbjct  555  LTGDLNVPAGQVTFRAKIGRESRLSNRGLYPDELGVVA  592



>gb|KHG21654.1| Protein EXECUTER 1, chloroplastic [Gossypium arboreum]
Length=724

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 108/153 (71%), Gaps = 7/153 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI  + S  DP +GLY+G  G Y +EV+ LKRK+G W      K  S +EF+EYVEAV
Sbjct  523  FHRIEIAASP-DPLNGLYIGTHGLYTSEVIHLKRKFGQWQGDSGTKEPSDLEFYEYVEAV  581

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRA++GK  +  + G+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  582  KLTGDPYVPAGQVAFRARVGKRYQLPHNGLIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  641

Query  416  ELLQLNGKGVGPHIKGAD-LGFLYVIPEHSFLV  321
            EL+ L+GK    +IKG   +GF+Y  PE+ FL+
Sbjct  642  ELVILDGK----YIKGGPVVGFVYWAPEYHFLI  670



>ref|XP_010101202.1| hypothetical protein L484_015006 [Morus notabilis]
 gb|EXB87876.1| hypothetical protein L484_015006 [Morus notabilis]
Length=630

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 6/100 (6%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNW---NVRDEEKSSGMEFFEYVE  603
            F RI +S  DLDPFDGLYVGAFGPYGTEVVQL+RK+G+W   NV+D   SS +EFFEYVE
Sbjct  493  FNRINSSNGDLDPFDGLYVGAFGPYGTEVVQLRRKFGHWNGSNVKD--NSSDVEFFEYVE  550

Query  602  AVKLTGDMNVPAGQVTFRAKIGKG-NRFTNKGMYPDELGV  486
            AVKLTGD+NVPAGQVTFRAKIG+G NR +N+GMYPDELGV
Sbjct  551  AVKLTGDLNVPAGQVTFRAKIGRGNNRISNRGMYPDELGV  590



>ref|XP_001771979.1| predicted protein [Physcomitrella patens]
 gb|EDQ63240.1| predicted protein, partial [Physcomitrella patens]
Length=108

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = -2

Query  623  EFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYG  444
            E FEYVEAVKLTGD++VPAG+V+FRAK+GKG+R  ++G+YP+ELGV A YKGQ R+AE G
Sbjct  1    ECFEYVEAVKLTGDVHVPAGEVSFRAKVGKGSRLPHRGVYPEELGVTARYKGQARMAEPG  60

Query  443  FKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKL  300
            FKNP+WV+GEL+ LNGKG GP I GA+LGF+Y  P + FLVLF RL+L
Sbjct  61   FKNPQWVDGELVFLNGKG-GPTI-GAELGFVYFGPGNHFLVLFGRLRL  106



>ref|XP_003084183.1| unnamed protein product [Ostreococcus tauri]
Length=580

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = -2

Query  773  FTRIT---TSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVE  603
            F RI     SGS  D FD LY+GAFGP+G EV++L R  G W   DE+  S     + V 
Sbjct  418  FQRIDPSLASGSRKDIFDRLYIGAFGPHGPEVLRLVR--GRWG--DEDGDSN----DCVT  469

Query  602  AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
            AVKLTGD NVP G  +FRAK+ K N  T  G YPD+LGV+A YKG+GR+A+ GF    WV
Sbjct  470  AVKLTGDENVPCGAASFRAKVNKSNLITEGGSYPDDLGVIARYKGEGRVAKPGFTESHWV  529

Query  422  EGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
            EGELL LNG+G G    GA+LGF++ +P E   L+LFS L LPE
Sbjct  530  EGELLVLNGRG-GSLTGGAELGFVWAVPGERRLLILFSALALPE  572



>emb|CEG00751.1| Protein of unknown function DUF3506 [Ostreococcus tauri]
Length=749

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = -2

Query  773  FTRIT---TSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVE  603
            F RI     SGS  D FD LY+GAFGP+G EV++L R  G W   DE+  S     + V 
Sbjct  587  FQRIDPSLASGSRKDIFDRLYIGAFGPHGPEVLRLVR--GRWG--DEDGDSN----DCVT  638

Query  602  AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
            AVKLTGD NVP G  +FRAK+ K N  T  G YPD+LGV+A YKG+GR+A+ GF    WV
Sbjct  639  AVKLTGDENVPCGAASFRAKVNKSNLITEGGSYPDDLGVIARYKGEGRVAKPGFTESHWV  698

Query  422  EGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
            EGELL LNG+G G    GA+LGF++ +P E   L+LFS L LPE
Sbjct  699  EGELLVLNGRG-GSLTGGAELGFVWAVPGERRLLILFSALALPE  741



>gb|EPS72739.1| hypothetical protein M569_02016, partial [Genlisea aurea]
Length=621

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI  S S  DP +GLY+GA G Y +E++ +KRK+G W     +K+ S +EF+EYVEA+
Sbjct  495  FNRIYVSSS-ADPLNGLYIGAHGMYTSEIIHMKRKFGQWKDDASKKTPSKLEFYEYVEAI  553

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            K+TGD  VPAGQV FRAK+GKG +  +KG+ P+E GV+A Y+GQGR+AE GF+NP+WV+G
Sbjct  554  KITGDAYVPAGQVAFRAKVGKGFQLPHKGIIPEEFGVIARYRGQGRLAEPGFRNPRWVDG  613

Query  416  ELLQLNGK  393
            EL+ L+GK
Sbjct  614  ELVVLDGK  621



>emb|CAA20576.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80080.1| hypothetical protein [Arabidopsis thaliana]
Length=750

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNV-RDEEKSSGMEFFEYVEAV  597
            F RI  + S LDP DGLY+GA G Y +EV+ LKRK+G W   ++ +K + +EF+EYVEAV
Sbjct  603  FRRIDVTPS-LDPLDGLYIGAHGLYTSEVIHLKRKFGQWKGGKESKKPTDIEFYEYVEAV  661

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAG+V FRAKIG+     +KG+ P+E GV+A YKGQGR+A+ GF+NP+WV+G
Sbjct  662  KLTGDPYVPAGKVAFRAKIGRRYELPHKGLIPEEFGVIARYKGQGRLADPGFRNPRWVDG  721

Query  416  ELLQLNGK  393
            EL+ L+GK
Sbjct  722  ELVILDGK  729



>ref|XP_001422141.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00458.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=590

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = -2

Query  773  FTRIT---TSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVE  603
            F RI     SGS  D FDGLY+GAFGP+G EV+++ R  G W   D+   S     E V 
Sbjct  429  FQRIDPRLASGSRNDVFDGLYIGAFGPHGPEVLRMVR--GRWG--DDVGESN----ECVT  480

Query  602  AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
            AVKLTGD NVP G  +FRAK+ K N  T    YPDELGV+A YKG+GR+A+ GF +  WV
Sbjct  481  AVKLTGDENVPCGAASFRAKVSKENLITEGSSYPDELGVLARYKGEGRVAKPGFADSHWV  540

Query  422  EGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
            EGELL LNGKG G    GA+LGF++ +P E   L+LFS L LP+
Sbjct  541  EGELLVLNGKG-GSLTGGAELGFVWAVPGERRLLILFSSLVLPD  583



>gb|KDO37024.1| hypothetical protein CISIN_1g033722mg [Citrus sinensis]
Length=80

