BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051D02

Length=734
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620200.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    408   9e-138   Nicotiana tomentosiformis
ref|XP_009804022.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    407   1e-137   Nicotiana sylvestris
emb|CDO98596.1|  unnamed protein product                                396   3e-133   Coffea canephora [robusta coffee]
ref|XP_006353749.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    393   8e-132   Solanum tuberosum [potatoes]
ref|XP_010323966.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    388   4e-130   Solanum lycopersicum
ref|XP_004243668.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    387   9e-130   Solanum lycopersicum
ref|XP_010417504.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    379   9e-128   Camelina sativa [gold-of-pleasure]
ref|XP_010472724.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    378   1e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010429752.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    378   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006436405.1|  hypothetical protein CICLE_v10031422mg             376   2e-127   
dbj|BAD43982.1|  unnamed protein product                                375   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417502.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    379   1e-126   Camelina sativa [gold-of-pleasure]
ref|XP_007023655.1|  Pseudouridine synthase family protein              379   3e-126   
ref|XP_010429751.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    378   4e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010472723.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    378   5e-126   Camelina sativa [gold-of-pleasure]
gb|EYU34909.1|  hypothetical protein MIMGU_mgv1a006040mg                377   1e-125   Erythranthe guttata [common monkey flower]
ref|XP_006300371.1|  hypothetical protein CARUB_v10022381mg             377   1e-125   Capsella rubella
ref|XP_011074171.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    377   1e-125   Sesamum indicum [beniseed]
ref|XP_002267010.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    376   4e-125   Vitis vinifera
ref|XP_006436406.1|  hypothetical protein CICLE_v10031422mg             375   4e-125   Citrus clementina [clementine]
ref|XP_006468112.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    375   4e-125   Citrus sinensis [apfelsine]
emb|CBI18448.3|  unnamed protein product                                375   5e-125   Vitis vinifera
ref|NP_178012.2|  RNA pseudourine synthase 3                            375   7e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209989.1|  hypothetical protein PRUPE_ppa005240mg             374   1e-124   Prunus persica
ref|XP_010539606.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    374   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_008239134.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    374   2e-124   Prunus mume [ume]
gb|EYU23584.1|  hypothetical protein MIMGU_mgv1a026780mg                372   4e-124   Erythranthe guttata [common monkey flower]
ref|XP_002887761.1|  hypothetical protein ARALYDRAFT_477057             373   5e-124   Arabidopsis lyrata subsp. lyrata
gb|KHG09609.1|  hypothetical protein F383_12972                         371   1e-123   Gossypium arboreum [tree cotton]
gb|KJB56429.1|  hypothetical protein B456_009G119600                    367   2e-123   Gossypium raimondii
ref|XP_006389943.1|  hypothetical protein EUTSA_v10018480mg             371   2e-123   Eutrema salsugineum [saltwater cress]
gb|KJB56427.1|  hypothetical protein B456_009G119600                    366   2e-123   Gossypium raimondii
emb|CDX88490.1|  BnaC06g39340D                                          370   4e-123   
gb|AAC83020.1|  Contains similarity to gi|1786244 hypothetical 24...    369   3e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KJB56428.1|  hypothetical protein B456_009G119600                    368   3e-122   Gossypium raimondii
ref|XP_010263262.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    368   3e-122   Nelumbo nucifera [Indian lotus]
emb|CDX87423.1|  BnaA07g34500D                                          367   6e-122   
ref|XP_011028390.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    367   9e-122   Populus euphratica
ref|XP_002526838.1|  ribosomal pseudouridine synthase, putative         366   1e-121   Ricinus communis
ref|XP_006385075.1|  hypothetical protein POPTR_0004s23670g             365   2e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010111123.1|  RNA pseudourine synthase 3                         363   8e-121   
ref|XP_009106606.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    364   1e-120   Brassica rapa
ref|XP_010696109.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    359   1e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696108.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    360   2e-120   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21299.1|  hypothetical protein JCGZ_21770                         362   6e-120   Jatropha curcas
ref|XP_010094671.1|  RNA pseudourine synthase 3                         360   2e-119   
ref|XP_009358613.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    360   5e-119   Pyrus x bretschneideri [bai li]
ref|XP_006601251.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    356   8e-118   
ref|XP_004300876.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    357   9e-118   Fragaria vesca subsp. vesca
ref|XP_007160970.1|  hypothetical protein PHAVU_001G032500g             357   1e-117   Phaseolus vulgaris [French bean]
ref|XP_006601250.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    356   2e-117   Glycine max [soybeans]
ref|XP_008441208.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    356   2e-117   Cucumis melo [Oriental melon]
ref|XP_004515176.1|  PREDICTED: RNA pseudourine synthase 3, mitoc...    355   5e-117   Cicer arietinum [garbanzo]
gb|KDO44461.1|  hypothetical protein CISIN_1g042463mg                   355   5e-117   Citrus sinensis [apfelsine]
ref|XP_004158518.1|  PREDICTED: RNA pseudourine synthase 3, mitoc...    354   7e-117   
ref|XP_010063681.1|  PREDICTED: LOW QUALITY PROTEIN: RNA pseudour...    355   7e-117   Eucalyptus grandis [rose gum]
ref|XP_004138653.1|  PREDICTED: RNA pseudourine synthase 3, mitoc...    354   1e-116   
gb|KDP41142.1|  hypothetical protein JCGZ_03633                         352   7e-116   Jatropha curcas
gb|KGN63094.1|  hypothetical protein Csa_2G402020                       353   2e-115   Cucumis sativus [cucumbers]
gb|KHN37004.1|  RNA pseudourine synthase 3, mitochondrial               346   4e-114   Glycine soja [wild soybean]
ref|XP_009401551.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    345   3e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927194.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    345   5e-113   Elaeis guineensis
ref|NP_001167875.1|  uncharacterized protein LOC100381582               335   1e-112   
dbj|BAD09700.1|  putative ribosomal large subunit pseudouridine s...    339   1e-112   Oryza sativa Japonica Group [Japonica rice]
gb|KEH22051.1|  RNA pseudouridine synthase                              343   1e-111   Medicago truncatula
ref|XP_008807168.1|  PREDICTED: LOW QUALITY PROTEIN: RNA pseudour...    341   2e-111   
dbj|BAJ88492.1|  predicted protein                                      337   2e-111   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS65775.1|  hypothetical protein M569_09000                         340   2e-111   Genlisea aurea
gb|AFW61501.1|  hypothetical protein ZEAMMB73_778378                    335   4e-111   
ref|XP_006659607.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    335   7e-111   
ref|NP_001062265.1|  Os08g0520100                                       338   2e-110   
gb|EAZ43360.1|  hypothetical protein OsJ_27960                          338   3e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004974856.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    333   8e-109   
ref|XP_008677489.1|  PREDICTED: uncharacterized protein LOC100381...    334   9e-109   
gb|KFK42267.1|  hypothetical protein AALP_AA2G233400                    327   2e-106   Arabis alpina [alpine rockcress]
ref|XP_003572398.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    327   6e-106   Brachypodium distachyon [annual false brome]
ref|XP_002444745.1|  hypothetical protein SORBIDRAFT_07g027030          325   1e-105   
gb|EMT10490.1|  RNA pseudourine synthase 3, mitochondrial               320   9e-105   
gb|AGT16005.1|  hypothetical protein SHCRBa_115_J16_R_190               320   5e-104   Saccharum hybrid cultivar R570
ref|XP_006843179.1|  hypothetical protein AMTR_s00146p00072100          320   9e-104   Amborella trichopoda
ref|XP_008361299.1|  PREDICTED: LOW QUALITY PROTEIN: RNA pseudour...    309   1e-99    
gb|EMS66956.1|  RNA pseudourine synthase 3, mitochondrial               302   2e-97    Triticum urartu
ref|XP_010911043.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    233   8e-74    
gb|EYU24288.1|  hypothetical protein MIMGU_mgv1a0228501mg               222   9e-70    Erythranthe guttata [common monkey flower]
ref|XP_010647894.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    221   1e-65    Vitis vinifera
ref|XP_002282614.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    221   3e-65    Vitis vinifera
ref|XP_006847251.1|  hypothetical protein AMTR_s00015p00025410          215   4e-63    
ref|XP_006487001.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    207   4e-62    
gb|KDO59819.1|  hypothetical protein CISIN_1g023907mg                   206   9e-62    Citrus sinensis [apfelsine]
ref|XP_006486999.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    208   3e-61    
gb|KDO59820.1|  hypothetical protein CISIN_1g023907mg                   204   4e-61    Citrus sinensis [apfelsine]
ref|XP_007042534.1|  Ribosomal pseudouridine synthase, putative         209   2e-60    
ref|XP_004511295.1|  PREDICTED: RNA pseudourine synthase 4, mitoc...    207   4e-60    Cicer arietinum [garbanzo]
ref|XP_009378853.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    204   8e-60    
ref|XP_010271251.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    207   1e-59    Nelumbo nucifera [Indian lotus]
ref|XP_009341344.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    207   1e-59    Pyrus x bretschneideri [bai li]
ref|XP_011001179.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    204   1e-58    Populus euphratica
ref|XP_011001172.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    203   2e-58    Populus euphratica
ref|XP_006422925.1|  hypothetical protein CICLE_v10028283mg             204   2e-58    
gb|KDP45903.1|  hypothetical protein JCGZ_15463                         202   4e-58    Jatropha curcas
ref|XP_008236380.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    202   8e-58    Prunus mume [ume]
gb|KEH27320.1|  RNA pseudouridine synthase                              199   1e-57    Medicago truncatula
ref|XP_010096290.1|  RNA pseudourine synthase 4                         201   1e-57    Morus notabilis
ref|XP_002518674.1|  ribosomal pseudouridine synthase, putative         202   2e-57    
ref|XP_008812838.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    201   2e-57    Phoenix dactylifera
ref|XP_007199810.1|  hypothetical protein PRUPE_ppa004969mg             201   2e-57    Prunus persica
ref|XP_003635999.1|  RNA pseudourine synthase                           198   6e-57    
ref|XP_010943216.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    199   7e-57    Elaeis guineensis
ref|XP_006346360.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    197   3e-56    
gb|KJB12280.1|  hypothetical protein B456_002G009500                    197   3e-56    Gossypium raimondii
ref|XP_004230733.2|  PREDICTED: RNA pseudouridine synthase 4, mit...    197   6e-56    Solanum lycopersicum
ref|XP_010943215.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    197   8e-56    Elaeis guineensis
ref|XP_002313876.2|  hypothetical protein POPTR_0009s09860g             196   2e-55    
ref|XP_007199809.1|  hypothetical protein PRUPE_ppa004969mg             195   4e-55    
ref|XP_009805028.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    195   4e-55    Nicotiana sylvestris
ref|XP_009805027.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    195   5e-55    Nicotiana sylvestris
ref|XP_009629273.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    190   1e-54    Nicotiana tomentosiformis
gb|ACR37582.1|  unknown                                                 187   3e-54    Zea mays [maize]
ref|XP_003516775.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    191   4e-54    Glycine max [soybeans]
ref|XP_006573909.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    191   4e-54    Glycine max [soybeans]
ref|XP_010507743.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    192   6e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010466089.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    191   8e-54    Camelina sativa [gold-of-pleasure]
ref|XP_007157229.1|  hypothetical protein PHAVU_002G053600g             190   9e-54    Phaseolus vulgaris [French bean]
ref|XP_009629272.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    191   1e-53    Nicotiana tomentosiformis
emb|CDO97224.1|  unnamed protein product                                191   1e-53    Coffea canephora [robusta coffee]
ref|XP_010487888.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    190   2e-53    Camelina sativa [gold-of-pleasure]
ref|XP_009145786.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    188   1e-52    Brassica rapa
gb|EYU42699.1|  hypothetical protein MIMGU_mgv1a006097mg                187   1e-52    Erythranthe guttata [common monkey flower]
ref|XP_003576723.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    187   2e-52    Brachypodium distachyon [annual false brome]
gb|KGN43882.1|  hypothetical protein Csa_7G072200                       184   2e-52    Cucumis sativus [cucumbers]
ref|XP_011092538.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    187   3e-52    Sesamum indicum [beniseed]
ref|XP_008651548.1|  PREDICTED: LOC100285271 isoform X1                 187   3e-52    
ref|XP_009396599.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    187   4e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010691670.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    187   4e-52    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004956276.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    186   6e-52    Setaria italica
ref|XP_008454996.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    186   6e-52    Cucumis melo [Oriental melon]
gb|EEE69173.1|  hypothetical protein OsJ_28343                          186   7e-52    Oryza sativa Japonica Group [Japonica rice]
gb|EEC84066.1|  hypothetical protein OsI_30347                          186   9e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_004954753.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    186   2e-51    
ref|XP_006297582.1|  hypothetical protein CARUB_v10013603mg             184   3e-51    Capsella rubella
ref|XP_004137095.1|  PREDICTED: RNA pseudourine synthase 4, mitoc...    184   5e-51    
ref|XP_004305959.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    184   5e-51    Fragaria vesca subsp. vesca
gb|EMT04250.1|  RNA pseudourine synthase 4, mitochondrial               183   9e-51    
ref|XP_004170490.1|  PREDICTED: RNA pseudourine synthase 4, mitoc...    183   9e-51    
gb|EMS51241.1|  RNA pseudourine synthase 4, mitochondrial               183   9e-51    Triticum urartu
emb|CDY46174.1|  BnaA05g20610D                                          183   1e-50    Brassica napus [oilseed rape]
dbj|BAK06727.1|  predicted protein                                      182   2e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_188575.1|  RNA pseudourine synthase 4                            182   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406501.1|  hypothetical protein EUTSA_v10020633mg             181   6e-50    Eutrema salsugineum [saltwater cress]
ref|XP_002883182.1|  pseudouridine synthase family protein              181   7e-50    Arabidopsis lyrata subsp. lyrata
ref|XP_006651552.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    179   2e-49    
gb|KHG26351.1|  hypothetical protein F383_00972                         179   4e-49    Gossypium arboreum [tree cotton]
ref|XP_010538615.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    178   5e-49    Tarenaya hassleriana [spider flower]
emb|CDX99223.1|  BnaC05g33380D                                          177   2e-48    
gb|KFK39271.1|  hypothetical protein AALP_AA3G222700                    174   1e-47    Arabis alpina [alpine rockcress]
ref|XP_001759658.1|  predicted protein                                  169   3e-47    
ref|XP_010065966.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    172   2e-46    Eucalyptus grandis [rose gum]
ref|XP_002985813.1|  hypothetical protein SELMODRAFT_123269             168   4e-46    
ref|XP_002984751.1|  hypothetical protein SELMODRAFT_121195             168   4e-46    
ref|XP_010507750.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    171   4e-46    
ref|NP_001151637.1|  LOC100285271                                       170   5e-46    
ref|XP_010024063.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    170   8e-46    Eucalyptus grandis [rose gum]
ref|XP_010693154.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    157   2e-44    
gb|KJB56431.1|  hypothetical protein B456_009G119600                    161   3e-43    Gossypium raimondii
gb|KJB56432.1|  hypothetical protein B456_009G119600                    160   3e-43    Gossypium raimondii
ref|XP_010695900.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    154   5e-43    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010271255.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    160   1e-42    Nelumbo nucifera [Indian lotus]
gb|EYU24287.1|  hypothetical protein MIMGU_mgv1a0228502mg               157   2e-42    Erythranthe guttata [common monkey flower]
ref|XP_010093260.1|  hypothetical protein L484_000201                   146   8e-41    
ref|XP_004515177.1|  PREDICTED: RNA pseudourine synthase 3, mitoc...    152   6e-40    
tpg|DAA60656.1|  TPA: hypothetical protein ZEAMMB73_133926              149   3e-38    
gb|KCW70916.1|  hypothetical protein EUGRSUZ_F04033                     113   4e-38    Eucalyptus grandis [rose gum]
tpg|DAA60657.1|  TPA: hypothetical protein ZEAMMB73_133926              132   8e-32    
ref|XP_010326297.1|  PREDICTED: RNA pseudouridine synthase 3, mit...    124   8e-32    
ref|XP_009805029.1|  PREDICTED: RNA pseudouridine synthase 4, mit...    103   4e-22    Nicotiana sylvestris
ref|XP_010279041.1|  PREDICTED: RNA pseudouridine synthase 4, mit...  97.1    4e-21    Nelumbo nucifera [Indian lotus]
ref|XP_010271260.1|  PREDICTED: RNA pseudouridine synthase 4, mit...  99.8    6e-21    Nelumbo nucifera [Indian lotus]
ref|XP_010279040.1|  PREDICTED: RNA pseudouridine synthase 4, mit...  96.7    8e-21    Nelumbo nucifera [Indian lotus]
ref|XP_005714249.1|  unnamed protein product                          98.2    2e-20    Chondrus crispus [carageen]
ref|WP_014240363.1|  pseudouridine synthase                           94.4    1e-19    Azospirillum brasilense
ref|WP_035673581.1|  pseudouridine synthase                           94.4    2e-19    Azospirillum
ref|WP_038527907.1|  pseudouridine synthase                           92.0    9e-19    Azospirillum brasilense
gb|EFA78208.1|  Probable ribosomal large subunit pseudouridine sy...  94.7    2e-18    Heterostelium album PN500
dbj|GAM19537.1|  hypothetical protein SAMD00019534_027120             94.0    3e-18    Acytostelium subglobosum LB1
ref|WP_029603870.1|  pseudouridine synthase                           89.7    1e-17    Kozakia baliensis
gb|EFL90075.1|  rRNA pseudouridylate synthase C                       89.4    2e-17    Ahrensia sp. R2A130
ref|WP_040304703.1|  pseudouridine synthase                           89.4    2e-17    Ahrensia sp. R2A130
ref|XP_003290575.1|  hypothetical protein DICPUDRAFT_81306            90.5    3e-17    Dictyostelium purpureum
emb|CCG09371.1|  Pseudouridine synthase                               87.4    1e-16    Pararhodospirillum photometricum DSM 122
ref|WP_043337633.1|  pseudouridine synthase                           86.7    1e-16    Belnapia moabensis
ref|WP_020401271.1|  hypothetical protein                             86.3    2e-16    Kordiimonas gwangyangensis
ref|XP_004350370.1|  putative ribosomal large subunit pseudouridi...  88.6    2e-16    Cavenderia fasciculata
ref|WP_011390409.1|  pseudouridine synthase                           85.9    3e-16    Rhodospirillum rubrum
ref|WP_019013199.1|  hypothetical protein                             84.7    6e-16    Elioraea tepidiphila
ref|NP_001062556.1|  Os09g0103500                                     86.3    6e-16    
ref|WP_043358896.1|  pseudouridine synthase                           84.3    8e-16    Belnapia sp. F-4-1
gb|ABD27273.1|  ribosomal large subunit pseudouridine synthase C      85.5    1e-15    Novosphingobium aromaticivorans DSM 12444
ref|WP_041551261.1|  pseudouridine synthase                           85.5    1e-15    Novosphingobium
ref|WP_021999249.1|  pseudouridine synthase                           84.0    1e-15    
ref|WP_024849769.1|  pseudouridine synthase                           84.0    1e-15    Aminobacter sp. J41
ref|WP_007197145.1|  pseudouridine synthase                           83.6    1e-15    Hoeflea phototrophica
ref|XP_002672650.1|  predicted protein                                85.9    2e-15    Naegleria gruberi strain NEG-M
gb|EKE08954.1|  Pseudouridine synthase                                83.2    2e-15    uncultured bacterium
ref|XP_006660410.1|  PREDICTED: RNA pseudouridine synthase 4, mit...  84.3    2e-15    
ref|WP_009452506.1|  pseudouridine synthase                           83.2    2e-15    Nitratireductor indicus
ref|WP_007066556.1|  pseudouridine synthase                           82.4    4e-15    Fulvimarina pelagi
ref|XP_638115.1|  hypothetical protein DDB_G0285543                   84.7    4e-15    Dictyostelium discoideum AX4
ref|WP_025886626.1|  pseudouridine synthase                           82.4    4e-15    Asaia prunellae
ref|WP_039096046.1|  pseudouridine synthase                           82.8    4e-15    
ref|WP_040965006.1|  pseudouridine synthase                           82.8    5e-15    Erythrobacter vulgaris
emb|CDQ74527.1|  unnamed protein product                              83.2    5e-15    Oncorhynchus mykiss
ref|WP_035528357.1|  pseudouridine synthase                           82.0    6e-15    Hoeflea sp. BAL378
ref|WP_039196130.1|  pseudouridine synthase                           81.6    7e-15    Aureimonas altamirensis
ref|WP_019998934.1|  pseudouridine synthase                           81.6    7e-15    Aureimonas ureilytica
ref|WP_039331683.1|  pseudouridine synthase                           82.8    8e-15    Novosphingobium subterraneum
ref|WP_028096591.1|  pseudouridine synthase                           81.6    9e-15    Dongia sp. URHE0060
ref|WP_008597531.1|  pseudouridine synthase                           81.3    9e-15    Nitratireductor pacificus
ref|WP_028641933.1|  pseudouridine synthase                           82.8    1e-14    Novosphingobium acidiphilum
ref|WP_010239011.1|  pseudouridine synthase                           82.0    1e-14    Citromicrobium
ref|WP_040994651.1|  pseudouridine synthase                           80.9    1e-14    Mesorhizobium sp. SOD10
ref|WP_025823971.1|  pseudouridine synthase                           80.9    1e-14    Asaia astilbis
ref|WP_041006782.1|  pseudouridine synthase                           80.9    1e-14    Mesorhizobium plurifarium
ref|WP_040982994.1|  pseudouridine synthase                           80.9    1e-14    Mesorhizobium plurifarium
ref|WP_043744764.1|  pseudouridine synthase                           80.9    1e-14    Magnetospirillum magneticum