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -2

Query  626  MEFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEY  447
            MEFFEYVEAVKLTGD+NVPAG+VTFRAKIGKG+R  N+G +PDELGVVASY GQGRIA++
Sbjct  1    MEFFEYVEAVKLTGDLNVPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGRIADF  60

Query  446  GFKNPKWVEGELLQLNGKGV  387
            GF+NPKWV+GELLQLNGK V
Sbjct  61   GFRNPKWVDGELLQLNGKVV  80



>gb|KJB79578.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
Length=667

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI TS S  DP +GLYVGA G Y +EV+ L+RK+G W      ++ S +EF+EYVEA 
Sbjct  527  FHRIETSASP-DPLNGLYVGAHGLYTSEVIHLRRKFGQWQGDSGTKEPSDLEFYEYVEAE  585

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD  VPAGQV FRA++GK  +  +KG+ P+E GVVA YKGQGR+AE GF+NP+WV+G
Sbjct  586  KLTGDPYVPAGQVAFRARVGKRYQLPHKGIIPEEFGVVARYKGQGRLAEPGFRNPRWVDG  645

Query  416  ELLQLNGK  393
            EL+ L+GK
Sbjct  646  ELVILDGK  653



>ref|XP_002954035.1| hypothetical protein VOLCADRAFT_106212 [Volvox carteri f. nagariensis]
 gb|EFJ44752.1| hypothetical protein VOLCADRAFT_106212 [Volvox carteri f. nagariensis]
Length=1401

 Score =   152 bits (385),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 15/161 (9%)
 Frame = -2

Query  773   FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
             + RI T     DPF GLY+GAFGP+G E++QL R      ++D E        E V A K
Sbjct  965   YARIPTDLPRSDPFCGLYLGAFGPHGPELIQLSR-----TMQDGE--------EVVCATK  1011

Query  593   LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
             +TGD NVPAG+V+FRAK+G+ +R  ++ +YPDELG+VA YKG+GR+A  G+K+P+WV+GE
Sbjct  1012  VTGDPNVPAGEVSFRAKVGRRHRLDSRDVYPDELGIVARYKGEGRVAMAGYKSPRWVDGE  1071

Query  413   LLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
             LL     G  P   GA+LGF++ +P E  FL+L ++L L E
Sbjct  1072  LLVF-AVGASPVTGGAELGFVWSVPGEKRFLILLNKLDLKE  1111



>ref|XP_001703381.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06063.1| predicted protein [Chlamydomonas reinhardtii]
Length=745

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 15/161 (9%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            + RI T     DPF GLY+GAFGP+G E++QL R      ++D E        E V AVK
Sbjct  596  YGRIPTDLPRSDPFCGLYLGAFGPHGPELIQLSR-----GLQDGE--------EVVSAVK  642

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGE  414
            +TGD NVPAG+V+FRAK+G+ ++  ++ +YPDELG+VA YKG+GR+A  G+K+P+WV+GE
Sbjct  643  VTGDPNVPAGEVSFRAKVGRRHKLDSRDVYPDELGIVARYKGEGRVAMAGYKSPRWVDGE  702

Query  413  LLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
            LL +   G  P   GA LGF++ +P E  FL+L ++L L E
Sbjct  703  LL-VFAVGASPVTGGAQLGFVWSVPGEKRFLILLNKLDLKE  742



>gb|EAZ16473.1| hypothetical protein OsJ_31943 [Oryza sativa Japonica Group]
Length=693

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI    S  DP  GLY+ A G + +E++ L+RK+G W   D  E+   ++F+EYV
Sbjct  535  VTHFSRIQIPVSS-DPLTGLYMTASG-FDSEILSLQRKFGQWREDDSSEEHRDLQFYEYV  592

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAGQV FRAK+GK  +  +KG+ P ELGVVA YKG+ RIA+ GF+NP+W
Sbjct  593  EAVKLTGDNLVPAGQVVFRAKVGKHYQLPHKGIIPRELGVVARYKGERRIADPGFQNPRW  652

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RLKLP+
Sbjct  653  VDGELLILDGKFIR---DGPVIAFFYWTSNFHLFEFFRRLKLPD  693



>sp|Q7XD99.1|EXEC1_ORYSJ RecName: Full=Protein EXECUTER 1, chloroplastic; Short=OsEX1; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL59023.1|AC087182_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54343.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB47802.1| expressed protein [Oryza sativa Japonica Group]
Length=727

 Score =   145 bits (367),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI    S  DP  GLY+ A G + +E++ L+RK+G W   D  E+   ++F+EYV
Sbjct  569  VTHFSRIQIPVSS-DPLTGLYMTASG-FDSEILSLQRKFGQWREDDSSEEHRDLQFYEYV  626

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAGQV FRAK+GK  +  +KG+ P ELGVVA YKG+ RIA+ GF+NP+W
Sbjct  627  EAVKLTGDNLVPAGQVVFRAKVGKHYQLPHKGIIPRELGVVARYKGERRIADPGFQNPRW  686

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RLKLP+
Sbjct  687  VDGELLILDGKFIR---DGPVIAFFYWTSNFHLFEFFRRLKLPD  727



>ref|XP_006662456.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Oryza brachyantha]
Length=656

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 106/164 (65%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI    S LDP  GLY+ A G + +E++ L+RK+G W   D  ++   ++F+EYV
Sbjct  498  VTHFSRIQMPIS-LDPLTGLYMTASG-FDSEILSLQRKFGQWREDDSSDEHRDLQFYEYV  555

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAGQV FRAK+G   +  +KG+ P ELGVVA YKG+ RIA+ GF+NP+W
Sbjct  556  EAVKLTGDNLVPAGQVVFRAKVGNHYQLPHKGIIPRELGVVARYKGERRIADPGFQNPRW  615

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RLKLP+
Sbjct  616  VDGELLVLDGKFIR---DGPVIAFFYWTSNFHLFEFFRRLKLPD  656



>ref|XP_002500729.1| hypothetical protein MICPUN_57395 [Micromonas sp. RCC299]
 gb|ACO61987.1| hypothetical protein MICPUN_57395 [Micromonas sp. RCC299]
Length=1030

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 110/164 (67%), Gaps = 13/164 (8%)
 Frame = -2

Query  773   FTRI---TTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVE  603
             F+RI     S S++DPFD LY+GAFGP+G EV+++ R  G W    +E   G E    V 
Sbjct  866   FSRIPEAVASRSNVDPFDRLYLGAFGPHGPEVLRVVR--GRWG---DELGEGEEC---VT  917

Query  602   AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
             AVKLTGD NVPAG  +FRAK+G  ++  +   YP+ELGV A YKGQGR+A+ GF    WV
Sbjct  918   AVKLTGDANVPAGAASFRAKVGPQHKLESSFSYPEELGVTARYKGQGRVAKPGFTERNWV  977

Query  422   EGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
             +GELL L+G+G G    GA+LGF++ +P E   L+LFS L+LP+
Sbjct  978   DGELLVLDGRG-GSLTGGAELGFVWAVPGERRLLILFSSLELPD  1020



>dbj|BAJ87615.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 103/164 (63%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI    S  DP  GLY  A G + +EV+ L+RK+G W   D  E+   ++F+EYV
Sbjct  401  VTHFSRIQMPISS-DPLSGLYETASG-FDSEVLSLQRKFGQWQEDDSSEEHLDLKFYEYV  458