ref|WP_002726010.1|  pseudouridine synthase                           80.9    1e-14    Phaeospirillum molischianum
ref|WP_021131582.1|  23S rRNA pseudouridylate synthase                80.9    1e-14    Phaeospirillum fulvum
ref|WP_019370883.1|  pseudouridine synthase                           81.3    2e-14    Sphingomonas
ref|WP_029008013.1|  pseudouridine synthase                           79.3    2e-14    Azospirillum halopraeferens
ref|WP_013215522.1|  pseudouridine synthase                           80.5    2e-14    Hyphomicrobium denitrificans
ref|WP_010667066.1|  pseudouridine synthase                           80.5    2e-14    Acetobacter aceti
ref|WP_008837745.1|  pseudouridine synthase                           80.5    2e-14    Mesorhizobium alhagi
ref|WP_014891235.1|  pseudouridine synthase                           80.9    2e-14    Methylocystis sp. SC2
ref|WP_040970394.1|  pseudouridine synthase                           80.5    2e-14    Mesorhizobium sp. ORS 3324
ref|WP_010544344.1|  pseudouridine synthase                           80.9    2e-14    Sphingomonas elodea
ref|WP_024924791.1|  MULTISPECIES: pseudouridine synthase             80.1    3e-14    Mesorhizobium
ref|WP_026203778.1|  pseudouridine synthase                           80.1    3e-14    Rhizobium giardinii
ref|WP_042642232.1|  pseudouridine synthase                           80.1    3e-14    Mesorhizobium sp. ORS 3359
ref|WP_034504892.1|  pseudouridine synthase                           80.1    3e-14    Agrobacterium rhizogenes
ref|WP_036306420.1|  membrane protein                                 80.1    3e-14    Methylopila sp. 73B
ref|WP_012226160.1|  pseudouridine synthase                           79.7    3e-14    Gluconacetobacter diazotrophicus
ref|WP_006834593.1|  pseudouridine synthase                           80.5    3e-14    Erythrobacter sp. SD-21
ref|WP_015597654.1|  pseudouridine synthase                           79.7    3e-14    Hyphomicrobium denitrificans
ref|WP_023977683.1|  MULTISPECIES: pseudouridine synthase             79.7    4e-14    Asaia
emb|CCQ75210.1|  putative RNA pseudouridine synthase                  78.6    4e-14    Magnetospira sp. QH-2
ref|WP_007435118.1|  pseudouridine synthase                           79.7    4e-14    Acetobacteraceae bacterium AT-5844
ref|WP_008492315.1|  pseudouridine synthase                           79.7    4e-14    Acidocella sp. MX-AZ02
emb|CBS90560.1|  Pseudouridine synthase                               78.6    4e-14    Azospirillum lipoferum 4B
ref|WP_026440287.1|  pseudouridine synthase                           79.7    4e-14    Acidocella facilis
ref|WP_044553313.1|  pseudouridine synthase                           78.6    4e-14    
ref|WP_009541243.1|  Ribosomal large subunit pseudouridine syntha...  79.3    5e-14    Caenispirillum salinarum
ref|WP_018428051.1|  pseudouridine synthase                           79.3    5e-14    Hoeflea sp. 108
ref|WP_007406124.1|  MULTISPECIES: pseudouridine synthase             79.7    6e-14    Sphingomonas
ref|WP_026617364.1|  pseudouridine synthase                           79.0    6e-14    Ensifer aridi
ref|WP_037534444.1|  pseudouridine synthase                           79.7    6e-14    Sphingomonas sp. RIT328
ref|XP_006573910.1|  PREDICTED: RNA pseudouridine synthase 4, mit...  79.0    7e-14    
ref|WP_026622841.1|  pseudouridine synthase                           79.0    7e-14    Ensifer sp. WSM1721
ref|WP_019646015.1|  hypothetical protein                             79.0    8e-14    Novispirillum itersonii
ref|WP_037133545.1|  pseudouridine synthase                           79.0    8e-14    Rhizobium sp. CF097
ref|WP_023675121.1|  pseudouridine synthase                           79.0    8e-14    Mesorhizobium sp. LSJC280B00
ref|WP_019461184.1|  MULTISPECIES: hypothetical protein               78.6    9e-14    Roseomonas
ref|WP_025437476.1|  pseudouridine synthase                           78.6    9e-14    Komagataeibacter xylinus
ref|WP_025899885.1|  pseudouridine synthase                           78.6    9e-14    Sneathiella glossodoripedis
ref|WP_023717531.1|  pseudouridine synthase                           78.6    9e-14    Mesorhizobium sp. LSHC420B00
ref|WP_027444057.1|  pseudouridine synthase                           79.3    1e-13    
ref|WP_012977665.1|  MULTISPECIES: pseudouridine synthase             77.8    1e-13    Alphaproteobacteria
ref|WP_023788071.1|  pseudouridine synthase                           78.6    1e-13    Hyphomicrobium nitrativorans
ref|WP_029352250.1|  pseudouridine synthase                           78.6    1e-13    Mesorhizobium ciceri
ref|WP_010909296.1|  pseudouridine synthase                           78.2    1e-13    Mesorhizobium
ref|WP_008615415.1|  23S rRNA pseudouridylate synthase                78.2    1e-13    Magnetospirillum caucaseum
ref|WP_023799271.1|  pseudouridine synthase                           78.2    1e-13    Mesorhizobium sp. L48C026A00
ref|WP_027279921.1|  pseudouridine synthase                           78.2    1e-13    Roseomonas gilardii
ref|WP_037202306.1|  pseudouridine synthase                           78.2    1e-13    Rhizobium
ref|WP_006728528.1|  pseudouridine synthase                           78.2    1e-13    Agrobacterium albertimagni
ref|WP_014187812.1|  pseudouridine synthase                           77.0    1e-13    Azospirillum lipoferum
ref|WP_025825852.1|  pseudouridine synthase                           78.2    1e-13    Acetobacter persici
ref|WP_018445236.1|  pseudouridine synthase                           78.2    1e-13    Rhizobium gallicum
ref|WP_018242151.1|  pseudouridine synthase                           78.2    1e-13    Rhizobium leguminosarum
ref|WP_021234708.1|  pseudouridine synthase                           79.0    1e-13    Novosphingobium lindaniclasticum
ref|WP_006333415.1|  Pseudouridine synthase                           78.2    1e-13    Mesorhizobium sp. STM 4661
ref|XP_001372198.1|  PREDICTED: RNA pseudouridylate synthase doma...  78.6    2e-13    
ref|WP_023755196.1|  MULTISPECIES: pseudouridine synthase             78.2    2e-13    
ref|WP_041039831.1|  pseudouridine synthase                           78.2    2e-13    
ref|WP_029874201.1|  pseudouridine synthase                           78.2    2e-13    
ref|WP_043060129.1|  pseudouridine synthase                           79.0    2e-13    
ref|WP_035032358.1|  MULTISPECIES: pseudouridine synthase             77.8    2e-13    
ref|WP_040715702.1|  pseudouridine synthase                           79.0    2e-13    
gb|KIM00060.1|  Ribosomal large subunit pseudouridine synthase C      77.8    2e-13    
ref|WP_024509013.1|  hypothetical protein                             79.0    2e-13    
ref|WP_015317967.1|  MULTISPECIES: pseudouridine synthase             77.8    2e-13    
ref|WP_017978300.1|  pseudouridine synthase                           79.0    2e-13    
ref|WP_008851820.1|  ribosomal large subunit pseudouridine syntha...  76.6    2e-13    
ref|WP_029139967.1|  pseudouridine synthase                           78.6    2e-13    
dbj|GAD49414.1|  putative pseudouridine synthase                      79.0    2e-13    
ref|WP_017964438.1|  pseudouridine synthase                           77.8    2e-13    
ref|WP_042692997.1|  pseudouridine synthase                           76.6    2e-13    
ref|WP_027044993.1|  pseudouridine synthase                           77.8    2e-13    
ref|WP_032924913.1|  pseudouridine synthase                           77.8    2e-13    
ref|XP_003764442.1|  PREDICTED: RNA pseudouridylate synthase doma...  77.4    2e-13    
ref|WP_039857039.1|  pseudouridine synthase                           78.2    2e-13    
ref|WP_038461298.1|  hypothetical protein                             77.4    2e-13    
gb|EGG76163.1|  Ribosomal large subunit pseudouridine synthase C      77.8    2e-13    
ref|WP_034929026.1|  MULTISPECIES: pseudouridine synthase             77.8    2e-13    
ref|WP_018063081.1|  pseudouridine synthase                           77.8    2e-13    
ref|WP_029648966.1|  membrane protein                                 78.2    2e-13    
ref|WP_037453533.1|  pseudouridine synthase                           77.8    2e-13    
ref|WP_018980850.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_039004053.1|  pseudouridine synthase                           77.8    2e-13    
ref|WP_006205437.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_019091685.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_010507095.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_014106391.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_018485896.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_031446431.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_006924679.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_016554084.1|  RNA-pseudouridine synthase, ribosomal large ...  77.4    2e-13    
ref|XP_004995105.1|  hypothetical protein PTSG_04209                  77.0    2e-13    
ref|WP_018072213.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_010513921.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_027170345.1|  pseudouridine synthase                           77.4    2e-13    
ref|WP_020086114.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_007163236.1|  pseudouridine synthase                           78.2    3e-13    
ref|WP_028753113.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_042484539.1|  pseudouridine synthase                           77.8    3e-13    
ref|WP_028000174.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_025318255.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_038662848.1|  pseudouridine synthase                           77.8    3e-13    
ref|XP_010879269.1|  PREDICTED: RNA pseudouridylate synthase doma...  77.8    3e-13    
ref|WP_027028859.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_023698805.1|  MULTISPECIES: pseudouridine synthase             77.4    3e-13    
ref|WP_025319718.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_027684579.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_003537406.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_027145587.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_027051791.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_023726804.1|  MULTISPECIES: pseudouridine synthase             77.0    3e-13    
ref|WP_042692040.1|  pseudouridine synthase                           75.9    3e-13    
ref|WP_044828440.1|  pseudouridine synthase                           77.8    3e-13    
ref|WP_041606290.1|  hypothetical protein                             77.0    3e-13    
ref|WP_019857981.1|  MULTISPECIES: pseudouridine synthase             77.0    3e-13    
ref|WP_025286100.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_011652121.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_025495429.1|  pseudouridine synthase                           77.8    3e-13    
ref|XP_005741526.1|  PREDICTED: RNA pseudouridylate synthase doma...  77.8    3e-13    
gb|AFK54441.1|  ribosomal large subunit pseudouridine synthase C      77.0    3e-13    
ref|WP_007009543.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_022734179.1|  pseudouridine synthase                           77.4    3e-13    
ref|WP_027154029.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_007629204.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_018407001.1|  pseudouridine synthase                           77.8    3e-13    
ref|WP_025030954.1|  pseudouridine synthase                           77.0    3e-13    
ref|WP_011643701.1|  ribosomal large subunit pseudouridine syntha...  77.0    3e-13    
ref|WP_015340001.1|  ribosomal large subunit pseudouridine syntha...  77.0    3e-13    
ref|WP_003539956.1|  pseudouridine synthase                           77.0    3e-13    
emb|CCB65758.1|  pseudouridylate synthase                             77.0    3e-13    
ref|WP_004675565.1|  pseudouridine synthase                           77.0    4e-13    
ref|WP_034960125.1|  hypothetical protein                             77.8    4e-13    
ref|WP_023750816.1|  pseudouridine synthase                           77.0    4e-13    
ref|WP_023691252.1|  MULTISPECIES: pseudouridine synthase             77.0    4e-13    
ref|WP_034903357.1|  pseudouridine synthase                           77.8    4e-13    
ref|WP_037149341.1|  pseudouridine synthase                           77.0    4e-13    
ref|WP_035575818.1|  MULTISPECIES: pseudouridine synthase             77.0    4e-13    
ref|WP_027284848.1|  pseudouridine synthase                           77.0    4e-13    
ref|WP_023701774.1|  pseudouridine synthase                           77.0    4e-13    
ref|WP_023672769.1|  MULTISPECIES: pseudouridine synthase             77.0    4e-13    
ref|WP_023818858.1|  pseudouridine synthase                           76.6    4e-13    
gb|KEO90321.1|  pseudouridine synthase                                77.8    4e-13    
ref|WP_008875682.1|  Pseudouridine synthase                           76.6    4e-13    
ref|WP_006277090.1|  RluA family pseudouridine synthase               76.6    4e-13    
ref|WP_013833097.1|  MULTISPECIES: pseudouridine synthase             77.8    4e-13    
ref|WP_003617948.1|  pseudouridine synthase                           76.6    4e-13    
ref|WP_008892206.1|  pseudouridine synthase                           77.4    4e-13    
ref|WP_023821361.1|  pseudouridine synthase                           76.6    4e-13    
gb|EJK81898.1|  pseudouridine synthase, RluA family                   76.6    4e-13    
ref|WP_043607631.1|  pseudouridine synthase                           77.0    4e-13    
ref|WP_041111967.1|  pseudouridine synthase                           76.6    5e-13    
gb|ABI61480.1|  ribosomal large subunit pseudouridine synthase C      77.0    5e-13    
ref|WP_006965629.1|  Ribosomal large subunit pseudouridine syntha...  77.8    5e-13    
gb|AHJ64988.1|  Ribosomal large subunit pseudouridine synthase C      77.0    5e-13    
gb|AHJ62361.1|  Ribosomal large subunit pseudouridine synthase C      77.0    5e-13    
ref|WP_013895683.1|  MULTISPECIES: pseudouridine synthase             76.6    5e-13    
ref|WP_042058723.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_017994166.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_011253188.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_018854923.1|  MULTISPECIES: pseudouridine synthase             76.6    5e-13    
ref|WP_039278281.1|  pseudouridine synthase                           77.4    5e-13    
ref|WP_037545365.1|  pseudouridine synthase                           77.0    5e-13    
ref|WP_024898734.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_012757582.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_012976176.1|  pseudouridine synthase                           75.1    5e-13    
ref|WP_007423036.1|  MULTISPECIES: pseudouridine synthase             76.6    5e-13    
ref|WP_017183991.1|  pseudouridine synthase                           77.8    5e-13    
ref|WP_035187511.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_019052903.1|  pseudouridine synthase                           77.8    5e-13    
ref|WP_034477477.1|  pseudouridine synthase                           76.6    5e-13    
ref|WP_024078417.1|  putative RNA pseudouridine synthase(rluC/rluD)   75.1    5e-13    
ref|WP_037503202.1|  pseudouridine synthase                           77.0    5e-13    
ref|XP_003441465.1|  PREDICTED: RNA pseudouridylate synthase doma...  77.0    5e-13    
ref|WP_037128068.1|  pseudouridine synthase                           76.6    6e-13    
ref|WP_018099565.1|  pseudouridine synthase                           76.3    6e-13    
ref|WP_039735495.1|  pseudouridine synthase                           76.3    6e-13    
ref|WP_006925162.1|  pseudouridine synthase                           76.3    6e-13    
ref|WP_039859745.1|  pseudouridine synthase                           74.7    6e-13    
gb|EMG54568.1|  RluA family pseudouridine synthase                    74.7    6e-13    
ref|WP_039974327.1|  pseudouridine synthase                           76.3    6e-13    
ref|WP_027057000.1|  pseudouridine synthase                           76.3    6e-13    
ref|WP_012651537.1|  MULTISPECIES: pseudouridine synthase             76.3    6e-13    
emb|CCD94089.1|  putative ribosomal large subunit pseudouridine s...  76.3    6e-13    
ref|WP_008850507.1|  pseudouridine synthase                           76.3    7e-13    
ref|WP_008995588.1|  pseudouridine synthase                           77.4    7e-13    
ref|WP_025394694.1|  pseudouridine synthase                           76.3    7e-13    
dbj|GAJ29170.1|  ribosomal 23S RNA pseudouridine synthase RluC        76.6    7e-13    
ref|WP_033067160.1|  pseudouridine synthase                           76.6    7e-13    
ref|WP_037100667.1|  pseudouridine synthase                           76.3    7e-13    
ref|WP_036054240.1|  pseudouridine synthase                           75.1    7e-13    
ref|WP_038012916.1|  pseudouridine synthase                           76.3    7e-13    
ref|WP_018010424.1|  pseudouridine synthase                           76.3    7e-13    
ref|WP_004690820.1|  MULTISPECIES: pseudouridine synthase             76.3    7e-13    
ref|WP_003568854.1|  pseudouridine synthase                           76.3    8e-13    
ref|NP_001039205.1|  RNA pseudouridylate synthase domain-containi...  75.9    8e-13    
ref|WP_003579459.1|  pseudouridine synthase                           76.3    8e-13    
gb|AEW13123.1|  pseudouridine synthase, RluA family protein           76.3    8e-13    
ref|WP_011413237.1|  pseudouridine synthase                           76.6    8e-13    
ref|WP_011975196.1|  MULTISPECIES: pseudouridine synthase             76.3    8e-13    
ref|WP_034159244.1|  pseudouridine synthase                           76.6    8e-13    
ref|WP_022698062.1|  ribosomal large subunit pseudouridine syntha...  75.9    8e-13    
ref|WP_006165788.1|  RluA family pseudouridine synthase               75.9    8e-13    
ref|WP_023515299.1|  ribosomal large subunit pseudouridine syntha...  75.9    8e-13    
ref|WP_003523610.1|  ribosomal large subunit pseudouridine syntha...  75.9    8e-13    
ref|WP_033182747.1|  pseudouridine synthase                           75.9    8e-13    
ref|WP_038312374.1|  pseudouridine synthase                           76.3    8e-13    
ref|XP_006783428.1|  PREDICTED: RNA pseudouridylate synthase doma...  76.6    8e-13    
ref|WP_036840469.1|  hypothetical protein                             76.3    8e-13    
ref|WP_027026977.1|  pseudouridine synthase                           75.9    8e-13    
ref|WP_010218445.1|  pseudouridine synthase                           76.6    8e-13    
ref|WP_043949259.1|  pseudouridine synthase                           75.9    8e-13    
ref|WP_014457000.1|  pseudouridine synthase                           75.9    9e-13    
ref|WP_027038726.1|  pseudouridine synthase                           75.9    9e-13    
ref|WP_007688178.1|  pseudouridine synthase                           77.0    9e-13    
ref|WP_003629620.1|  pseudouridine synthase                           75.9    9e-13    
ref|WP_010162252.1|  pseudouridine synthase                           76.3    9e-13    
ref|WP_003623964.1|  ribosomal RNA large subunit 23S rRNA pseudou...  75.9    9e-13    
ref|WP_035641070.1|  pseudouridine synthase                           76.3    9e-13    
ref|WP_042787565.1|  pseudouridine synthase                           75.9    9e-13    
ref|WP_037169542.1|  MULTISPECIES: pseudouridine synthase             75.9    9e-13    
ref|WP_012483948.1|  MULTISPECIES: pseudouridine synthase             75.9    1e-12    
ref|WP_022674206.1|  pseudouridine synthase                           76.3    1e-12    
ref|WP_023812076.1|  pseudouridine synthase                           75.9    1e-12    
ref|WP_037504490.1|  pseudouridine synthase                           76.3    1e-12    
ref|WP_026398567.1|  pseudouridine synthase                           75.9    1e-12    
ref|WP_027163357.1|  pseudouridine synthase                           75.9    1e-12    
ref|XP_007552445.1|  PREDICTED: RNA pseudouridylate synthase doma...  76.3    1e-12    
ref|WP_003559680.1|  pseudouridine synthase                           75.9    1e-12    
ref|WP_032450171.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_020050085.1|  pseudouridine synthase                           75.9    1e-12    
ref|WP_042994911.1|  pseudouridine synthase                           75.5    1e-12    
gb|EFG37997.1|  ribosomal large subunit pseudouridine synthase C      75.9    1e-12    
ref|WP_005766983.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_029618112.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_010971647.1|  MULTISPECIES: pseudouridine synthase             75.5    1e-12    
ref|WP_024021864.1|  pseudouridine synthase                           76.6    1e-12    
ref|WP_014130806.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_013531445.1|  pseudouridine synthase                           75.5    1e-12    
gb|EFM60720.1|  pseudouridine synthase, RluA family                   74.7    1e-12    
ref|XP_001518233.1|  PREDICTED: RNA pseudouridylate synthase doma...  75.1    1e-12    
ref|WP_033923210.1|  pseudouridine synthase                           75.9    1e-12    
ref|XP_005807378.1|  PREDICTED: RNA pseudouridylate synthase doma...  76.3    1e-12    
ref|WP_028735081.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_012111689.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_009542199.1|  Ribosomal large subunit pseudouridine syntha...  74.3    1e-12    
ref|WP_014924208.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_035264040.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_019171197.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_035217394.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_006697448.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_025560161.1|  MULTISPECIES: pseudouridine synthase             75.9    1e-12    
ref|WP_010126646.1|  pseudouridine synthase                           75.9    1e-12    
ref|WP_006315328.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_029724567.1|  pseudouridine synthase                           75.9    1e-12    
ref|WP_039758181.1|  pseudouridine synthase                           75.5    1e-12    
ref|WP_022556167.1|  MULTISPECIES: Pseudouridine synthase             75.5    1e-12    
ref|WP_022682860.1|  pseudouridine synthase                           76.3    1e-12    
ref|WP_004441802.1|  MULTISPECIES: pseudouridine synthase             75.5    1e-12    
ref|WP_003512960.1|  MULTISPECIES: pseudouridine synthase             75.5    1e-12    
ref|WP_006609091.1|  pseudouridine synthase                           76.3    1e-12    
ref|WP_042087869.1|  pseudouridine synthase                           75.5    1e-12    
dbj|GAM05754.1|  ribosomal large subunit pseudouridine synthase C     76.3    1e-12    
gb|ETE66758.1|  RNA pseudouridylate synthase domain-containing pr...  75.1    1e-12    
gb|KFL45041.1|  ribosomal large subunit pseudouridine synthase C      75.5    1e-12    
ref|WP_003496085.1|  pseudouridine synthase                           75.1    2e-12    
gb|KFV13864.1|  RNA pseudouridylate synthase domain-containing pr...  74.3    2e-12    
ref|WP_024505072.1|  pseudouridine synthase                           75.1    2e-12    
ref|XP_009980434.1|  PREDICTED: RNA pseudouridylate synthase doma...  74.3    2e-12    
ref|WP_007091474.1|  pseudouridine synthase                           75.5    2e-12    
ref|WP_003502691.1|  pseudouridine synthase                           75.1    2e-12    
ref|WP_040577463.1|  membrane protein                                 75.1    2e-12    
ref|WP_036480346.1|  pseudouridine synthase                           75.1    2e-12    
ref|WP_007826135.1|  MULTISPECIES: pseudouridine synthase             75.1    2e-12    
ref|WP_037462014.1|  pseudouridine synthase                           73.6    2e-12    
ref|WP_008832569.1|  pseudouridine synthase                           75.9    2e-12    
ref|WP_036523670.1|  pseudouridine synthase                           75.9    2e-12    



>ref|XP_009620200.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009620208.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009620216.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009620223.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
tomentosiformis]
Length=478

 Score =   408 bits (1048),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 217/238 (91%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            TEESIS LHL+ S+ K+ K  S+AW+D+C  TY+RYWALVIGSPKEKEG+I APL+KV+L
Sbjct  243  TEESISHLHLLFSNAKRSKSLSKAWNDACGSTYQRYWALVIGSPKEKEGIISAPLTKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+G+TERV+LAQ+S LEAS++A+TEYR+LGPMINGCSWIELRPH SRKHQLRVHCAEALG
Sbjct  303  DDGRTERVMLAQHSGLEASEEAITEYRLLGPMINGCSWIELRPHTSRKHQLRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVD+EPTTG+PYR++RPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  363  TPIVGDYKYGWFVHRKWKQMPRVDVEPTTGKPYRLKRPEGLDVQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF+ELHS   R+R  N  +D  SKPDLLRFVAPMPSHMKISW LMSSYLI
Sbjct  423  ELVLPNIAKFIELHSRKTRTRCLN--ADNSSKPDLLRFVAPMPSHMKISWKLMSSYLI  478



>ref|XP_009804022.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
sylvestris]
 ref|XP_009804023.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
sylvestris]
 ref|XP_009804024.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nicotiana 
sylvestris]
Length=478

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 216/238 (91%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            TEESIS LHL+ S  K+ K  S+AW+D+C  TY+RYWALVIGSPKEKEG+I APL+KV+L
Sbjct  243  TEESISHLHLLFSSTKRSKSLSKAWNDACGSTYQRYWALVIGSPKEKEGIISAPLTKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+G+TERV+LAQ+S LEAS++A+TEYR+LGPMINGCSWIELRPH SRKHQLRVHCAEALG
Sbjct  303  DDGRTERVMLAQHSGLEASEEAITEYRLLGPMINGCSWIELRPHTSRKHQLRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVD+EPTTG+PYR++RPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  363  TPIVGDYKYGWFVHRKWKQMPRVDVEPTTGKPYRLKRPEGLDVQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF+ELHS   R+R  N  +D  SKPDLLRFVAPMPSHMKISW LMSSYLI
Sbjct  423  ELVLPNIAKFIELHSRKTRTRCLN--ADNSSKPDLLRFVAPMPSHMKISWKLMSSYLI  478



>emb|CDO98596.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   396 bits (1018),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 210/238 (88%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS LHL+ SD+ K K  S+ W D+C+ TY+RYWALVIGSPKEKEGLI AP++KV+L
Sbjct  230  TKESISYLHLLFSDINKAKSLSKGWGDACESTYQRYWALVIGSPKEKEGLIHAPITKVML  289

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVI+A  S LEA Q+A+TEYRVLGPMINGCSWIELRPH SRKHQLRVHC+EALG
Sbjct  290  DDGKTERVIVANRSGLEAFQEAITEYRVLGPMINGCSWIELRPHTSRKHQLRVHCSEALG  349

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH KWKQMPRVD EP +GEPYR+RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  350  TPIVGDYKYGWFVHHKWKQMPRVDFEPNSGEPYRLRRPEGLDVQKGSVLSKVPLLHLHCR  409

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNI KFLE+H  +++  NY+ K    SKPD+LRFVAPMPSHMKISWNLMSSYLI
Sbjct  410  EMVLPNIEKFLEIH--TSKGSNYSSKLKYSSKPDVLRFVAPMPSHMKISWNLMSSYLI  465



>ref|XP_006353749.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006353750.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006353751.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X3 [Solanum tuberosum]
Length=475