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EA KLTGD  VPAGQV FRAK+GK  +  +KG+ P ELGVVA YKGQ R+A+ GFKNP+W
Sbjct  459  EAAKLTGDNLVPAGQVVFRAKVGKHYQLPHKGVIPRELGVVARYKGQRRVADAGFKNPRW  518

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RL LP+
Sbjct  519  VDGELLILDGKFIR---DGPVIAFFYWTSNLHLFEFFRRLSLPD  559



>ref|XP_004982803.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Setaria italica]
 ref|XP_004982804.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Setaria italica]
 ref|XP_004982805.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Setaria italica]
 ref|XP_004982806.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X4 
[Setaria italica]
Length=699

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 108/164 (66%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI T  S  DP +GLY+ A G + +E++ L+RK+G W   +  E+ S + F+EYV
Sbjct  541  VTHFSRIQTPISS-DPLNGLYLTASG-FDSEILSLQRKFGQWREDNSSEEHSDLLFYEYV  598

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EAVKLTGD  VPAGQV FRAK+G+  +  +KG+ P ELGVVA YKGQ +IA+ GF+NP+W
Sbjct  599  EAVKLTGDNLVPAGQVVFRAKVGERYQLPHKGIIPRELGVVARYKGQRKIADPGFQNPRW  658

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RL+LP+
Sbjct  659  VDGELLILDGKFIR---DGPVIAFFYWTSNFHLFEFFRRLRLPD  699



>ref|XP_003574086.1| PREDICTED: protein EXECUTER 1, chloroplastic [Brachypodium distachyon]
Length=708

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 103/164 (63%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI    S  DP  GLY  A G + +E++ L+RK+G W   D  E+   ++F+EYV
Sbjct  550  VTHFSRIQAPMSS-DPLSGLYETASG-FDSEILSLQRKFGQWREDDSSEEDRDLKFYEYV  607

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EA KLTGD  VPAGQV FRAK+GK  +  +KG+ P ELGVVA YKGQ RIA+ GF+NP+W
Sbjct  608  EATKLTGDNLVPAGQVVFRAKVGKHYQLPHKGIIPRELGVVARYKGQRRIADAGFQNPRW  667

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RL LP+
Sbjct  668  VDGELLILDGKFIR---DGPVIAFFYWTSNLHLFEFFRRLSLPD  708



>dbj|BAJ89988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 103/164 (63%), Gaps = 6/164 (4%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYV  606
            +  F+RI    S  DP  GLY  A G + +EV+ L+RK+G W   D  E+   ++F+EYV
Sbjct  554  VTHFSRIQMPISS-DPLSGLYETASG-FDSEVLSLQRKFGQWQEDDSSEEHLDLKFYEYV  611

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
            EA KLTGD  VPAGQV FRAK+GK  +  +KG+ P ELGVVA YKGQ R+A+ GFKNP+W
Sbjct  612  EAAKLTGDNLVPAGQVVFRAKVGKHYQLPHKGVIPRELGVVARYKGQRRVADAGFKNPRW  671

Query  425  VEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            V+GELL L+GK +     G  + F Y          F RL LP+
Sbjct  672  VDGELLILDGKFIR---DGPVIAFFYWTSNLHLFEFFRRLSLPD  712



>ref|XP_005650349.1| RNB-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25805.1| RNB-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=1751

 Score =   143 bits (361),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 75/162 (46%), Positives = 102/162 (63%), Gaps = 16/162 (10%)
 Frame = -2

Query  773   FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
             ++RI T     DPF GLY+G FGP+G EV+ L+R        D E        E V  +K
Sbjct  1599  YSRIQTDVPKTDPFTGLYLGTFGPHGPEVLHLQRSL----TEDGE--------ECVLGIK  1646

Query  593   LTGDMNVPAGQVTFRAKIGKGNRFTNKG-MYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
             LTGD NVPAG V+FRA+IG+ +R +    MYP EL + A Y G+GR+A  GFK+ +WVEG
Sbjct  1647  LTGDANVPAGHVSFRARIGRKHRRSGYDLMYPPELDISARYAGEGRVAHKGFKDARWVEG  1706

Query  416   ELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
             ELL  +G    P  +GA+LGF++V+P E  +L+L SR+ L +
Sbjct  1707  ELLHFSGS--NPVTRGAELGFVWVVPHERRYLILLSRIDLDD  1746



>gb|EMT28755.1| hypothetical protein F775_09989 [Aegilops tauschii]
Length=575

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 5/146 (3%)
 Frame = -2

Query  728  GLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAVKLTGDMNVPAGQVTF  552
            GLY  A G + +EV+ L+RK+G W   D  E+ S ++F+EYVEA KLTGD  VPAGQV F
Sbjct  434  GLYETASG-FDSEVLSLQRKFGQWQEDDSSEEHSDLKFYEYVEAAKLTGDNLVPAGQVVF  492

Query  551  RAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGPHIK  372
            RAK+GK  +  +KG+ P ELGVVA YKGQ RIA+ GFKNP+WV+GELL L+GK +     
Sbjct  493  RAKVGKHYQLPHKGVIPRELGVVARYKGQRRIADAGFKNPRWVDGELLILDGKFIR---D  549

Query  371  GADLGFLYVIPEHSFLVLFSRLKLPE  294
            G  + F Y          F RL LP+
Sbjct  550  GPVIAFFYWTSNLHLFEFFRRLSLPD  575



>dbj|BAJ92734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 97/150 (65%), Gaps = 5/150 (3%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAVKLTGDMNVPAG  564
            DP  GLY  A G + +EV+ L+RK+G W   D  E+   ++F+EYVEA KLTGD  VPAG
Sbjct  567  DPLSGLYETASG-FDSEVLSLQRKFGQWQEDDSSEEHLDLKFYEYVEAAKLTGDNLVPAG  625

Query  563  QVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVG  384
            QV FRAK+GK  +  +KG+ P ELGVVA YKGQ R+A+ GFKNP+WV+GELL L+GK + 
Sbjct  626  QVVFRAKVGKHYQLPHKGVIPRELGVVARYKGQRRVADAGFKNPRWVDGELLILDGKFIR  685

Query  383  PHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
                G  + F Y          F RL LP+
Sbjct  686  ---DGPVIAFFYWTSNLHLFEFFRRLSLPD  712



>gb|AER62114.1| hypothetical protein, partial [Eremopyrum triticeum]
Length=194

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 5/93 (5%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  +  DPF+GLYVGAF PYG EVVQL+RK+G+WN  D+     +EFFEYVEAVK
Sbjct  107  FNRIVTDSNGSDPFNGLYVGAFSPYGPEVVQLRRKFGHWNSTDD-----VEFFEYVEAVK  161

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDE  495
            LTGD++VPAGQVTFRAK+ KG+R  N+G YP+E
Sbjct  162  LTGDLSVPAGQVTFRAKVAKGSRLENRGAYPEE  194



>gb|EMS61090.1| hypothetical protein TRIUR3_15831 [Triticum urartu]
Length=523

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 5/146 (3%)
 Frame = -2

Query  728  GLYVGAFGPYGTEVVQLKRKYGNWNVRDE-EKSSGMEFFEYVEAVKLTGDMNVPAGQVTF  552
            GLY  A G + +EV+ L+RK+G W   D  E+   ++F+EYVEA KLTGD  VPAGQV F
Sbjct  382  GLYETASG-FDSEVLSLQRKFGQWQEEDSSEEHLDLKFYEYVEAAKLTGDNLVPAGQVVF  440