 Score =   393 bits (1009),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 210/238 (88%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            TEESIS LHL+ S+ KK K  S+AW+D+C  TY+RYWALVIGSPKEKEG+I APL+KV+L
Sbjct  243  TEESISHLHLLFSNTKKSKSLSKAWNDACGSTYQRYWALVIGSPKEKEGVISAPLTKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+G+TERV+LAQ S LEAS +AVTEYR+LGPMINGCSWIELRPH SRKHQ+RVHCAEALG
Sbjct  303  DDGRTERVMLAQQSGLEASDEAVTEYRLLGPMINGCSWIELRPHTSRKHQIRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVD+EPTTG+PYR++RPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  363  TPIVGDYKYGWFVHRKWKQMPRVDVEPTTGKPYRLKRPEGLDVQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF+ELH     SR     SD  SKPDLLRFVAPMPS MKISW LMSS LI
Sbjct  423  ELVLPNIAKFIELH-----SRKTKKHSDYSSKPDLLRFVAPMPSPMKISWKLMSSCLI  475



>ref|XP_010323966.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X2 [Solanum lycopersicum]
Length=459

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 208/238 (87%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            TEESIS LHL+ S+ K+ K  S+AW+D+C  TY+RYWALVIGSPK KEG+I APL+KV+L
Sbjct  227  TEESISHLHLLFSNTKRSKSLSKAWNDACGSTYQRYWALVIGSPKVKEGVISAPLTKVLL  286

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+G+TERV+LAQ S LEAS +AVTEYR+LGPMINGCSWIELRPH SRKHQLRVHCAEALG
Sbjct  287  DDGRTERVMLAQQSGLEASDEAVTEYRLLGPMINGCSWIELRPHTSRKHQLRVHCAEALG  346

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVD+EP TG+PYR++RPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  347  TPIVGDYKYGWFVHRKWKQMPRVDVEPITGKPYRLKRPEGLDVQKGSVLSKVPLLHLHCR  406

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF+ELHS   R       +D  SKPDLLRFVAPMPS MKISW LMSS LI
Sbjct  407  ELVLPNIAKFIELHSRKTRK-----NTDYSSKPDLLRFVAPMPSPMKISWKLMSSCLI  459



>ref|XP_004243668.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323964.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323965.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X1 [Solanum lycopersicum]
Length=475

 Score =   387 bits (995),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 208/238 (87%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            TEESIS LHL+ S+ K+ K  S+AW+D+C  TY+RYWALVIGSPK KEG+I APL+KV+L
Sbjct  243  TEESISHLHLLFSNTKRSKSLSKAWNDACGSTYQRYWALVIGSPKVKEGVISAPLTKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+G+TERV+LAQ S LEAS +AVTEYR+LGPMINGCSWIELRPH SRKHQLRVHCAEALG
Sbjct  303  DDGRTERVMLAQQSGLEASDEAVTEYRLLGPMINGCSWIELRPHTSRKHQLRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVD+EP TG+PYR++RPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  363  TPIVGDYKYGWFVHRKWKQMPRVDVEPITGKPYRLKRPEGLDVQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF+ELHS   R       +D  SKPDLLRFVAPMPS MKISW LMSS LI
Sbjct  423  ELVLPNIAKFIELHSRKTRK-----NTDYSSKPDLLRFVAPMPSPMKISWKLMSSCLI  475



>ref|XP_010417504.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=369

 Score =   379 bits (972),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  135  TKESIDHLHSVFSDYKGRNLSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  194

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  195  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  254

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  255  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  314

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  315  EMVLPNIAKFLHV---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  369



>ref|XP_010472724.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=370

 Score =   378 bits (971),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  136  TKESIDHLHSVFSDYKGRNSSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  195

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGC+W+ELRP  SRKHQLRVHCAEALG
Sbjct  196  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCTWLELRPITSRKHQLRVHCAEALG  255

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  256  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  315

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E++LPNIAKFL L    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  316  EMILPNIAKFLHL---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  370



>ref|XP_010429752.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X2 [Camelina sativa]
Length=369

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  135  TKESIDHLHSVFSDYKGRNSSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  194

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  195  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  254

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  255  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  314

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  315  EMVLPNIAKFLHV---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  369



>ref|XP_006436405.1| hypothetical protein CICLE_v10031422mg [Citrus clementina]
 gb|ESR49645.1| hypothetical protein CICLE_v10031422mg [Citrus clementina]
Length=343

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 1/238 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+SLL  + SD+ K K  S+AW+D+C+  Y+RYWALVIGSPKEK+G+I APLSKV+L
Sbjct  107  TKESVSLLTWLFSDVNKSKSLSKAWNDACEAMYQRYWALVIGSPKEKQGIIHAPLSKVLL  166

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTER+ILAQNS LEASQ+AVTEYRVLGPMINGCSWIELRP   RKHQLRVHCAEALG
Sbjct  167  DDGKTERIILAQNSGLEASQEAVTEYRVLGPMINGCSWIELRPLTCRKHQLRVHCAEALG  226

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEPT+G+PY++RRP+GLDVQKGSVLSKVPLLHLHCR
Sbjct  227  TPIVGDYKYGWFVHRRWKQMPRVDIEPTSGKPYKLRRPDGLDVQKGSVLSKVPLLHLHCR  286

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF  +  N      +   S     PDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  287  ELVLPNIAKFRNV-LNQKSDNLFPTLSSKPDGPDLLRFVASMPSHMKISWNLMSSYLV  343



>dbj|BAD43982.1| unnamed protein product [Arabidopsis thaliana]
Length=326

 Score =   375 bits (964),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 203/238 (85%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ +C+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  92   TKESIDYLHSVFSDYKGRNSSCKAWNKACEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  151

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQDA+TEY+VLGP INGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  152  DDGKTDRVVLAQGSGFEASQDAITEYKVLGPKINGCSWVELRPITSRKHQLRVHCAEALG  211

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  212  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  271

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     + +  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  272  EMVLPNIAKFLHV---MNQQETEPLHTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  326



>ref|XP_010417502.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=478

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  244  TKESIDHLHSVFSDYKGRNLSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  304  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  364  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  423

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  424  EMVLPNIAKFLHV---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  478



>ref|XP_007023655.1| Pseudouridine synthase family protein [Theobroma cacao]
 gb|EOY26277.1| Pseudouridine synthase family protein [Theobroma cacao]
Length=471

 Score =   379 bits (972),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 206/238 (87%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES++ LH + +DL   K   +AW+D+C V Y+R+WALVIG+PKEKEGLICAPLSK++L
Sbjct  238  TKESVAHLHWLFNDLNTVKSSCKAWNDACDVKYQRFWALVIGTPKEKEGLICAPLSKILL  297

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILAQN  LEASQ+A+TEYRVLGPMINGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  298  DDGKTERVILAQNVGLEASQEAITEYRVLGPMINGCSWIELRPLTSRKHQLRVHCAEALG  357

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  358  TPIVGDYKYGWFVHRRWKQMPRVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  417

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL + + +  +    +      KPDLLRFVA MP HMKISWNLMSSYL+
Sbjct  418  ELVLPNIAKFLPVLNKNTET----LPPALSMKPDLLRFVATMPKHMKISWNLMSSYLV  471



>ref|XP_010429751.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X1 [Camelina sativa]
Length=478

 Score =   378 bits (971),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  244  TKESIDHLHSVFSDYKGRNSSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  304  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  364  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  423

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  424  EMVLPNIAKFLHV---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  478



>ref|XP_010472723.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=479

 Score =   378 bits (970),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  245  TKESIDHLHSVFSDYKGRNSSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  304

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGC+W+ELRP  SRKHQLRVHCAEALG
Sbjct  305  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCTWLELRPITSRKHQLRVHCAEALG  364

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  365  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  424

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E++LPNIAKFL L    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  425  EMILPNIAKFLHL---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  479



>gb|EYU34909.1| hypothetical protein MIMGU_mgv1a006040mg [Erythranthe guttata]
Length=460

 Score =   377 bits (967),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 201/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS LH + SD++K    S+ W D+C   Y+RYWALVIG P +KEG+ICAPL+KV+L
Sbjct  225  TKESISYLHWLFSDVRKAASFSKEWSDACDAMYQRYWALVIGVPNQKEGVICAPLTKVLL  284

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTE VIL+ NS LEASQ+A+T YRVLGPMINGCSWIEL P   RKHQLRVHCAEALG
Sbjct  285  NDGKTEMVILSHNSGLEASQEAITRYRVLGPMINGCSWIELHPLTRRKHQLRVHCAEALG  344

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH KWKQMPR+D EPTTGEPY+MRRPEGLDVQKGSVLSKVPLLHLH R
Sbjct  345  TPIVGDYKYGWFVHSKWKQMPRLDFEPTTGEPYKMRRPEGLDVQKGSVLSKVPLLHLHSR  404

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNI KF+ELH   + S NYNV  +  +KPD+LRFV PMP HMKISWNLMSSYL+
Sbjct  405  EMVLPNIEKFIELH--KHMSGNYNVDPELCAKPDILRFVVPMPKHMKISWNLMSSYLV  460



>ref|XP_006300371.1| hypothetical protein CARUB_v10022381mg [Capsella rubella]
 gb|EOA33269.1| hypothetical protein CARUB_v10022381mg [Capsella rubella]
Length=478

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 204/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
             +ESI  LH V SD K +    +AW+ SC+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  244  NKESIGYLHSVFSDYKGRNSSCKAWNKSCEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  304  DDGKTDRVVLAQGSCFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  364  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  423

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  424  EMVLPNIAKFLHV---LNQQEAEPIRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  478



>ref|XP_011074171.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Sesamum 
indicum]
Length=475

 Score =   377 bits (967),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 204/238 (86%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            + ESIS L  + +D +K +  S+ W+D+C+  Y+RYWALVIG PK+KEGLIC PL+KV+L
Sbjct  240  SRESISYLQWLFNDGRKAESLSEDWNDACEAMYQRYWALVIGLPKQKEGLICTPLTKVLL  299

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERV+LA NS LEA+Q+A+TEYRVLGP INGCSWIELRPH  RKHQLRVHCAEALG
Sbjct  300  NDGKTERVVLAHNSCLEAAQEAITEYRVLGPTINGCSWIELRPHTRRKHQLRVHCAEALG  359

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMPRVD EPTTGEPY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  360  TPIVGDYKYGWFVHKRWKQMPRVDFEPTTGEPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  419

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKF+ LH    +   Y V  +   KPD+LRFVAPMPSHMKISWNLMSSYL+
Sbjct  420  EMVLPNIAKFIVLH--KQQLGGYRVNPEHDLKPDVLRFVAPMPSHMKISWNLMSSYLV  475



>ref|XP_002267010.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Vitis 
vinifera]
Length=479

 Score =   376 bits (965),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 206/238 (87%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES++ LH + SD+ K K  S+AWDD+C+ T +RYWALVIGSPK+KEG+I APLSKV+L
Sbjct  244  TKESVAHLHWLFSDINKAKSLSKAWDDACEATCQRYWALVIGSPKQKEGVIHAPLSKVLL  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA  S LEASQ+A+TEYRVLGPMINGCSWIEL P  SRKHQLRVHCAEALG
Sbjct  304  DDGKTERVILANQSGLEASQEAITEYRVLGPMINGCSWIELCPRTSRKHQLRVHCAEALG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD+EPTTG+PY+MRRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  364  TPIVGDYKYGWFVHRRWKQMPRVDLEPTTGKPYKMRRPEGLDVQKGSVLSKVPLLHLHCR  423

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            EL+LPNIAKFL +     + +N N       KPD+LRFVA MP+HMKISWNLMSSYL+
Sbjct  424  ELILPNIAKFLPIL--DPKPKNQNQYPKLSLKPDILRFVASMPNHMKISWNLMSSYLV  479



>ref|XP_006436406.1| hypothetical protein CICLE_v10031422mg [Citrus clementina]
 gb|ESR49646.1| hypothetical protein CICLE_v10031422mg [Citrus clementina]
Length=471

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 1/238 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+SLL  + SD+ K K  S+AW+D+C+  Y+RYWALVIGSPKEK+G+I APLSKV+L
Sbjct  235  TKESVSLLTWLFSDVNKSKSLSKAWNDACEAMYQRYWALVIGSPKEKQGIIHAPLSKVLL  294

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTER+ILAQNS LEASQ+AVTEYRVLGPMINGCSWIELRP   RKHQLRVHCAEALG
Sbjct  295  DDGKTERIILAQNSGLEASQEAVTEYRVLGPMINGCSWIELRPLTCRKHQLRVHCAEALG  354

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEPT+G+PY++RRP+GLDVQKGSVLSKVPLLHLHCR
Sbjct  355  TPIVGDYKYGWFVHRRWKQMPRVDIEPTSGKPYKLRRPDGLDVQKGSVLSKVPLLHLHCR  414

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF  +  N      +   S     PDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  415  ELVLPNIAKFRNV-LNQKSDNLFPTLSSKPDGPDLLRFVASMPSHMKISWNLMSSYLV  471



>ref|XP_006468112.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Citrus 
sinensis]
Length=471

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 206/238 (87%), Gaps = 1/238 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+SLL  + SD+ K K  S+AW+D+C+  Y+RYWALVIGSP+EK+G+I APLSKV+L
Sbjct  235  TKESVSLLTWLFSDVNKSKSLSKAWNDACEAMYQRYWALVIGSPREKQGIIRAPLSKVLL  294

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTER+ILAQNS LEASQ+A+TEYRVLGPMINGCSWIELRP   RKHQLRVHCAEALG
Sbjct  295  DDGKTERIILAQNSGLEASQEAMTEYRVLGPMINGCSWIELRPLTCRKHQLRVHCAEALG  354

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEPT+G+PY++RRP+GLDVQKGSVLSKVPLLHLHCR
Sbjct  355  TPIVGDYKYGWFVHRRWKQMPRVDIEPTSGKPYKLRRPDGLDVQKGSVLSKVPLLHLHCR  414

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF+ +  N      +   S     PDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  415  ELVLPNIAKFINV-LNQKSDNLFPTLSSKPDGPDLLRFVASMPSHMKISWNLMSSYLV  471



>emb|CBI18448.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   375 bits (964),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 206/238 (87%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES++ LH + SD+ K K  S+AWDD+C+ T +RYWALVIGSPK+KEG+I APLSKV+L
Sbjct  246  TKESVAHLHWLFSDINKAKSLSKAWDDACEATCQRYWALVIGSPKQKEGVIHAPLSKVLL  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA  S LEASQ+A+TEYRVLGPMINGCSWIEL P  SRKHQLRVHCAEALG
Sbjct  306  DDGKTERVILANQSGLEASQEAITEYRVLGPMINGCSWIELCPRTSRKHQLRVHCAEALG  365

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD+EPTTG+PY+MRRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  366  TPIVGDYKYGWFVHRRWKQMPRVDLEPTTGKPYKMRRPEGLDVQKGSVLSKVPLLHLHCR  425

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            EL+LPNIAKFL +     + +N N       KPD+LRFVA MP+HMKISWNLMSSYL+
Sbjct  426  ELILPNIAKFLPIL--DPKPKNQNQYPKLSLKPDILRFVASMPNHMKISWNLMSSYLV  481



>ref|NP_178012.2| RNA pseudourine synthase 3 [Arabidopsis thaliana]
 sp|Q5XET6.1|PUS3_ARATH RecName: Full=RNA pseudouridine synthase 3, mitochondrial; AltName: 
Full=RNA pseudouridylate synthase 3; AltName: Full=RNA-uridine 
isomerase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU95416.1| At1g78910 [Arabidopsis thaliana]
 gb|AAW30031.1| At1g78910 [Arabidopsis thaliana]
 gb|AEE36173.1| RNA pseudourine synthase 3 [Arabidopsis thaliana]
Length=478

 Score =   375 bits (963),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 203/238 (85%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ +C+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  244  TKESIDYLHSVFSDYKGRNSSCKAWNKACEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQDA+TEY+VLGP INGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  304  DDGKTDRVVLAQGSGFEASQDAITEYKVLGPKINGCSWVELRPITSRKHQLRVHCAEALG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  364  TPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  423

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     + +  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  424  EMVLPNIAKFLHV---MNQQETEPLHTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  478