Query  551  RAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGPHIK  372
            RAK+GK  +  +KG+ P ELGVVA YKGQ RIA+ GFKNP+WV+GELL L+GK +     
Sbjct  441  RAKVGKHYQLPHKGVIPRELGVVARYKGQRRIADAGFKNPRWVDGELLILDGKFIR---D  497

Query  371  GADLGFLYVIPEHSFLVLFSRLKLPE  294
            G  + F Y          F RL LP+
Sbjct  498  GPVIAFFYWTSNLHLFEFFRRLSLPD  523



>ref|NP_001159303.1| uncharacterized protein LOC100304395 [Zea mays]
 ref|XP_008643904.1| PREDICTED: uncharacterized protein LOC100304395 isoform X1 [Zea 
mays]
 gb|ACN25728.1| unknown [Zea mays]
 gb|AFW68537.1| hypothetical protein ZEAMMB73_115279 [Zea mays]
 gb|AFW68538.1| hypothetical protein ZEAMMB73_115279 [Zea mays]
Length=699

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 10/166 (6%)
 Frame = -2

Query  782  IHXFTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE---EKSSGMEFFE  612
            +  F+RI    S  DP  GLY+ A G + +E++ L+RK+G W  R++   E+ S + F+E
Sbjct  541  VTHFSRIQMPISS-DPLTGLYLTASG-FDSEILSLQRKFGQW--REDGPSEEHSDLLFYE  596

Query  611  YVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNP  432
            YVEAVKLTGD  +PAGQV FRAK+G+  R  +KG+ P ELGV+A YKGQ +IA+ GF+NP
Sbjct  597  YVEAVKLTGDNLMPAGQVVFRAKVGEHYRLPHKGIIPRELGVIARYKGQRKIADPGFQNP  656

Query  431  KWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            +WV+GELL L+GK +     G  + F Y          F +LKLP+
Sbjct  657  QWVDGELLILDGKFIR---DGPVIAFFYWTSNVHLFEFFRQLKLPD  699



>ref|XP_007511043.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66603.1| predicted protein [Bathycoccus prasinos]
Length=1088

 Score =   138 bits (348),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 104/155 (67%), Gaps = 17/155 (11%)
 Frame = -2

Query  740   DPFDGLYVGAFGPYGTEVVQLKR-KYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAG  564
             DPFD LYVGAFGP+G E+V++ R +YG+    D    +G         +KLTGD NVPAG
Sbjct  924   DPFDRLYVGAFGPHGAEIVRIVRGRYGDELGEDSNCITG---------IKLTGDANVPAG  974

Query  563   QVTFRAKIGKGNRF---TNKGM--YPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLN  399
               +FRAKI + N+    T  G+  YP+ELGV+A YKGQGR+A+ GF++  W +GELL L+
Sbjct  975   AASFRAKIDEENKLPKLTVNGLQTYPEELGVLARYKGQGRVAKPGFEDASWTDGELLVLD  1034

Query  398   GKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLP  297
             GKG G    GA+LGF++ +P E   L+LF+ LKLP
Sbjct  1035  GKG-GQLTGGAELGFVWAVPHERRLLILFTSLKLP  1068



>ref|XP_008664851.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 ref|XP_008664852.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 ref|XP_008664853.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 ref|XP_008664854.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 tpg|DAA49566.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49567.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49568.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49569.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49570.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
Length=701

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%), Gaps = 9/152 (6%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE---EKSSGMEFFEYVEAVKLTGDMNVP  570
            DP  GLYV   G + +E++ L+RK+G W  RD+   E+ S + F+E+VEAVKLTGD  +P
Sbjct  556  DPLTGLYVTTSG-FDSEILSLQRKFGQW--RDDGSSEEHSDLLFYEHVEAVKLTGDNLMP  612

Query  569  AGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKG  390
            AGQV FRAK+G+  +  +KG+ P ELGV+A YKGQ +IA+ GF+NP+WV+GELL ++GK 
Sbjct  613  AGQVVFRAKVGERYQLPHKGIIPRELGVIARYKGQRKIADPGFQNPRWVDGELLIIDGKF  672

Query  389  VGPHIKGADLGFLYVIPEHSFLVLFSRLKLPE  294
            +     G  + F Y          F RL+LPE
Sbjct  673  IR---DGPVIAFFYWTSNFHRFEFFRRLRLPE  701



>gb|AFW79778.1| hypothetical protein ZEAMMB73_469165 [Zea mays]
Length=92

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 5/91 (5%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQ  561
            DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVKLTGD++VPAGQ
Sbjct  7    DPFNGLYVGAFSPYGPEIVQLRRKFGHWNSTDD-----VEFFEYVEAVKLTGDLSVPAGQ  61

Query  560  VTFRAKIGKGNRFTNKGMYPDELGVVASYKG  468
            +TFRAKIGKG R  N+G YP+E        G
Sbjct  62   ITFRAKIGKGKRLENRGAYPEEFDCQLQRSG  92



>ref|XP_008662558.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Zea mays]
Length=88

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 5/88 (6%)
 Frame = -2

Query  749  SDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVP  570
            + +DPF+GLYVGAF PYG E+VQL+RK+G+WN  D+     +EFFEYVEAVKLTGD++VP
Sbjct  4    NSMDPFNGLYVGAFSPYGPEIVQLRRKFGHWNSFDD-----VEFFEYVEAVKLTGDLSVP  58

Query  569  AGQVTFRAKIGKGNRFTNKGMYPDELGV  486
            AGQ+TFRAKIGKG R  N+G YP+E   
Sbjct  59   AGQITFRAKIGKGKRLENRGAYPEEFDC  86



>ref|XP_008644779.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Zea mays]
Length=88

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 5/88 (6%)
 Frame = -2

Query  749  SDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVP  570
            + +DPF+GLYVGAF PYG E+VQL++K+G+WN  D+     +EFFEYVEAVKLTGD++VP
Sbjct  4    NSMDPFNGLYVGAFSPYGPEIVQLRQKFGHWNSSDD-----VEFFEYVEAVKLTGDLSVP  58

Query  569  AGQVTFRAKIGKGNRFTNKGMYPDELGV  486
            AGQ+TFRAKIGKG R  N+G YP+E   
Sbjct  59   AGQITFRAKIGKGKRLENRGAYPEEFDC  86



>gb|AFW68071.1| hypothetical protein ZEAMMB73_464170 [Zea mays]
Length=546

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  623  EFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYG  444
             FFEYVEAVKLTGD++VPAGQ+TFRAKIGKG R  ++G+YP+E GV+ASYK QGRIA+ G
Sbjct  382  HFFEYVEAVKLTGDLSVPAGQITFRAKIGKGKRLEHRGVYPEEFGVIASYKCQGRIAQPG  441

Query  443  FKNPKWVEGELLQLNGK  393
            FKNP+WV+GELL LNGK
Sbjct  442  FKNPRWVDGELLVLNGK  458



>gb|AFW68072.1| hypothetical protein ZEAMMB73_464170 [Zea mays]
Length=763

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  623  EFFEYVEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYG  444
             FFEYVEAVKLTGD++VPAGQ+TFRAKIGKG R  ++G+YP+E GV+ASYK QGRIA+ G
Sbjct  382  HFFEYVEAVKLTGDLSVPAGQITFRAKIGKGKRLEHRGVYPEEFGVIASYKCQGRIAQPG  441

Query  443  FKNPKWVEGELLQLNGK  393
            FKNP+WV+GELL LNGK
Sbjct  442  FKNPRWVDGELLVLNGK  458



>ref|XP_003064419.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51324.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=105

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = -2

Query  608  VEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPK  429
            V AVKLTGD NVPAG  +FRA++G  +R  +   YPDELGVVA YKGQGR+A+ GF    
Sbjct  1    VTAVKLTGDANVPAGAASFRARVGAEHRLESSFSYPDELGVVARYKGQGRVAKPGFTERI  60

Query  428  WVEGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVLFSRLKLPE  294
            WV+GELL L+G+G G    GA+LGF++ +P E   L+LFS L+LP+
Sbjct  61   WVDGELLLLDGRG-GSLTGGAELGFVWAVPGERRLLILFSSLELPD  105



>ref|XP_010101203.1| hypothetical protein L484_015007 [Morus notabilis]
 gb|EXB87877.1| hypothetical protein L484_015007 [Morus notabilis]
Length=106

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -2

Query  485  VASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIPEHSFLVLFSRL  306
            VASYKGQGRIAE+GF+NP+WV+GELLQLNGKG+GP +KGADLGFLYV+PE SFLVLF+RL
Sbjct  43   VASYKGQGRIAEFGFRNPQWVDGELLQLNGKGMGPFVKGADLGFLYVVPEQSFLVLFNRL  102

Query  305  KLP  297
            KLP
Sbjct  103  KLP  105



>ref|XP_011395457.1| Protein EXECUTER 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM22601.1| Protein EXECUTER 1, chloroplastic [Auxenochlorella protothecoides]
Length=531

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 93/149 (62%), Gaps = 17/149 (11%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQ  561
            D   G+Y+G FGP+G EVVQL R       RD +        E+V A K+TGD NVPAG+
Sbjct  386  DALAGVYLGQFGPHGPEVVQLARSR-----RDGD--------EWVHATKITGDRNVPAGE  432

Query  560  VTFRAKIGKGNRF-TNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVG  384
            ++F+A++G+ +R  T    YP ELGV A Y G+GR+AE GFKNP+WV  ELLQ       
Sbjct  433  LSFKARVGREHRLPTAVEGYPPELGVTARYAGRGRVAEPGFKNPRWVNAELLQFASG--N  490

Query  383  PHIKGADLGFLYVIPE-HSFLVLFSRLKL  300
            P  +GA+LG ++ +     +L+LF+R+ L
Sbjct  491  PMTRGAELGIVFSVSRTQRYLILFNRVDL  519



>ref|XP_005849264.1| hypothetical protein CHLNCDRAFT_51231 [Chlorella variabilis]
 gb|EFN57162.1| hypothetical protein CHLNCDRAFT_51231 [Chlorella variabilis]
Length=975

 Score =   122 bits (306),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 16/133 (12%)
 Frame = -2

Query  740  DPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQ  561
            DPF GLYVG FGP+G E++Q+ R+                  E+  A KLTGD NVPAG 
Sbjct  845  DPFSGLYVGTFGPHGPELLQVSRQVEGGR-------------EWAVATKLTGDPNVPAGT  891

Query  560  VTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGP  381
            V+++A IG+GNR   + MYP E+ V A YKGQG++A+ GF N KWVEGELL        P
Sbjct  892  VSWKALIGRGNRLPAE-MYPPEMAVTARYKGQGQVAQTGFTNAKWVEGELLVFGAD--SP  948

Query  380  HIKGADLGFLYVI  342
             ++GA LG+L V+
Sbjct  949  FVRGAQLGYLIVL  961



>gb|KCW49292.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=588

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F+RITTS  DLDPFDGLYVGAFGPYGTEVVQL+RK+G WN  D   SS +EFFEYVEAVK
Sbjct  491  FSRITTSKGDLDPFDGLYVGAFGPYGTEVVQLRRKFGQWNGSD-NGSSEVEFFEYVEAVK  549

Query  593  LTGDMNVPAGQVTF  552
            LTGD+NVPAGQV +
Sbjct  550  LTGDLNVPAGQVFY  563



>gb|EPS59467.1| hypothetical protein M569_15340, partial [Genlisea aurea]
Length=499

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEK--SSGMEFFEYVEA  600
            F RITTS SDLDPF+GLYVGAFGPYG+E+VQL+RKYG+W    +E   S  +EFFEYVEA
Sbjct  426  FNRITTSSSDLDPFEGLYVGAFGPYGSEIVQLRRKYGSWKTAGDEDSISDDVEFFEYVEA  485

Query  599  VKLTGDMNVPAGQV  558
            VKLTGD NVPAGQV
Sbjct  486  VKLTGDFNVPAGQV  499



>gb|AAD45989.1|AC005916_1 EST gb|N65787 comes from this gene [Arabidopsis thaliana]
Length=568

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI T  S+LDPFDGLYVGAFGPYGTE+VQLKRKYG W+  +   SS +EFFEYVEAVK
Sbjct  492  FNRIITPESNLDPFDGLYVGAFGPYGTEIVQLKRKYGRWDDAEGSNSSDIEFFEYVEAVK  551

Query  593  LTGDMNVPAGQVTF  552
            LTGD NVPAGQV  
Sbjct  552  LTGDPNVPAGQVII  565



>gb|AFW73863.1| hypothetical protein ZEAMMB73_070018, partial [Zea mays]
Length=142

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 5/84 (6%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI    + +DPF+GLYVGAF PYG E+VQL  K+ +WN  D+     +EFFEY EAVK
Sbjct  53   FNRIIMDTNSMDPFNGLYVGAFSPYGPEIVQLHWKFDHWNSSDD-----VEFFEYAEAVK  107

Query  593  LTGDMNVPAGQVTFRAKIGKGNRF  522
            LTGD++VPAGQ+TF AKIGKG R 
Sbjct  108  LTGDLSVPAGQITFCAKIGKGKRL  131



>ref|XP_008644780.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Zea mays]
Length=82

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 11/88 (13%)
 Frame = -2

Query  749  SDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVP  570
            + +DPF+GLYVGAF PYG E+VQL++K+G+WN  D+     +EFFEYVEAVKLTGD++VP
Sbjct  4    NSMDPFNGLYVGAFSPYGPEIVQLRQKFGHWNSSDD-----VEFFEYVEAVKLTGDLSVP  58

Query  569  AGQVTFRAKIGKGNRFTNKGMYPDELGV  486
            AGQ      IGKG R  N+G YP+E   
Sbjct  59   AGQ------IGKGKRLENRGAYPEEFDC  80



>ref|XP_007042829.1| Executer 1 isoform 3 [Theobroma cacao]
 gb|EOX98660.1| Executer 1 isoform 3 [Theobroma cacao]
Length=681

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVK  594
            F RI  + S  DP +GLY+GA G Y +EV+ L+RK+G W     ++ S +EF+EYVEAVK
Sbjct  530  FHRIEIAASP-DPLNGLYIGAHGLYTSEVIHLRRKFGQWQDSGTKEPSDLEFYEYVEAVK  588

Query  593  LTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVV  483
            LTGD  VPAGQV FRA++GK  +  +KG+ P+E GVV
Sbjct  589  LTGDPYVPAGQVAFRARVGKRYQLPHKGIIPEEFGVV  625