>ref|XP_007209989.1| hypothetical protein PRUPE_ppa005240mg [Prunus persica]
 gb|EMJ11188.1| hypothetical protein PRUPE_ppa005240mg [Prunus persica]
Length=471

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+SLL  + +D  K K   QAWDD+C+  Y+RYWALVIGSPKEKEGLICAPLSKV+L
Sbjct  238  TKESVSLLQWLYTDFNKGKSSCQAWDDACEARYQRYWALVIGSPKEKEGLICAPLSKVLL  297

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGKTERVILA  S LEASQ A+T+YRVLGP INGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  298  DNGKTERVILAHQSGLEASQKAITQYRVLGPTINGCSWIELRPLTSRKHQLRVHCAEALG  357

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMP VD+EPT+G PY++RRP GLDVQKGSVLSKVPLLHLHCR
Sbjct  358  TPIVGDYKYGWFVHRRWKQMPHVDVEPTSGLPYKLRRPAGLDVQKGSVLSKVPLLHLHCR  417

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +      S +  V     SKPD+LRFVA MPSHMKISWNLMSSYL+
Sbjct  418  ELVLPNIAKFLLILDQKLDSLHPAVS----SKPDILRFVASMPSHMKISWNLMSSYLV  471



>ref|XP_010539606.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Tarenaya 
hassleriana]
Length=483

 Score =   374 bits (961),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/238 (75%), Positives = 204/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++SI  LH + SDLK  K   + W+D+C+  Y++YWALVIGSPKEKEG+I APLSKVVL
Sbjct  249  TQQSIDTLHWLFSDLKGSKSSYKEWNDACEAMYQKYWALVIGSPKEKEGIISAPLSKVVL  308

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTER++LAQ S LEAS +A+TEYRVLGPMINGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  309  DDGKTERIVLAQCSGLEASHEALTEYRVLGPMINGCSWIELRPITSRKHQLRVHCAEALG  368

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMPRVDIEPT+G+PY+MRRP GLDVQKGSVLSKVPLLHLHCR
Sbjct  369  TPIVGDYKYGWFVHKRWKQMPRVDIEPTSGKPYKMRRPSGLDVQKGSVLSKVPLLHLHCR  428

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNI KFL +    NR  +  + S   SKPDLLRFVA MP+HMKISWNLMSSYL+
Sbjct  429  EMVIPNIDKFLHVW---NRQGSETLPSGINSKPDLLRFVASMPNHMKISWNLMSSYLV  483



>ref|XP_008239134.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Prunus 
mume]
Length=471

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+SLL  + +D  K K   QAWDD+C+  Y+RYWALVIGSPKEKEGLICAPLSKV+L
Sbjct  238  TKESVSLLQWLYTDFNKGKSSCQAWDDACEARYQRYWALVIGSPKEKEGLICAPLSKVLL  297

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGKTERVILA  S LEASQ A+T+YRVLGP I+GCSWIELRP  SRKHQLRVHCAEALG
Sbjct  298  DNGKTERVILAHQSGLEASQKAITQYRVLGPTIHGCSWIELRPLTSRKHQLRVHCAEALG  357

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMP VDIEPT+G PY++RRP GLDVQKGSVLSKVPLLHLHCR
Sbjct  358  TPIVGDYKYGWFVHRRWKQMPHVDIEPTSGLPYKLRRPAGLDVQKGSVLSKVPLLHLHCR  417

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +       +  N+     SKPD+LRFVA MPSHMKISWNLMSSYL+
Sbjct  418  ELVLPNIAKFLLILDQ----KLDNLHPAVCSKPDILRFVASMPSHMKISWNLMSSYLV  471



>gb|EYU23584.1| hypothetical protein MIMGU_mgv1a026780mg, partial [Erythranthe 
guttata]
Length=452

 Score =   372 bits (955),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 200/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS LH + SD++K    S+ W D+C   Y+RYWALVIG P +KEG+I APL+KV+L
Sbjct  217  TKESISYLHWLFSDVRKAASFSKEWSDACDAMYQRYWALVIGVPNQKEGVIFAPLTKVLL  276

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTE VIL+ NS LEASQ+A+T YRVLGPMINGCSWIEL P   RKHQLRVHCAEALG
Sbjct  277  NDGKTEMVILSHNSGLEASQEAITRYRVLGPMINGCSWIELHPLTRRKHQLRVHCAEALG  336

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH KWKQMPR++ EPTTGEPY+MRRPEGLDVQKGSVLSKVPLLHLH R
Sbjct  337  TPIVGDYKYGWFVHSKWKQMPRLNFEPTTGEPYKMRRPEGLDVQKGSVLSKVPLLHLHSR  396

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNI KF+ELH    +  NYNV  +  +KPD+LRFVAPMP HMKISWNLMSSYL+
Sbjct  397  EMVLPNIEKFIELH--KQKPGNYNVDPELCAKPDILRFVAPMPKHMKISWNLMSSYLV  452



>ref|XP_002887761.1| hypothetical protein ARALYDRAFT_477057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64020.1| hypothetical protein ARALYDRAFT_477057 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   373 bits (957),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 204/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            ++ESI  LH V SD K +    +AW+ +C+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  243  SKESIHYLHSVFSDYKGRNSSCKAWNKACEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  303  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            T IVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  363  TSIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     +++  + KPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  423  EMVLPNIAKFLHV---LNQQETEPLRTGIIDKPDLLRFVASMPSHMKISWNLMSSYLV  477



>gb|KHG09609.1| hypothetical protein F383_12972 [Gossypium arboreum]
Length=468

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 202/238 (85%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS LH + +D+   K   +AW+D+C   ++R+WALVIG+PKE EGLI +PLSK++L
Sbjct  235  TKESISHLHWLFNDINPAKSSCKAWNDACDAKFQRFWALVIGTPKENEGLIRSPLSKILL  294

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILAQN  LE SQ+AVTEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  295  DDGKTERVILAQNVGLEPSQEAVTEYRVLGPMINGCSWVELRPLTSRKHQLRVHCAEALG  354

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVDIEP TG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  355  TPIVGDYKYGWFVHRKWKQMPRVDIEPRTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  414

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL L SN+  +    +      KPDLLRFVA MP HMKISWNLMSSYL+
Sbjct  415  ELVLPNIAKFLPLLSNNAET----LSPGLSGKPDLLRFVASMPKHMKISWNLMSSYLV  468



>gb|KJB56429.1| hypothetical protein B456_009G119600 [Gossypium raimondii]
Length=352

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ LH + +D+   K   +AW+D+C   ++RYWALVIG+PKE EGLI +PLSK++L
Sbjct  119  TKESINHLHWLFNDINPAKSSCKAWNDACDAKFQRYWALVIGTPKENEGLIRSPLSKILL  178

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILAQN  LE SQ+AVTEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  179  DDGKTERVILAQNVGLEPSQEAVTEYRVLGPMINGCSWVELRPLTSRKHQLRVHCAEALG  238

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVDIE  TG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  239  TPIVGDYKYGWFVHRKWKQMPRVDIEQRTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  298

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL L SN+  +    +      KPDLLRFVA MP HMKISWNLMSSYL+
Sbjct  299  ELVLPNIAKFLPLLSNNAET----LSPGLSGKPDLLRFVASMPKHMKISWNLMSSYLV  352



>ref|XP_006389943.1| hypothetical protein EUTSA_v10018480mg [Eutrema salsugineum]
 gb|ESQ27229.1| hypothetical protein EUTSA_v10018480mg [Eutrema salsugineum]
Length=478

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 206/238 (87%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +  + +AW+ +C+  Y++YWALVIGSPK+KEG+I AP+SKV+L
Sbjct  244  TKESIDHLHSVFSDFKGRDSRCKAWNKACEAMYQQYWALVIGSPKDKEGVISAPISKVLL  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LA+ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  304  DDGKTDRVVLARGSGFEASQEAITEYRVLGPMINGCSWLELRPLTSRKHQLRVHCAEALG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHKKWKQMP+VDIEPT+G+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  364  TPIVGDYKYGWFVHKKWKQMPQVDIEPTSGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  423

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL + +N       ++    +SKPDLLRFVA MPSHMKISWN+MSSYL+
Sbjct  424  EMVLPNIAKFLHVLNNQEID---SLHPGIISKPDLLRFVASMPSHMKISWNIMSSYLV  478



>gb|KJB56427.1| hypothetical protein B456_009G119600 [Gossypium raimondii]
Length=340

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ LH + +D+   K   +AW+D+C   ++RYWALVIG+PKE EGLI +PLSK++L
Sbjct  107  TKESINHLHWLFNDINPAKSSCKAWNDACDAKFQRYWALVIGTPKENEGLIRSPLSKILL  166

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILAQN  LE SQ+AVTEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  167  DDGKTERVILAQNVGLEPSQEAVTEYRVLGPMINGCSWVELRPLTSRKHQLRVHCAEALG  226

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVDIE  TG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  227  TPIVGDYKYGWFVHRKWKQMPRVDIEQRTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  286

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL L SN+  +    +      KPDLLRFVA MP HMKISWNLMSSYL+
Sbjct  287  ELVLPNIAKFLPLLSNNAET----LSPGLSGKPDLLRFVASMPKHMKISWNLMSSYLV  340



>emb|CDX88490.1| BnaC06g39340D [Brassica napus]
Length=473

 Score =   370 bits (951),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 204/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +  + +AW+ +C+  Y+RYWALVIGSPK++EG+I APLSKV+L
Sbjct  239  TKESIDHLHSVFSDFKGRNSRCKAWNKACEAMYQRYWALVIGSPKDREGVISAPLSKVLL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  299  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPVTSRKHQLRVHCAEALG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWF+HK+WKQMP+VDIEPTTG+ Y++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  359  TPIVGDYKYGWFIHKRWKQMPQVDIEPTTGKQYKLRRPEGLDVQKGSVLSKVPLLHLHCR  418

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL +    N+     ++    SKPDLLRFVA MPSHMKISWN+MSSYL+
Sbjct  419  EMVLPNIAKFLHV---LNQRETDPLRPGISSKPDLLRFVASMPSHMKISWNIMSSYLV  473



>gb|AAC83020.1| Contains similarity to gi|1786244 hypothetical 24.9 kD protein 
in surA-hepA intergenic region yab0 from Escherichia coli 
genome gb|AE000116, and to hypothetical YABO family PF|00849 
[Arabidopsis thaliana]
Length=491

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/244 (72%), Positives = 203/244 (83%), Gaps = 9/244 (4%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +    +AW+ +C+  Y++YWALVIGSPKEKEGLI APLSKV+L
Sbjct  251  TKESIDYLHSVFSDYKGRNSSCKAWNKACEAMYQQYWALVIGSPKEKEGLISAPLSKVLL  310

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQ------LRVH  392
            D+GKT+RV+LAQ S  EASQDA+TEY+VLGP INGCSW+ELRP  SRKHQ      LRVH
Sbjct  311  DDGKTDRVVLAQGSGFEASQDAITEYKVLGPKINGCSWVELRPITSRKHQPPSKKQLRVH  370

Query  391  CAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPL  212
            CAEALGTPIVGDYKYGWFVHK+WKQMP+VDIEPTTG+PY++RRPEGLDVQKGSVLSKVPL
Sbjct  371  CAEALGTPIVGDYKYGWFVHKRWKQMPQVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPL  430

Query  211  LHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            LHLHCRE+VLPNIAKFL +    N+     + +  + KPDLLRFVA MPSHMKISWNLMS
Sbjct  431  LHLHCREMVLPNIAKFLHV---MNQQETEPLHTGIIDKPDLLRFVASMPSHMKISWNLMS  487

Query  31   SYLI  20
            SYL+
Sbjct  488  SYLV  491



>gb|KJB56428.1| hypothetical protein B456_009G119600 [Gossypium raimondii]
Length=472

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ LH + +D+   K   +AW+D+C   ++RYWALVIG+PKE EGLI +PLSK++L
Sbjct  239  TKESINHLHWLFNDINPAKSSCKAWNDACDAKFQRYWALVIGTPKENEGLIRSPLSKILL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILAQN  LE SQ+AVTEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  299  DDGKTERVILAQNVGLEPSQEAVTEYRVLGPMINGCSWVELRPLTSRKHQLRVHCAEALG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQMPRVDIE  TG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  359  TPIVGDYKYGWFVHRKWKQMPRVDIEQRTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  418

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL L SN+  +    +      KPDLLRFVA MP HMKISWNLMSSYL+
Sbjct  419  ELVLPNIAKFLPLLSNNAET----LSPGLSGKPDLLRFVASMPKHMKISWNLMSSYLV  472



>ref|XP_010263262.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Nelumbo 
nucifera]
Length=474

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 207/238 (87%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ LH + SD+ K K   + W+D+C+ T +RYWALVIGSP+EK+G ICAPLSKV+L
Sbjct  242  TKESIARLHWLFSDVNKAKSPLKTWNDACETTTQRYWALVIGSPREKQGRICAPLSKVLL  301

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERVILA  S +EASQ+A+T++RVLGPMINGC+WIEL P   RKHQLRVHCAEALG
Sbjct  302  NDGKTERVILANPSGVEASQEAITDFRVLGPMINGCTWIELCPLTGRKHQLRVHCAEALG  361

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW+VHKKWKQMPRVDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  362  TPIVGDYKYGWYVHKKWKQMPRVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  421

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            EL+LPNIAKFL++     +S+N    S   S+PD+LRFVAPMPSHMKISWNLMSSYL+
Sbjct  422  ELILPNIAKFLDIL--DRKSQNLPKFS---SRPDVLRFVAPMPSHMKISWNLMSSYLV  474



>emb|CDX87423.1| BnaA07g34500D [Brassica napus]
Length=471

 Score =   367 bits (943),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 204/238 (86%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES   LH V SD K +  + +AW+ +C+  Y+RYWALVIGSPK+KEG++ APLSKV+L
Sbjct  237  TKESKDHLHSVFSDYKGRNSRCKAWNKACEAMYQRYWALVIGSPKDKEGIVSAPLSKVLL  296

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  297  DDGKTDRVVLAQGSGFEASQEAITEYRVLGPMINGCSWLELRPVTSRKHQLRVHCAEALG  356

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWF+HK+WKQMP+VDIEPTTG+ Y++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  357  TPIVGDYKYGWFIHKRWKQMPQVDIEPTTGKQYKLRRPEGLDVQKGSVLSKVPLLHLHCR  416

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKF  LH  S R  +  ++    SKPDLLRFVA MPSHMKISWN+MSSYL+
Sbjct  417  EMVLPNIAKF--LHVLSQREAD-PLRPGISSKPDLLRFVASMPSHMKISWNIMSSYLV  471



>ref|XP_011028390.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Populus 
euphratica]
Length=462

 Score =   367 bits (941),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 207/238 (87%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ L L+ S + K + + QAW+D+C+ TY+RYWALVIGSPK+KEGLI A LSKV+L
Sbjct  229  TKESIAHLQLLFSYINKAQSKCQAWNDACEATYQRYWALVIGSPKDKEGLISARLSKVLL  288

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LAQ+S LE S++AVTEYRVLGP INGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  289  DDGKTERVVLAQHSSLEPSREAVTEYRVLGPTINGCSWIELRPLTSRKHQLRVHCAEALG  348

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEP++G+PY++R PEG+D+QKGSVL+KVPLLHLHCR
Sbjct  349  TPIVGDYKYGWFVHRRWKQMPRVDIEPSSGKPYKLRWPEGVDIQKGSVLAKVPLLHLHCR  408

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL++       ++ NV     ++PDLLRFVA MPSHMKISWNLMSS+L+
Sbjct  409  ELVLPNIAKFLDVLDG----KSENVHPALSTRPDLLRFVASMPSHMKISWNLMSSFLV  462



>ref|XP_002526838.1| ribosomal pseudouridine synthase, putative [Ricinus communis]
 gb|EEF35573.1| ribosomal pseudouridine synthase, putative [Ricinus communis]
Length=468

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 204/238 (86%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  L  + SD+ K   + +AW+D+CK TY+RYWALVIGSPKEKEGLI APLSKV+L
Sbjct  235  TKESIDHLQWLFSDVNKSNSRCKAWNDACKATYQRYWALVIGSPKEKEGLIRAPLSKVLL  294