>gb|KJB79580.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
Length=629

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-EEKSSGMEFFEYVEAV  597
            F RI TS S  DP +GLYVGA G Y +EV+ L+RK+G W      ++ S +EF+EYVEA 
Sbjct  527  FHRIETSASP-DPLNGLYVGAHGLYTSEVIHLRRKFGQWQGDSGTKEPSDLEFYEYVEAE  585

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVV  483
            KLTGD  VPAGQV FRA++GK  +  +KG+ P+E GVV
Sbjct  586  KLTGDPYVPAGQVAFRARVGKRYQLPHKGIIPEEFGVV  623



>gb|AEB22069.1| executer 1, partial [Solanum tuberosum]
Length=75

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 59/79 (75%), Gaps = 5/79 (6%)
 Frame = -2

Query  560  VTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGP  381
            + FRA+IGK  +  +KG+ P+E GV+A Y+GQGR+AE GF+NP+WV+GEL+ L+GK    
Sbjct  1    IAFRARIGKKYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRNPRWVDGELVILDGK----  56

Query  380  HIKGAD-LGFLYVIPEHSF  327
            +IKG   +GF+Y  PE+ F
Sbjct  57   YIKGGPVVGFVYWDPEYHF  75



>emb|CAN67007.1| hypothetical protein VITISV_020409 [Vitis vinifera]
Length=189

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  563  QVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVG  384
            +V FRAK+GK  +  +KG+ P+E GV+A Y+GQGR+AE GF+NP+WV+GEL+ L+GK + 
Sbjct  65   KVAFRAKVGKRYQLPHKGIIPEEFGVIARYRGQGRLAEPGFRNPRWVDGELVILDGKVLS  124

Query  383  PHIKGADLGFLYVIPEHSFLV  321
                 A  GF+Y+   ++ L 
Sbjct  125  ILAGSAFSGFVYLFFPYTMLC  145



>emb|CAN67006.1| hypothetical protein VITISV_020408 [Vitis vinifera]
Length=830

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKS-SGMEFFEYVEAV  597
            F RI    S  DP +GLY+G+ G Y +E++ L+RK+G W      K  S +EF+EYVEA+
Sbjct  677  FNRIEIPASP-DPLNGLYIGSHGLYTSEIIHLRRKFGQWKEDAGAKEPSNLEFYEYVEAL  735

Query  596  KLTGDMNVPAGQ  561
            KLTGD  VPAGQ
Sbjct  736  KLTGDPYVPAGQ  747



>emb|CBI21738.3| unnamed protein product [Vitis vinifera]
Length=61

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = -2

Query  767  RITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSS  630
            R TTS   LDPFDGL+VG FGPYGTEVVQL+ K+G+WN   EE SS
Sbjct  14   RFTTSKGHLDPFDGLHVGTFGPYGTEVVQLRLKFGHWN---EEMSS  56



>ref|XP_006423690.1| hypothetical protein CICLE_v100298791mg, partial [Citrus clementina]
 gb|ESR36930.1| hypothetical protein CICLE_v100298791mg, partial [Citrus clementina]
Length=176

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 6/74 (8%)
 Frame = -2

Query  773  FTRITTSGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDE---EKSSGMEFFEYVE  603
            F RI T+ S  D  +GLY+G  G   +EV+ L+RK+G W  +D+   +  S +EF+EYVE
Sbjct  106  FHRIETATSQ-DALNGLYIGVHGLRTSEVINLRRKFGQW--QDDGGIKNPSNLEFYEYVE  162

Query  602  AVKLTGDMNVPAGQ  561
            A+K+TGD  VPAGQ
Sbjct  163  AIKVTGDPYVPAGQ  176



>gb|KIZ02757.1| hypothetical protein MNEG_5197 [Monoraphidium neglectum]
Length=67

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -2

Query  494  LGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVL  318
            +GV A Y G+GRIA+  + N KWVEGELL  +         GA +GF++ +P +  FL+L
Sbjct  1    MGVSARYAGEGRIADSNYSNAKWVEGELLVFSSASNEMITGGARVGFVWSVPNDRRFLIL  60

Query  317  FSRLKL  300
             +R++L
Sbjct  61   LNRIQL  66



>gb|KIY91410.1| hypothetical protein MNEG_16554 [Monoraphidium neglectum]
Length=67

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -2

Query  494  LGVVASYKGQGRIAEYGFKNPKWVEGELLQLNGKGVGPHIKGADLGFLYVIP-EHSFLVL  318
            +GV A Y G+GRIA+  F N KWV+GELL  +         GA +GF++ +P +  FL+L
Sbjct  1    MGVAARYPGRGRIADSNFSNAKWVDGELLVFSPAASPLVTGGARVGFVWSVPNDRRFLIL  60

Query  317  FSRLKL  300
             +R++L
Sbjct  61   LNRVQL  66



>gb|AFW68070.1| hypothetical protein ZEAMMB73_464170, partial [Zea mays]
Length=55

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  485  VASYKGQGRIAEYGFKNPKWVEGELLQLNGK  393
            +ASYK QGRIA+ GFKNP+WV+GELL LNGK
Sbjct  23   IASYKCQGRIAQPGFKNPRWVDGELLVLNGK  53



>gb|KIL85769.1| hypothetical protein FAVG1_10738 [Fusarium avenaceum]
Length=502

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 69/147 (47%), Gaps = 19/147 (13%)
 Frame = -2

Query  755  SGSDLDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSG  627
            + + L P+ G++VG +  +G E + + +     +  DEE                 ++ G
Sbjct  339  TPTPLKPWRGIWVGDYSTHGCEFLLIHQPDDENSATDEELGLVRRDAETREAWEARRTEG  398

Query  626  MEFFEYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAE  450
              F   +EA+KLTGD NVP G++TF A  +G      +    P  LG+   Y  QG IA 
Sbjct  399  RTFQGRLEAIKLTGDPNVPRGEITFVADDLGPDGVVDSPPPDPRFLGIRTVY-SQGHIAN  457

Query  449  YGFKNPKWVEGELLQLNGKGVGPHIKG  369
             GF   ++VE +L+ ++   +  H  G
Sbjct  458  TGFTQDRYVESQLILVSHDRLAQHWIG  484



>gb|EGZ69627.1| hypothetical protein NEUTE2DRAFT_152230 [Neurospora tetrasperma 
FGSC 2509]
Length=650

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (47%), Gaps = 16/145 (11%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-----EEKSSGMEFFEYVEA---------  600
            P+ G++VG +GP+G E + + +   + N++D      E  +  EF +  +          
Sbjct  495  PYRGIFVGHYGPHGCEFILMHQPDDDPNIQDAEIERRENETDEEFQKRTQESKIYKGGLA  554

Query  599  -VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
             +KLTGD NVP G+ TF AK      F  K    +E       K +G +AE+ F++  W+
Sbjct  555  GIKLTGDPNVPRGEYTFVAKDIGEEGFV-KVADEEEFRGARVVKAKGHVAEHNFRDDDWI  613

Query  422  EGELLQLNGKGVGPHIKGADLGFLY  348
            + +L   +   +  H    D+  ++
Sbjct  614  DCDLFLASHNTLALHWHRWDMTSVF  638



>ref|XP_009853025.1| hypothetical protein NEUTE1DRAFT_123663 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO55158.1| hypothetical protein NEUTE1DRAFT_123663 [Neurospora tetrasperma 
FGSC 2508]
Length=659

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (47%), Gaps = 16/145 (11%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-----EEKSSGMEFFEYVEA---------  600
            P+ G++VG +GP+G E + + +   + N++D      E  +  EF +  +          
Sbjct  495  PYRGIFVGHYGPHGCEFILMHQPDDDPNIQDAEIERRENETDEEFQKRTQESKIYKGGLA  554

Query  599  -VKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
             +KLTGD NVP G+ TF AK      F  K    +E       K +G +AE+ F++  W+
Sbjct  555  GIKLTGDPNVPRGEYTFVAKDIGEEGFV-KVADEEEFRGARVVKAKGHVAEHNFRDDDWI  613

Query  422  EGELLQLNGKGVGPHIKGADLGFLY  348
            + +L   +   +  H    D+  ++
Sbjct  614  DCDLFLASHNTLALHWHRWDMTSVF  638



>ref|XP_957999.2| F-box domain-containing protein [Neurospora crassa OR74A]
 gb|EAA28763.2| F-box domain-containing protein [Neurospora crassa OR74A]
 gb|KHE88058.1| hypothetical protein GE21DRAFT_9847 [Neurospora crassa]
Length=627

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 71/146 (49%), Gaps = 18/146 (12%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRKYGNWNVRD-----EEKSSGMEFFEY----------VE  603
            P+ G++VG +GP+G E + + +   + +++D      E  +  EF +           + 
Sbjct  472  PYRGIFVGHYGPHGCEFILMHQPDDDPSIQDAEIERRENETDEEFQKRKLESKVYKGGLA  531

Query  602  AVKLTGDMNVPAGQVTFRAK-IGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKW  426
             +KLTGD NVP G+ TF AK IG+G     K    +E       K +G +AE+ F++  W
Sbjct  532  GIKLTGDPNVPRGEYTFVAKDIGEGGFV--KVADEEEFRGARVVKAKGHVAEHNFRDDDW  589

Query  425  VEGELLQLNGKGVGPHIKGADLGFLY  348
            ++ +L   +   +  H    D+  ++
Sbjct  590  IDCDLFLASHNTLALHWHRWDMTSVF  615



>gb|AAF99740.1|AC004557_19 F17L21.29 [Arabidopsis thaliana]
Length=684

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = -2

Query  485  VASYKGQGRIAEYGFKNPKWVEGELLQLNGK-----GVGPHIKGADLGFLYVIPE  336
            +ASY+GQG+IA++GFK P+WVEG+LL+LNGK      V      AD  F   I E
Sbjct  3    LASYRGQGKIADFGFKKPRWVEGKLLKLNGKKMEGGSVNESHSNADQMFDTTIEE  57



>ref|WP_007415956.1| hypothetical protein [Pedosphaera parvula]
 gb|EEF60024.1| hypothetical protein Cflav_PD3083 [bacterium Ellin514]
Length=108

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 19/74 (26%)
 Frame = -2

Query  608  VEAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPK  429
            VEAVK+TGD  VPAG VT+RA +                    +  G+G+IAE+GF+NP+
Sbjct  38   VEAVKITGDDYVPAGTVTWRADL-------------------KTLIGEGQIAEHGFRNPR  78

Query  428  WVEGELLQLNGKGV  387
            ++ G+L  LN + +
Sbjct  79   FIPGKLTLLNSERI  92



>ref|XP_003345472.1| hypothetical protein SMAC_07459 [Sordaria macrospora k-hell]
 emb|CCC13823.1| unnamed protein product [Sordaria macrospora k-hell]
Length=644

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 66/143 (46%), Gaps = 14/143 (10%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRK---YGNWNVRDEEKSSGMEFFEY----------VEAV  597
            P+ G++VG +GP+G E + + +         V+ +E  +  EF             +  +
Sbjct  491  PYRGIFVGHYGPHGCEFILMHQPDDGEAAETVQRKEDETDEEFTRRNQEAKVYRGGLAGI  550

Query  596  KLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEG  417
            KLTGD NVP G+ TF AK   G+    K    +E       K +G +AE+ F++  W++ 
Sbjct  551  KLTGDPNVPRGEYTFVAK-DIGDEGFVKVAEEEEFAGARVVKAKGHVAEHNFRDDDWIDC  609

Query  416  ELLQLNGKGVGPHIKGADLGFLY  348
            +L   +   +  H    D+  ++
Sbjct  610  DLFLASHNRLALHWHRWDMTSVF  632



>gb|EXM07624.1| hypothetical protein FOIG_02612 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=499

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESGEEWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  459  SDRYIESQLIFVSHDRLAQHWVG  481



>gb|EXA50992.1| hypothetical protein FOVG_03487 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA50993.1| hypothetical protein FOVG_03487 [Fusarium oxysporum f. sp. pisi 
HDV247]
Length=499

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSTTDEELGLVRRDSESDEEWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  459  SDRYIESQLIFVSHDRLAQHWVG  481



>gb|EXM07625.1| hypothetical protein FOIG_02612 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=480

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  321  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESGEEWQARRTEGRTFQ  380

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  381  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  439

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  440  SDRYIESQLIFVSHDRLAQHWVG  462



>gb|EXA50994.1| hypothetical protein FOVG_03487 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA50995.1| hypothetical protein FOVG_03487 [Fusarium oxysporum f. sp. pisi 
HDV247]
Length=480

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  321  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSTTDEELGLVRRDSESDEEWQARRTEGRTFQ  380

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  381  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  439

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  440  SDRYIESQLIFVSHDRLAQHWVG  462



>gb|EXM35568.1| hypothetical protein FOTG_00029 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM35569.1| hypothetical protein FOTG_00029 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=499

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  459  SDRYIESQLIFVSHDRLAQHWVG  481



>gb|EXM35570.1| hypothetical protein FOTG_00029 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM35571.1| hypothetical protein FOTG_00029 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=480

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  321  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  380

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  381  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  439

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  440  SDRYIESQLIFVSHDRLAQHWVG  462



>gb|EGU87599.1| hypothetical protein FOXB_01884 [Fusarium oxysporum Fo5176]
 gb|EXK99616.1| hypothetical protein FOQG_00083 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK99617.1| hypothetical protein FOQG_00083 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL79227.1| hypothetical protein FOPG_06759 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL79228.1| hypothetical protein FOPG_06759 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=499

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  459  SDRYIESQLIFVSHDRLAQHWVG  481



>gb|EXK99618.1| hypothetical protein FOQG_00083 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK99619.1| hypothetical protein FOQG_00083 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL79229.1| hypothetical protein FOPG_06759 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL79230.1| hypothetical protein FOPG_06759 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=480

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  321  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  380

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  381  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  439

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  440  SDRYIESQLIFVSHDRLAQHWVG  462



>emb|CCT65466.1| uncharacterized protein FFUJ_02409 [Fusarium fujikuroi IMI 58289]
Length=499

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 68/143 (48%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLVHQPDDETSATDEELGLVRRDSETDEAWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
            + +++E +L+ ++   +  H  G
Sbjct  459  SDRYIESQLIFVSHDRLAQHWVG  481



>ref|XP_001556545.1| hypothetical protein BC1G_05314 [Botrytis cinerea B05.10]
Length=235

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 34/162 (21%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----KSSGMEFFE-----------YV  606
            P+ G++VG +  +G E + L ++ G    +DE      K    E +E            +
Sbjct  82   PYRGIFVGDYSGHGCEYLLLDQRDG-LQKQDESTILKLKDESHEAWEARKGQTRIPTGSL  140