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERV+LAQ+S LEASQ+A+TEYRVLGP INGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  295  NDGKTERVVLAQHSGLEASQEALTEYRVLGPRINGCSWIELRPLTSRKHQLRVHCAEALG  354

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW VH++WKQMPRVDIEP +G+PY++RRP GLDVQKGSVLSKVPLLHLHCR
Sbjct  355  TPIVGDYKYGWCVHQRWKQMPRVDIEPFSGKPYKLRRPAGLDVQKGSVLSKVPLLHLHCR  414

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E VLPNIAKFL + +     ++ N+     +KPDLLRFVA MP+HMKISWNLMSSYL+
Sbjct  415  EFVLPNIAKFLAVLN----EKSENIHPALDAKPDLLRFVASMPTHMKISWNLMSSYLV  468



>ref|XP_006385075.1| hypothetical protein POPTR_0004s23670g [Populus trichocarpa]
 gb|ERP62872.1| hypothetical protein POPTR_0004s23670g [Populus trichocarpa]
Length=462

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 206/238 (87%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ L L+ S + K + +  AW+D+C+ TY+RYWALVIGSPK+KEGLI A LSKV+L
Sbjct  229  TKESIAHLQLLFSYINKAQSKCHAWNDACEATYQRYWALVIGSPKDKEGLISARLSKVLL  288

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LAQ+S LE S+DAVTEYRVLGP INGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  289  DDGKTERVVLAQHSSLEPSRDAVTEYRVLGPTINGCSWIELRPLTSRKHQLRVHCAEALG  348

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEP++G+PY++R PEG+D+QKGSVL+KVPLLHLHCR
Sbjct  349  TPIVGDYKYGWFVHRRWKQMPRVDIEPSSGKPYKLRWPEGVDIQKGSVLAKVPLLHLHCR  408

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL++       ++ NV     ++PDLLRFVA MPSHMKISWNLMSS+L+
Sbjct  409  ELVLPNIAKFLDVLDG----KSENVHPALSTRPDLLRFVASMPSHMKISWNLMSSFLV  462



>ref|XP_010111123.1| RNA pseudourine synthase 3 [Morus notabilis]
 gb|EXC58952.1| RNA pseudourine synthase 3 [Morus notabilis]
Length=449

 Score =   363 bits (933),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 206/238 (87%), Gaps = 11/238 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS L  + S++K       AW+D+C+  Y++YWALVIGSPKEKEG+ICAPLSKV+L
Sbjct  223  TKESISHLEWLFSNIK-------AWNDACEAKYQKYWALVIGSPKEKEGIICAPLSKVLL  275

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERVILA  +  +ASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  276  NDGKTERVILAHQTGFQASQEAITEYRVLGPMINGCSWLELRPLTSRKHQLRVHCAEALG  335

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMP+V+IEPTTG+PY++RRPEGLDVQKGSV+SKVPLLHL CR
Sbjct  336  TPIVGDYKYGWFVHKRWKQMPQVNIEPTTGKPYKLRRPEGLDVQKGSVMSKVPLLHLQCR  395

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +    +++++  ++    SKPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  396  ELVLPNIAKFLRVFDRKSQNQDPALE----SKPDLLRFVARMPSHMKISWNLMSSYLV  449



>ref|XP_009106606.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Brassica 
rapa]
Length=471

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 203/238 (85%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +  + +AW+ +C+  Y+RYWALVIGSPK+KEG++ APLSKV+L
Sbjct  237  TKESIDHLHSVFSDFKGRNSRCKAWNKACEAMYQRYWALVIGSPKDKEGIVSAPLSKVLL  296

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LAQ S  + SQ+A+T+YRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  297  DDGKTDRVVLAQGSGFKTSQEAITKYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  356

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWF+HK+WKQMP+VDIEPTTG+ Y++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  357  TPIVGDYKYGWFIHKRWKQMPQVDIEPTTGKQYKLRRPEGLDIQKGSVLSKVPLLHLHCR  416

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKF  LH  S R  +  +     SKPDLLRFVA MPSHMKISWN+MSSYL+
Sbjct  417  EMVLPNIAKF--LHVLSQREAD-PLHPGISSKPDLLRFVASMPSHMKISWNIMSSYLV  471



>ref|XP_010696109.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=340

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES S L  +  ++   K    AW+D+C+ T+ RYWALV+G P+EKEG+ICAPL+KV+L
Sbjct  107  TKESASYLQQLFININVAKTSCLAWNDACEATFMRYWALVVGYPREKEGVICAPLTKVLL  166

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LA  S LEASQ+A+TEYRVLGPMINGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  167  DDGKTERVMLAHPSGLEASQEAMTEYRVLGPMINGCSWIELRPLTSRKHQLRVHCAEALG  226

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQ P+V IEPT+GEPY++RRP+GLDVQKGSVLSKVPLLHLHCR
Sbjct  227  TPIVGDYKYGWFVHRKWKQTPQVTIEPTSGEPYKLRRPDGLDVQKGSVLSKVPLLHLHCR  286

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +     RS  Y  K     KPD+LRFVA MPSHMKISWNLMSSYL+
Sbjct  287  ELVLPNIAKFLGVL--GQRSAGYYPKLS--EKPDVLRFVASMPSHMKISWNLMSSYLV  340



>ref|XP_010696108.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=366

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES S L  +  ++   K    AW+D+C+ T+ RYWALV+G P+EKEG+ICAPL+KV+L
Sbjct  133  TKESASYLQQLFININVAKTSCLAWNDACEATFMRYWALVVGYPREKEGVICAPLTKVLL  192

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LA  S LEASQ+A+TEYRVLGPMINGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  193  DDGKTERVMLAHPSGLEASQEAMTEYRVLGPMINGCSWIELRPLTSRKHQLRVHCAEALG  252

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+KWKQ P+V IEPT+GEPY++RRP+GLDVQKGSVLSKVPLLHLHCR
Sbjct  253  TPIVGDYKYGWFVHRKWKQTPQVTIEPTSGEPYKLRRPDGLDVQKGSVLSKVPLLHLHCR  312

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +     RS  Y  K     KPD+LRFVA MPSHMKISWNLMSSYL+
Sbjct  313  ELVLPNIAKFLGVL--GQRSAGYYPKLS--EKPDVLRFVASMPSHMKISWNLMSSYLV  366



>gb|KDP21299.1| hypothetical protein JCGZ_21770 [Jatropha curcas]
Length=462

 Score =   362 bits (929),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 203/238 (85%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+  L  + SD KK     + W+D+C+ T +RYWAL+IGSPKEKEGLI APLSKV+L
Sbjct  229  TKESVDHLQWMFSDQKKSNSYCKDWNDACQATCQRYWALIIGSPKEKEGLIRAPLSKVLL  288

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTER++LAQNS  EASQ+A+TEYRVLGP INGCSW+EL P  SRKHQLRVHCAEALG
Sbjct  289  NDGKTERIVLAQNSGFEASQEALTEYRVLGPTINGCSWVELCPLTSRKHQLRVHCAEALG  348

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWF+H++WKQMPRVDIEP +G+PY++RRPEG+DVQKGSVLSKVPLLHLHCR
Sbjct  349  TPIVGDYKYGWFMHRRWKQMPRVDIEPFSGKPYKLRRPEGIDVQKGSVLSKVPLLHLHCR  408

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL++ +  ++    N+     +KPDLLRFVA MP+HMKISWNLMSSYL+
Sbjct  409  ELVLPNIAKFLDVLNQKSK----NIHPALSAKPDLLRFVASMPTHMKISWNLMSSYLV  462



>ref|XP_010094671.1| RNA pseudourine synthase 3 [Morus notabilis]
 gb|EXC41018.1| RNA pseudourine synthase 3 [Morus notabilis]
Length=449

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 204/238 (86%), Gaps = 11/238 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS L  + S++K       AW+D+C+  Y++YWALVIGSPKEKEG+ICAPLSKV+L
Sbjct  223  TKESISHLEWLFSNIK-------AWNDACEAKYQKYWALVIGSPKEKEGIICAPLSKVLL  275

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERVILA  +  +ASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  276  NDGKTERVILAHQTGFQASQEAITEYRVLGPMINGCSWLELRPLTSRKHQLRVHCAEALG  335

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW VHK+WKQMP+V+IEPTTG+PY++RRPEGLDVQKGSV+SKVPLLHL CR
Sbjct  336  TPIVGDYKYGWLVHKRWKQMPQVNIEPTTGKPYKLRRPEGLDVQKGSVMSKVPLLHLQCR  395

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +    + +++  ++    SKPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  396  ELVLPNIAKFLRVFDRKSENQDPALE----SKPDLLRFVARMPSHMKISWNLMSSYLV  449



>ref|XP_009358613.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Pyrus 
x bretschneideri]
Length=470

 Score =   360 bits (923),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 198/238 (83%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T ES+SLL  + +D+ K K   +AW+D+C   Y+ YWALVIGSPKEKEGLICAPL+KVVL
Sbjct  237  TRESVSLLQWLYTDINKGKSPCKAWNDACDAKYQSYWALVIGSPKEKEGLICAPLTKVVL  296

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA  S  + SQ A+T+YRVLGP INGCSWIELRP  SRKHQLRVHCAEALG
Sbjct  297  DDGKTERVILAHQSGFQTSQQAITQYRVLGPTINGCSWIELRPLTSRKHQLRVHCAEALG  356

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGD+KYGWFVHK+WKQ+P+VDIEPT+G PY++RRP GLDVQKGSVLSKVPLLHLHCR
Sbjct  357  TPIVGDFKYGWFVHKRWKQIPQVDIEPTSGLPYKLRRPAGLDVQKGSVLSKVPLLHLHCR  416

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL L       ++  V    VSKPDLLRF A MPSHMKISWNLMSSYL+
Sbjct  417  ELVLPNIAKFLLLLDQKLDDQHPAV----VSKPDLLRFCASMPSHMKISWNLMSSYLV  470



>ref|XP_006601251.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X2 [Glycine max]
Length=449

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 202/238 (85%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++S+S L  + S++   K   + W+++C+ TY+RYWALVIG+PKEKEG+I APLSKV+L
Sbjct  216  TKDSVSHLQWLFSNINNAKSSCKDWNEACEATYQRYWALVIGTPKEKEGIIHAPLSKVLL  275

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTER+ILA +S +E  Q+AVTEYRVLGP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  276  NDGKTERIILAHHSSVEPRQEAVTEYRVLGPQINGCSWVELRPLTYRKHQLRVHCAEALG  335

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH +WKQMPRVDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  336  TPIVGDYKYGWFVHSRWKQMPRVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  395

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNI KF+ + +NS+      +++    +PD+LRFVA MPSHM+ISWNLMSSYL+
Sbjct  396  ELVLPNIVKFMHVLNNSSE----ELRTSLREQPDVLRFVATMPSHMRISWNLMSSYLV  449



>ref|XP_004300876.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=469

 Score =   357 bits (915),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+ LL  + +D+   K   +AW+D+C+   +RYWALVIGSPKEKEGLICAPL+KV+L
Sbjct  236  TKESLYLLQSLYTDINVGKSSCRAWNDACRAKCQRYWALVIGSPKEKEGLICAPLTKVLL  295

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA  S LEASQ A+T+YRVLGP INGCSWIEL+P  SRKHQLRVHCAEALG
Sbjct  296  DDGKTERVILAHQSGLEASQPALTQYRVLGPTINGCSWIELQPLTSRKHQLRVHCAEALG  355

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMP +DIEP TG  Y++RRP GLDVQKGSV+SKVPLLHLHCR
Sbjct  356  TPIVGDYKYGWFVHRRWKQMPHIDIEPATGLQYKLRRPAGLDVQKGSVVSKVPLLHLHCR  415

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL L      +R Y V S   SKPD+LRFVA MP+HMKISWNLMSSYL+
Sbjct  416  ELVLPNIAKFLCLLDQKLDNR-YTVDS---SKPDVLRFVASMPTHMKISWNLMSSYLV  469



>ref|XP_007160970.1| hypothetical protein PHAVU_001G032500g [Phaseolus vulgaris]
 gb|ESW32964.1| hypothetical protein PHAVU_001G032500g [Phaseolus vulgaris]
Length=480

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 202/238 (85%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++S S L  + +++   K   +AW+D+C+ TY+RYWALVIG+PKEKEG+I APLSKV+L
Sbjct  247  TKDSASHLQWLFTNINNAKSSCKAWNDACEATYQRYWALVIGTPKEKEGIIHAPLSKVLL  306

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTER+ILA +S +E  Q+AVTE+RVLGP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  307  NDGKTERIILANHSSVEPRQEAVTEFRVLGPKINGCSWVELRPLTYRKHQLRVHCAEALG  366

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH +WKQMPR+DIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  367  TPIVGDYKYGWFVHSRWKQMPRIDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  426

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL + +NS+      + S    +P++LRFVA MPSHM+ISWNLMSSYL+
Sbjct  427  ELVLPNIAKFLHVLNNSSEE----LHSSLNQQPEVLRFVATMPSHMRISWNLMSSYLV  480



>ref|XP_006601250.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like isoform 
X1 [Glycine max]
Length=476

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 202/238 (85%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++S+S L  + S++   K   + W+++C+ TY+RYWALVIG+PKEKEG+I APLSKV+L
Sbjct  243  TKDSVSHLQWLFSNINNAKSSCKDWNEACEATYQRYWALVIGTPKEKEGIIHAPLSKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTER+ILA +S +E  Q+AVTEYRVLGP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  303  NDGKTERIILAHHSSVEPRQEAVTEYRVLGPQINGCSWVELRPLTYRKHQLRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH +WKQMPRVDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  363  TPIVGDYKYGWFVHSRWKQMPRVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNI KF+ + +NS+      +++    +PD+LRFVA MPSHM+ISWNLMSSYL+
Sbjct  423  ELVLPNIVKFMHVLNNSSE----ELRTSLREQPDVLRFVATMPSHMRISWNLMSSYLV  476



>ref|XP_008441208.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Cucumis 
melo]
Length=473

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 198/238 (83%), Gaps = 3/238 (1%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+  L  + S+++  KF  +AW+++C  TY++YWALVIG P+E+EGLI APLSKV+L
Sbjct  239  TKESVDHLQWLFSNIRNGKFTCKAWEEACNATYQKYWALVIGRPREREGLISAPLSKVLL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LA  + LEASQ+A+TEYRVLGP INGCSWIEL P  SRKHQLR+HCAEALG
Sbjct  299  DDGKTERVVLANKASLEASQEAITEYRVLGPTINGCSWIELCPRTSRKHQLRIHCAEALG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD+EP +G PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  359  TPIVGDYKYGWFVHRRWKQMPRVDVEPISGRPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  418

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +  +     +  V S      DLLRFVA MPSHM+ISWNLMSSYL+
Sbjct  419  ELVLPNIAKFLNVFYDKGPISHRPVSSFDF---DLLRFVARMPSHMRISWNLMSSYLV  473



>ref|XP_004515176.1| PREDICTED: RNA pseudourine synthase 3, mitochondrial-like isoform 
X1 [Cicer arietinum]
Length=479

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 201/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++S+S L  + S++   K   +AW+D+C+ TY+RYWALVIG+PKEKEG+I APLSKV+L
Sbjct  246  TKDSVSHLQWLFSNINNTKSSCKAWNDACESTYQRYWALVIGTPKEKEGIIHAPLSKVLL  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERVILA  S +E  Q+AVTEYRVLGP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  306  NDGKTERVILAHESSIEPHQEAVTEYRVLGPKINGCSWVELRPLTYRKHQLRVHCAEALG  365

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH +WKQMPRVDIEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  366  TPIVGDYKYGWFVHSRWKQMPRVDIEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  425

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            EL LPNIAKFL +   S++  + ++      +PD+LRFVA MP+HM+ISWNLMSSYL+
Sbjct  426  ELALPNIAKFLNVLEKSSQQLDPSLS----LQPDVLRFVATMPNHMRISWNLMSSYLV  479



>gb|KDO44461.1| hypothetical protein CISIN_1g042463mg, partial [Citrus sinensis]
Length=490