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGM-------YPDELGVVASYKGQGRIAEY  447
             A+KLTGD N+P G+VT+ A     +  ++KG+       +P    V    K +G+IA  
Sbjct  141  CAIKLTGDPNIPRGEVTWVA-----DDISDKGLVRYGEKDWPGARIV----KSRGQIANQ  191

Query  446  GFKNPKWVEGELLQLNGKGVGPH-IKGADLGFLYVIPEHSFL  324
            G+KNPK++E EL+ ++   +  H +    + F Y +   S++
Sbjct  192  GYKNPKFIETELIMISPDVLAQHWVPFGHISFFYRVDIDSYI  233



>ref|XP_001905694.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP65937.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP30200.1| Putative protein of unknown function [Podospora anserina S mat+]
Length=539

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 16/128 (13%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRK-----YGNWNVRDEEKSSGMEFFEY----------VE  603
            PF G++VG +  +G E + + +      +   +++  E+ S  EF +           +E
Sbjct  384  PFRGIWVGDYSGHGCEFLLVTQPDDETPFDAESIQPREEESPDEFEKRKHDETVYRGPLE  443

Query  602  AVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWV  423
            AVKLTGD NVP G+VTFRA         N   Y    GV    K QG +   GF N  ++
Sbjct  444  AVKLTGDPNVPRGEVTFRAADLGERGLINICQYEPFEGVRI-VKSQGHVGSTGFVNDSFI  502

Query  422  EGELLQLN  399
            E +LL ++
Sbjct  503  ESQLLLIS  510



>emb|CCD43037.1| similar to F-box domain-containing protein [Botrytis cinerea 
T4]
Length=498

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 34/162 (21%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----KSSGMEFFE-----------YV  606
            P+ G++VG +  +G E + L ++ G    +DE      K    E +E            +
Sbjct  345  PYRGIFVGDYSGHGCEYLLLDQRDG-LQKQDESTILKLKDESHEAWEARKGQTRIPTGSL  403

Query  605  EAVKLTGDMNVPAGQVTFRAKIGKGNRFTNKGM-------YPDELGVVASYKGQGRIAEY  447
             A+KLTGD N+P G+VT+ A     +  ++KG+       +P    V    K +G+IA  
Sbjct  404  CAIKLTGDPNIPRGEVTWVA-----DDISDKGLVRYGEKDWPGARIV----KSRGQIANQ  454

Query  446  GFKNPKWVEGELLQLNGKGVGPH-IKGADLGFLYVIPEHSFL  324
            G+KNPK++E EL+ ++   +  H +    + F Y +   S++
Sbjct  455  GYKNPKFIETELIMISPDVLAQHWVPFGHISFFYRVDIDSYI  496



>gb|EWZ45717.1| hypothetical protein FOZG_05951 [Fusarium oxysporum Fo47]
 gb|EWZ45718.1| hypothetical protein FOZG_05951 [Fusarium oxysporum Fo47]
 gb|EWZ97461.1| hypothetical protein FOWG_01931 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ97462.1| hypothetical protein FOWG_01931 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=499

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 67/143 (47%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
              +++E +L+ ++   +  H  G
Sbjct  459  LDRYIESQLIFVSHNRLAQHWVG  481



>gb|EXL63069.1| hypothetical protein FOCG_01457 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL63070.1| hypothetical protein FOCG_01457 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=499

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 67/143 (47%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  340  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  399

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  400  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  458

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
              +++E +L+ ++   +  H  G
Sbjct  459  LDRYIESQLIFVSHNRLAQHWVG  481



>ref|XP_002288494.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93930.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=429

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 61/118 (52%), Gaps = 28/118 (24%)
 Frame = -2

Query  728  GLYVGAFGPYGTEVVQLKRKYGNWNVRDEEKSSGMEFFEYVEAVKLTGDMNVPAGQVTFR  549
            GL+VG +G  G E+V +               SG    + + A K+TGD NVP G+++F 
Sbjct  254  GLWVGKYGENGYEMVNIT-------------YSG----DTLVATKVTGDQNVPRGEISFT  296

Query  548  AKIGKGNRF-TNKGMYPDELGVVASYK----------GQGRIAEYGFKNPKWVEGELL  408
            A +    +F T  G+ P EL   A+ +          G+G++A  G++N +W++G+L+
Sbjct  297  ANLSPRAQFQTMSGLEPIELNARAARQWGKRYLPRHVGKGQVASEGYQNAQWMDGQLI  354



>gb|EXL63071.1| hypothetical protein FOCG_01457 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL63072.1| hypothetical protein FOCG_01457 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=480

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 67/143 (47%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  321  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  380

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  381  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  439

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
              +++E +L+ ++   +  H  G
Sbjct  440  LDRYIESQLIFVSHNRLAQHWVG  462



>gb|EWZ45719.1| hypothetical protein FOZG_05951 [Fusarium oxysporum Fo47]
 gb|EWZ45720.1| hypothetical protein FOZG_05951 [Fusarium oxysporum Fo47]
 gb|EWZ97463.1| hypothetical protein FOWG_01931 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ97464.1| hypothetical protein FOWG_01931 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=480

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 67/143 (47%), Gaps = 19/143 (13%)
 Frame = -2

Query  743  LDPFDGLYVGAFGPYGTEVVQLKRKYGNWNVRDEE-----------------KSSGMEFF  615
            L P+ G++VG +  +G E + + +     +  DEE                 ++ G  F 
Sbjct  321  LKPWRGIWVGDYSTHGCEFLLIHQPDDETSATDEELGLVRRDSESDEEWQARRTEGRTFQ  380

Query  614  EYVEAVKLTGDMNVPAGQVTFRA-KIGKGNRFTNKGMYPDELGVVASYKGQGRIAEYGFK  438
              +EA+KLTGD NVP G++TF A  IG         + P   G+ A +  +G IA  GF 
Sbjct  381  GRLEAIKLTGDPNVPRGEITFVADDIGPDGVVDGPPVDPCFQGMRAVH-SKGHIANTGFA  439

Query  437  NPKWVEGELLQLNGKGVGPHIKG  369
              +++E +L+ ++   +  H  G
Sbjct  440  LDRYIESQLIFVSHNRLAQHWVG  462



>gb|EYE99676.1| hypothetical protein EURHEDRAFT_446032 [Aspergillus ruber CBS 
135680]
Length=452

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 65/116 (56%), Gaps = 11/116 (9%)
 Frame = -2

Query  737  PFDGLYVGAFGPYGTE-VVQLKRKYGNWNVRDEEKSSGMEFFEY--VEAVKLTGDMNVPA  567
            P+ G++VG +  +G E ++ L+R   + +    E +   E+  +  +EA+KLTGD NVP 
Sbjct  311  PYQGIWVGDYSAHGCEFLLFLQRDTTDASTASAE-TENTEWIPHGRLEAIKLTGDPNVPR  369

Query  566  GQVTFRAK-IGKGN--RFTNKGMYPDELGVVASYKGQGRIAEYGFKNPKWVEGELL  408
            G+++F  + IG+G   R  N  ++ +   V    + +G +A  GF++  W+  +L+
Sbjct  370  GEISFAVEDIGQGGFVRIANDSLFRNARVV----RSEGHVAGLGFRDDTWLPSQLI  421



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360