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 197/238 (83%), Gaps = 15/238 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+SLL  + SD+ K K  S+AW+D+C+  Y+RYWALVIGSPKEK+G+I APLSKV+L
Sbjct  268  TKESVSLLTWLFSDVNKSKSLSKAWNDACEAMYQRYWALVIGSPKEKQGIIHAPLSKVLL  327

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTER+ILAQNS LEASQ+A+TEYRVLGPMINGCSWIELRP   RKHQLRVHCAEALG
Sbjct  328  DDGKTERIILAQNSGLEASQEAMTEYRVLGPMINGCSWIELRPLTCRKHQLRVHCAEALG  387

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVDIEPT+G+PY++RRP+GLDVQKGSVLSKVPLLHLHCR
Sbjct  388  TPIVGDYKYGWFVHRRWKQMPRVDIEPTSGKPYKLRRPDGLDVQKGSVLSKVPLLHLHCR  447

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            EL   N+   L               S     PDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  448  ELKSDNLFPTL---------------SSKPDGPDLLRFVASMPSHMKISWNLMSSYLV  490



>ref|XP_004158518.1| PREDICTED: RNA pseudourine synthase 3, mitochondrial-like [Cucumis 
sativus]
Length=471

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 197/238 (83%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+  L  + S+++  KF  +AW+++C  TY++YWALVIG P+E+EG+I APLSKV+L
Sbjct  239  TKESVDHLQWLFSNIRNAKFTCKAWEEACNATYQKYWALVIGCPREREGVISAPLSKVLL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA  + +EASQ+A+TEYRVLGP INGCSWIEL P  SRKHQLR+HCAEALG
Sbjct  299  DDGKTERVILANKASIEASQEAITEYRVLGPTINGCSWIELCPRTSRKHQLRIHCAEALG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD+EP +G PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  359  TPIVGDYKYGWFVHRRWKQMPRVDVEPISGRPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  418

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +      +R  +         DLLRFVA MPSHM+ISWNLMSSYL+
Sbjct  419  ELVLPNIAKFLNVFYGKGPNRPVSSFDS-----DLLRFVARMPSHMRISWNLMSSYLV  471



>ref|XP_010063681.1| PREDICTED: LOW QUALITY PROTEIN: RNA pseudouridine synthase 3, 
mitochondrial [Eucalyptus grandis]
Length=480

 Score =   355 bits (910),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 195/238 (82%), Gaps = 12/238 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES++ L  + SD+KK     QAW+D+C+ T +RYWALVIGSPKEKEGLICAPLSKV+L
Sbjct  255  TKESVAHLQWLFSDMKKTDSSFQAWNDACRATNQRYWALVIGSPKEKEGLICAPLSKVLL  314

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA+NS LE          VLGP INGCSWIELRPH SRKHQ+RVHCAEALG
Sbjct  315  DDGKTERVILARNSGLEPX--------VLGPTINGCSWIELRPHTSRKHQVRVHCAEALG  366

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD EPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  367  TPIVGDYKYGWFVHQRWKQMPRVDFEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  426

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKF E     + +     +    SK  +LRFVAPMPSHMKISWNLMSSYL+
Sbjct  427  ELVLPNIAKFQEFLDQKSEA----PRPVLSSKSHMLRFVAPMPSHMKISWNLMSSYLV  480



>ref|XP_004138653.1| PREDICTED: RNA pseudourine synthase 3, mitochondrial-like [Cucumis 
sativus]
Length=471

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 197/238 (83%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+  L  + S+++  KF  +AW+++C  TY++YWALVIG P+E+EG+I APLSKV+L
Sbjct  239  TKESVDHLQWLFSNIRNAKFTCKAWEEACNATYQKYWALVIGCPREREGVISAPLSKVLL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LA  + +EASQ+A+TEYRVLGP INGCSWIEL P  SRKHQLR+HCAEALG
Sbjct  299  DDGKTERVVLANKASIEASQEAITEYRVLGPTINGCSWIELCPRTSRKHQLRIHCAEALG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD+EP +G PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  359  TPIVGDYKYGWFVHRRWKQMPRVDVEPISGRPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  418

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +      +R  +         DLLRFVA MPSHM+ISWNLMSSYL+
Sbjct  419  ELVLPNIAKFLNVFYGKGPNRPVSSFDS-----DLLRFVARMPSHMRISWNLMSSYLV  471



>gb|KDP41142.1| hypothetical protein JCGZ_03633 [Jatropha curcas]
Length=463

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/237 (69%), Positives = 200/237 (84%), Gaps = 4/237 (2%)
 Frame = -2

Query  730  EESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLD  551
            +ES+  L  + SD KK   + + W+D+C+   +R+WALVIGSP+EKEGLI APLSKV+L+
Sbjct  231  KESVDHLQWLFSDQKKPSSRFKDWNDACQAKCQRFWALVIGSPEEKEGLIRAPLSKVLLN  290

Query  550  NGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGT  371
            +GKTER++LAQNS  EASQ+A+T+YRVLGP INGCSW+EL P  SRKHQLRVHCAEALGT
Sbjct  291  DGKTERIVLAQNSGFEASQEALTQYRVLGPTINGCSWVELCPLTSRKHQLRVHCAEALGT  350

Query  370  PIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRE  191
            PIVGDYKYGWFVH++WKQM RVDIEP +G+PY++RRPEG+DVQKGSVLSKVPLLHLHCRE
Sbjct  351  PIVGDYKYGWFVHRRWKQMARVDIEPFSGKPYKLRRPEGIDVQKGSVLSKVPLLHLHCRE  410

Query  190  LVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
             VLPNIAKFL++ +     ++ N+     +KPDLLRFVA MP+HMKISWNLMSSYL+
Sbjct  411  FVLPNIAKFLDILNQ----KSENIHPALSAKPDLLRFVASMPTHMKISWNLMSSYLV  463



>gb|KGN63094.1| hypothetical protein Csa_2G402020 [Cucumis sativus]
Length=543

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 197/238 (83%), Gaps = 5/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES+  L  + S+++  KF  +AW+++C  TY++YWALVIG P+E+EG+I APLSKV+L
Sbjct  311  TKESVDHLQWLFSNIRNAKFTCKAWEEACNATYQKYWALVIGCPREREGVISAPLSKVLL  370

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERV+LA  + +EASQ+A+TEYRVLGP INGCSWIEL P  SRKHQLR+HCAEALG
Sbjct  371  DDGKTERVVLANKASIEASQEAITEYRVLGPTINGCSWIELCPRTSRKHQLRIHCAEALG  430

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD+EP +G PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  431  TPIVGDYKYGWFVHRRWKQMPRVDVEPISGRPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  490

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +      +R  +         DLLRFVA MPSHM+ISWNLMSSYL+
Sbjct  491  ELVLPNIAKFLNVFYGKGPNRPVSSFDS-----DLLRFVARMPSHMRISWNLMSSYLV  543



>gb|KHN37004.1| RNA pseudourine synthase 3, mitochondrial [Glycine soja]
Length=443

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 189/214 (88%), Gaps = 4/214 (2%)
 Frame = -2

Query  661  WDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVT  482
            W+++C+ TY+RYWALVIG+PKEKEG+I APLSKV+L++GKTER+ILA +S +E  Q+AVT
Sbjct  234  WNEACEATYQRYWALVIGTPKEKEGIIHAPLSKVLLNDGKTERIILAHHSSVEPRQEAVT  293

Query  481  EYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVD  302
            EYRVLGP INGCSW+ELRP   RKHQLRVHCAEALGTPIVGDYKYGWFVH +WKQMPRVD
Sbjct  294  EYRVLGPQINGCSWVELRPLTYRKHQLRVHCAEALGTPIVGDYKYGWFVHSRWKQMPRVD  353

Query  301  IEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYN  122
            IEPTTG+PY++RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNI KF+ + +NS+      
Sbjct  354  IEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIVKFMHVLNNSSE----E  409

Query  121  VKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            +++    +PD+LRFVA MPSHM+ISWNLMSSYL+
Sbjct  410  LRTSLREQPDVLRFVATMPSHMRISWNLMSSYLV  443



>ref|XP_009401551.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 197/238 (83%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES++ LH + +++   K  S+ W+++C+ T +RYWALVIGSPKE+EG+I APL+KV+L
Sbjct  248  TKESLTRLHWLFTNVNLAKSSSEIWNNACEATTQRYWALVIGSPKEREGIISAPLTKVLL  307

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            +NGK ER+ILA  S ++ SQDA+TEYRV+GP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  308  NNGKAERIILAHPSGIDGSQDAITEYRVMGPTINGCSWVELRPLTGRKHQLRVHCAEALG  367

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQMPRVD E  +G+PY++RRPEGLDVQKGSVLSKVPLLHLHCR
Sbjct  368  TPIVGDYKYGWFVHQRWKQMPRVDYETLSGKPYKLRRPEGLDVQKGSVLSKVPLLHLHCR  427

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNI+KFL     S+          + SKPDLLR VAPMPSHMKISWN+MSS+L+
Sbjct  428  EMVIPNISKFL----GSSGEWLVECNPGSTSKPDLLRIVAPMPSHMKISWNVMSSFLV  481



>ref|XP_010927194.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Elaeis 
guineensis]
Length=483

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 195/238 (82%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+E+ + LH + +++   K  SQ W+D+C+ T +RYWALVIG PKE+EGLI APLSKV+L
Sbjct  250  TKETFARLHWLFANINLAKSSSQIWNDACEATMQRYWALVIGCPKEREGLISAPLSKVLL  309

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKTERVILA  S ++ SQ+AVTEYRV+GP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  310  DDGKTERVILAHPSGIDGSQEAVTEYRVMGPTINGCSWVELRPLTGRKHQLRVHCAEALG  369

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWF+H++WKQMPRVD EP T  PY++RRPEGL+VQKGSVLSKVPLLHLHCR
Sbjct  370  TPIVGDYKYGWFMHQRWKQMPRVDYEPMTRSPYKLRRPEGLEVQKGSVLSKVPLLHLHCR  429

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+P+ AKFL     S+   +      T  KPDLLRFVAPMPSHMKISWN+MSSYL+
Sbjct  430  EMVIPHFAKFLR----SSGEWHDEGTPWTSDKPDLLRFVAPMPSHMKISWNVMSSYLV  483



>ref|NP_001167875.1| uncharacterized protein LOC100381582 [Zea mays]
 gb|ACN26374.1| unknown [Zea mays]
Length=237

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH +L+ +   +  SQ W+ +C+   ++YWALVIG+PKE+EG+I AP+SKV+L
Sbjct  4    TKESFTRLHWLLTSVNLARTSSQTWNKACEAYAQKYWALVIGTPKEREGVISAPISKVLL  63

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+A+TEYRV+GP INGCSWIEL+P   RKHQLRVHCAEALG
Sbjct  64   DDGKAERVILAHPSGIDGAQEAITEYRVMGPTINGCSWIELQPLTGRKHQLRVHCAEALG  123

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+ WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCR
Sbjct  124  TPIVGDYKYGWFVHQTWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCR  183

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL    +S    + N       KP+LLRFVAPMP HMKISWN+MSSYL+
Sbjct  184  EMVIPNIAKFL----SSTGGWHENGTPWAKEKPNLLRFVAPMPPHMKISWNIMSSYLV  237



>dbj|BAD09700.1| putative ribosomal large subunit pseudouridine synthase C protein 
[Oryza sativa Japonica Group]
 dbj|BAD10435.1| putative ribosomal large subunit pseudouridine synthase C protein 
[Oryza sativa Japonica Group]
Length=340

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 194/238 (82%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + + +   K  SQ W+ +C+   +RYWALVIG+PKE+EG+I APLSKV+L
Sbjct  107  TKESFTRLHWLFTSVNLAKTNSQVWNAACEAYMQRYWALVIGTPKEREGIISAPLSKVLL  166

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVT YRV+GP I+GCSWIELRP   RKHQLRVHCAEALG
Sbjct  167  DDGKAERVILAHPSGIDGAQEAVTAYRVMGPTIHGCSWIELRPLTGRKHQLRVHCAEALG  226

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCR
Sbjct  227  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCR  286

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL    +SN   + N    +  KP+LLRF+APMP+HMKISWN+MSSYL+
Sbjct  287  EMVIPNIAKFL----SSNGEWHENGAPWSKEKPNLLRFIAPMPAHMKISWNIMSSYLV  340



>gb|KEH22051.1| RNA pseudouridine synthase [Medicago truncatula]
Length=534

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 199/238 (84%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++S+S L  + S+    K   +AW+D+C+ T++RYWALVIG+PKEKEG+I APLSKV++
Sbjct  301  TKDSVSHLQWLFSNTNNAKSSCKAWNDACEATHQRYWALVIGTPKEKEGVIHAPLSKVLM  360

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++ KTERV+LA +S +E  Q+AVTEYRVLGPMINGCSWIELRP   RKHQLRVHCAEALG
Sbjct  361  NDRKTERVMLAHHSSIEPHQEAVTEYRVLGPMINGCSWIELRPLTYRKHQLRVHCAEALG  420

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW VH +WKQM RVD+EPTTG+PY++RRPEGLDVQKGSVLSKVPLLHL+CR
Sbjct  421  TPIVGDYKYGWLVHSRWKQMARVDMEPTTGKPYKLRRPEGLDVQKGSVLSKVPLLHLNCR  480

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELVLPNIAKFL +   S+   + ++      +PD+LRFVA MP+HM+ISWNLMSSYL+
Sbjct  481  ELVLPNIAKFLHVLGKSSEELHPSLS----LQPDILRFVATMPNHMRISWNLMSSYLV  534



>ref|XP_008807168.1| PREDICTED: LOW QUALITY PROTEIN: RNA pseudouridine synthase 3, 
mitochondrial [Phoenix dactylifera]
Length=483

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 195/238 (82%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + +++   K  SQ W+D+C+ T +RYWALVIG PKE+EGLI APLSKV+L
Sbjct  250  TKESFAQLHWLFTNINLAKSSSQTWNDACEATMQRYWALVIGCPKEREGLISAPLSKVLL  309

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTERVILA  S ++ SQ+AVTEYRV+GP INGCSW+ELRP   RKHQLRVHCAEALG
Sbjct  310  NDGKTERVILAHPSGIDGSQEAVTEYRVMGPTINGCSWVELRPLTGRKHQLRVHCAEALG  369

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWF+H++WKQMPRVD EP T  PY++RRPEGL+VQKGS LSKVPLLHLHCR
Sbjct  370  TPIVGDYKYGWFMHQRWKQMPRVDYEPMTRAPYKLRRPEGLEVQKGSALSKVPLLHLHCR  429

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+P+IAKFL   S+S    +      +  KPDLLRFVAPMPSHMKISWN+MSS L+
Sbjct  430  EMVIPHIAKFL---SSSGEWHDEGTPWSS-DKPDLLRFVAPMPSHMKISWNVMSSCLV  483



>dbj|BAJ88492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T E  + LH + + +K  K  SQ W+ +C+   +RYWALVIG+P E EG+I APL+KV+L
Sbjct  124  TREGFTRLHWLFTSIKLAKTASQTWNTACESYLQRYWALVIGTPTESEGVISAPLTKVLL  183

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVTEYRV+GP INGCSWIELRP   RKHQLRVHCAEALG
Sbjct  184  DDGKAERVILAHPSGIDGAQEAVTEYRVMGPTINGCSWIELRPLTGRKHQLRVHCAEALG  243

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL+VQKGSVLSKVPLLHLHCR
Sbjct  244  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKLRRPEGLEVQKGSVLSKVPLLHLHCR  303

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL   SN+    + N    +  KP+LLRF+APMP+HMKISWN+MSSYL+
Sbjct  304  EMVVPNIAKFL---SNTGEWHD-NGTPWSKEKPNLLRFIAPMPAHMKISWNIMSSYLV  357



>gb|EPS65775.1| hypothetical protein M569_09000 [Genlisea aurea]
Length=460

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/236 (69%), Positives = 188/236 (80%), Gaps = 5/236 (2%)
 Frame = -2

Query  727  ESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDN  548
            ESIS L  + +D +K K  S+ WDD+C+ TYRRYWALVIGSPKE EGL+ APL+KV+LD+
Sbjct  230  ESISHLQWLFNDARKAKPLSEEWDDACRATYRRYWALVIGSPKEPEGLVSAPLTKVLLDD  289

Query  547  GKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTP  368
            G+TE VIL+ NS LE SQ A+TEYRVLGP INGCSWIELRP  S KHQ+RVHCAEALGTP
Sbjct  290  GETEMVILSHNSGLEPSQPAITEYRVLGPTINGCSWIELRPRTSCKHQVRVHCAEALGTP  349

Query  367  IVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCREL  188
            IVGDY+YGW VHKKWKQMPR+D EP TG  YRMRRPEGL VQKGSVLSKVPLLHLHCRE+
Sbjct  350  IVGDYRYGWSVHKKWKQMPRIDYEPATGSAYRMRRPEGLQVQKGSVLSKVPLLHLHCREM  409

Query  187  VLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            V+PN+ +F+E H    RS     + + +      RFVA MPSHM+ISWNLM SYL+
Sbjct  410  VMPNVERFVEFHRRKRRSNGGGFEGEGLL-----RFVAEMPSHMQISWNLMCSYLV  460



>gb|AFW61501.1| hypothetical protein ZEAMMB73_778378 [Zea mays]
Length=340

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH +L+ +   +  SQ W+ +C+   ++YWALVIG+PKE+EG+I AP+SKV+L
Sbjct  107  TKESFTRLHWLLTSVNLARTSSQTWNKACEAYAQKYWALVIGTPKEREGVISAPISKVLL  166

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+A+TEYRV+GP INGCSWIEL+P   RKHQLRVHCAEALG
Sbjct  167  DDGKAERVILAHPSGIDGAQEAITEYRVMGPTINGCSWIELQPLTGRKHQLRVHCAEALG  226

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+ WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCR
Sbjct  227  TPIVGDYKYGWFVHQTWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCR  286

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL    +S    + N       KP+LLRFVAPMP HMKISWN+MSSYL+
Sbjct  287  EMVIPNIAKFL----SSTGGWHENGTPWAKEKPNLLRFVAPMPPHMKISWNIMSSYLV  340



>ref|XP_006659607.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Oryza 
brachyantha]
Length=340

 Score =   335 bits (858),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + + +   K  S+AW+ +C+   +RYWALVIG+PKE EG+I APLSKV+L
Sbjct  107  TKESFTRLHWLFTSVNLAKTNSEAWNAACEAYMQRYWALVIGTPKESEGIISAPLSKVLL  166

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVT YRV+GP I+GCSWIELRP   RKHQLRVHCAEALG
Sbjct  167  DDGKAERVILAHPSGIDGAQEAVTAYRVMGPTISGCSWIELRPLTGRKHQLRVHCAEALG  226

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL +QKGSVLSKVPLLHLHCR
Sbjct  227  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKLRRPEGLAIQKGSVLSKVPLLHLHCR  286

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL   SN+      N    +  KP+LLRF+APMP+HMKISWN+MSSYL+
Sbjct  287  EMVIPNIAKFL---SNTGEWHE-NGTPWSKEKPNLLRFIAPMPAHMKISWNIMSSYLV  340



>ref|NP_001062265.1| Os08g0520100 [Oryza sativa Japonica Group]
 sp|Q0J4D4.1|PUS3_ORYSJ RecName: Full=RNA pseudouridine synthase 3, mitochondrial; AltName: 
Full=RNA pseudouridylate synthase 3; AltName: Full=RNA-uridine 
isomerase 3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAF24179.1| Os08g0520100 [Oryza sativa Japonica Group]
 gb|EAZ07658.1| hypothetical protein OsI_29911 [Oryza sativa Indica Group]
Length=475

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 194/238 (82%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + + +   K  SQ W+ +C+   +RYWALVIG+PKE+EG+I APLSKV+L
Sbjct  242  TKESFTRLHWLFTSVNLAKTNSQVWNAACEAYMQRYWALVIGTPKEREGIISAPLSKVLL  301

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVT YRV+GP I+GCSWIELRP   RKHQLRVHCAEALG
Sbjct  302  DDGKAERVILAHPSGIDGAQEAVTAYRVMGPTIHGCSWIELRPLTGRKHQLRVHCAEALG  361

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCR
Sbjct  362  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCR  421

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL    +SN   + N    +  KP+LLRF+APMP+HMKISWN+MSSYL+
Sbjct  422  EMVIPNIAKFL----SSNGEWHENGAPWSKEKPNLLRFIAPMPAHMKISWNIMSSYLV  475



>gb|EAZ43360.1| hypothetical protein OsJ_27960 [Oryza sativa Japonica Group]
Length=509

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 194/238 (82%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + + +   K  SQ W+ +C+   +RYWALVIG+PKE+EG+I APLSKV+L
Sbjct  276  TKESFTRLHWLFTSVNLAKTNSQVWNAACEAYMQRYWALVIGTPKEREGIISAPLSKVLL  335

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVT YRV+GP I+GCSWIELRP   RKHQLRVHCAEALG
Sbjct  336  DDGKAERVILAHPSGIDGAQEAVTAYRVMGPTIHGCSWIELRPLTGRKHQLRVHCAEALG  395

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCR
Sbjct  396  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCR  455

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL    +SN   + N    +  KP+LLRF+APMP+HMKISWN+MSSYL+
Sbjct  456  EMVIPNIAKFL----SSNGEWHENGAPWSKEKPNLLRFIAPMPAHMKISWNIMSSYLV  509



>ref|XP_004974856.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like, 
partial [Setaria italica]
Length=464

 Score =   333 bits (855),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + + +   +  SQ W+ +C+   ++YWALVIG+PKE+EG+I AP+SKV+L
Sbjct  231  TKESFTQLHWLFTSVNLARTTSQTWNKACEAYVQKYWALVIGTPKEREGVISAPISKVLL  290

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+A+TEYRV+GP INGCSWIELRP   RKHQLRVHCAEALG
Sbjct  291  DDGKAERVILAHPSGIDGAQEAITEYRVMGPTINGCSWIELRPLTGRKHQLRVHCAEALG  350

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL+VQKGSVLSKVPLLHLHCR
Sbjct  351  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKIRRPEGLEVQKGSVLSKVPLLHLHCR  410

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+VLPNIAKFL    +S    +    +    KP+LLRF+APMP HMKISWN+MSSYL+
Sbjct  411  EMVLPNIAKFL----SSIGEWHDGGAAWAKEKPNLLRFIAPMPPHMKISWNVMSSYLV  464



>ref|XP_008677489.1| PREDICTED: uncharacterized protein LOC100381582 isoform X1 [Zea 
mays]
 gb|AFW61502.1| hypothetical protein ZEAMMB73_778378 [Zea mays]
Length=478

 Score =   334 bits (856),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH +L+ +   +  SQ W+ +C+   ++YWALVIG+PKE+EG+I AP+SKV+L
Sbjct  245  TKESFTRLHWLLTSVNLARTSSQTWNKACEAYAQKYWALVIGTPKEREGVISAPISKVLL  304

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+A+TEYRV+GP INGCSWIEL+P   RKHQLRVHCAEALG
Sbjct  305  DDGKAERVILAHPSGIDGAQEAITEYRVMGPTINGCSWIELQPLTGRKHQLRVHCAEALG  364

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH+ WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCR
Sbjct  365  TPIVGDYKYGWFVHQTWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCR  424

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL    +S    + N       KP+LLRFVAPMP HMKISWN+MSSYL+
Sbjct  425  EMVIPNIAKFL----SSTGGWHENGTPWAKEKPNLLRFVAPMPPHMKISWNIMSSYLV  478



>gb|KFK42267.1| hypothetical protein AALP_AA2G233400 [Arabis alpina]
Length=462

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI  LH V SD K +  + +AW+ +C+  Y++YWALVIGSPKEKEG+I APLSKV+L
Sbjct  243  TKESIDHLHSVFSDYKGRNSRCKAWNKACEAMYQQYWALVIGSPKEKEGIISAPLSKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GKT+RV+LA+ S  EASQ+A+TEYRVLGPMINGCSW+ELRP  SRKHQLRVHCAEALG
Sbjct  303  DDGKTDRVVLARGSGFEASQEAITEYRVLGPMINGCSWLELRPITSRKHQLRVHCAEALG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVHK+WKQMPRVDIEPTTG+PY++RRPEGLD+QKGSVLSKVPLLHLHCR
Sbjct  363  TPIVGDYKYGWFVHKRWKQMPRVDIEPTTGKPYKLRRPEGLDIQKGSVLSKVPLLHLHCR  422

Query  193  ELVLPNIAKFL  161
            E+VLPNIAKFL
Sbjct  423  EMVLPNIAKFL  433



>ref|XP_003572398.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial [Brachypodium 
distachyon]
Length=479

 Score =   327 bits (837),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 190/238 (80%), Gaps = 4/238 (2%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES + LH + + +K  +  S  W+ +C+   +RYWALVIG+PKE EG+I APL+KV+L
Sbjct  246  TKESFTRLHWLFTSVKLARTASPIWNSACESYLQRYWALVIGTPKESEGVISAPLTKVLL  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVTEYRV+GP INGCSWIEL P   RKHQLRVHCAEALG
Sbjct  306  DDGKAERVILAHPSGIDGAQEAVTEYRVMGPTINGCSWIELCPLTGRKHQLRVHCAEALG  365

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGE Y++RRPEGL+VQKGSVLSKVPLLHLHCR
Sbjct  366  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEQYKLRRPEGLEVQKGSVLSKVPLLHLHCR  425

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL   SN+    +         KP+LLRF+APMP+HMKISWN+MSSYL+
Sbjct  426  EMVVPNIAKFL---SNTGDWHDDGTPWSK-EKPNLLRFIAPMPAHMKISWNIMSSYLV  479



>ref|XP_002444745.1| hypothetical protein SORBIDRAFT_07g027030 [Sorghum bicolor]
 gb|EES14240.1| hypothetical protein SORBIDRAFT_07g027030 [Sorghum bicolor]
Length=439

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 185/235 (79%), Gaps = 4/235 (2%)
 Frame = -2

Query  724  SISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNG  545
            S+ +L         K+     W+ +C+   ++YWALVIG+PKE+EG+ICAP+SKV+LD+G
Sbjct  209  SMDVLAAAALSYGNKEGPKLTWNKACEAYVQKYWALVIGTPKEREGVICAPISKVLLDDG  268

Query  544  KTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPI  365
            K ERVILA  S ++ +Q+A+TEYRV+GP INGCSWIELRP   RKHQLRVHCAEALGTPI
Sbjct  269  KAERVILAHPSGIDGAQEAITEYRVMGPTINGCSWIELRPLTGRKHQLRVHCAEALGTPI  328

Query  364  VGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELV  185
            VGDYKYGWFVH+ WKQ P+ D EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCRE+V
Sbjct  329  VGDYKYGWFVHQTWKQNPQPDFEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCREMV  388

Query  184  LPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            +PNIAKFL    +S    + N       KP+LLRFVAPMP HMKISWN+MSSYL+
Sbjct  389  IPNIAKFL----SSTGEWHENGAPWAKEKPNLLRFVAPMPPHMKISWNIMSSYLV  439



>gb|EMT10490.1| RNA pseudourine synthase 3, mitochondrial [Aegilops tauschii]
Length=368

 Score =   320 bits (820),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 187/238 (79%), Gaps = 15/238 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T ES + LH + + +K  +  SQ           RYWALVIG+P E EG+I APL+KV+L
Sbjct  146  TRESFTRLHWLFTSIKLARTASQ-----------RYWALVIGTPTESEGIISAPLTKVLL  194

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK ERVILA  S ++ +Q+AVTEYRV+GP INGCSWIELRP   RKHQLRVHCAEALG
Sbjct  195  DDGKAERVILAHPSGIDGAQEAVTEYRVMGPTINGCSWIELRPLTGRKHQLRVHCAEALG  254

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGWFVH++WKQ P+ D EP TGEPY++RRPEGL+VQKGSVLSKVPLLHLHCR
Sbjct  255  TPIVGDYKYGWFVHQRWKQNPQPDFEPFTGEPYKLRRPEGLEVQKGSVLSKVPLLHLHCR  314

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            E+V+PNIAKFL   SN+    + N    +  KP+LLRF+AP+P+HMKISWN+MSSYL+
Sbjct  315  EMVVPNIAKFL---SNTGEWHD-NGTPWSKEKPNLLRFIAPLPAHMKISWNIMSSYLV  368



>gb|AGT16005.1| hypothetical protein SHCRBa_115_J16_R_190 [Saccharum hybrid cultivar 
R570]
Length=439

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 177/214 (83%), Gaps = 4/214 (2%)
 Frame = -2

Query  661  WDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVT  482
            W+ +C+   ++YWALVIG+PKE+EG+I AP+SKV+LD+GK ERVILA  S ++ +Q+AVT
Sbjct  230  WNKACEAYVQKYWALVIGTPKEREGVIAAPISKVLLDDGKAERVILAHPSGIDGAQEAVT  289

Query  481  EYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVD  302
            EYRV+GP INGCSWIELRP   RKHQLRVHCAE LGTPIVGDYKYGWFVH+ WKQ P+ D
Sbjct  290  EYRVMGPTINGCSWIELRPLTGRKHQLRVHCAEGLGTPIVGDYKYGWFVHQTWKQNPQPD  349

Query  301  IEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYN  122
             EP TGEPY++RRPEGL++QKGSVLSKVPLLHLHCRE+V+PNIAKFL    +S    + N
Sbjct  350  FEPFTGEPYKLRRPEGLEIQKGSVLSKVPLLHLHCREMVIPNIAKFL----SSTGEWHKN  405

Query  121  VKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
                   KP+LLRFVAPMP HMKISWN+MSSYL+
Sbjct  406  GAPWAKEKPNLLRFVAPMPPHMKISWNIMSSYLV  439



>ref|XP_006843179.1| hypothetical protein AMTR_s00146p00072100 [Amborella trichopoda]
 gb|ERN04854.1| hypothetical protein AMTR_s00146p00072100 [Amborella trichopoda]
Length=462

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 184/238 (77%), Gaps = 7/238 (3%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES   L   L +       S++  D CK   R+YWALVIGSPKEK+GLI APLSKV+L
Sbjct  232  TDESFKRLR-SLFNYGSNGLTSESTGDRCKGAIRKYWALVIGSPKEKQGLISAPLSKVLL  290

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GKTER+ILA NS L+ +Q+A+TEYRVLGP INGCSWIEL P   RKHQLRVHCAEALG
Sbjct  291  NDGKTERLILAYNSSLDGAQEAITEYRVLGPTINGCSWIELCPLTGRKHQLRVHCAEALG  350

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW+VHK WKQMPR D +P TG+PY+MRR   L VQKGSVLSKVPLLHLHCR
Sbjct  351  TPIVGDYKYGWYVHKCWKQMPRADFDPETGKPYKMRRHHNLAVQKGSVLSKVPLLHLHCR  410

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ELV+PNI K+ E      +S++ N      SK D+LRFVAPMPSHMKISWN+MSS L+
Sbjct  411  ELVIPNIEKYFE------KSQDANKPMKCKSKQDVLRFVAPMPSHMKISWNVMSSCLV  462



>ref|XP_008361299.1| PREDICTED: LOW QUALITY PROTEIN: RNA pseudouridine synthase 3, 
mitochondrial-like, partial [Malus domestica]
Length=441

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  706  LVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVI  527
            ++ +D+ K K   +AW+D+C   Y+ YWALVIGSPKEKEGLICAPL+KVVLD+GKTERVI
Sbjct  246  MLYTDINKGKSPCKAWNDACDAKYQSYWALVIGSPKEKEGLICAPLTKVVLDDGKTERVI  305

Query  526  LAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKY  347
            LA  S  + SQ A+T+YRVLGP INGCSWIELRP  SRKHQLRVHCAEALGTPIVGD+KY
Sbjct  306  LAHQSGFQTSQQAITQYRVLGPTINGCSWIELRPLTSRKHQLRVHCAEALGTPIVGDFKY  365

Query  346  GWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAK  167
            GWFVHK+WKQ+P+VDIEPT+G PY++RRP GLDVQKGSVLSKVPLLHLHCRELVLPNIAK
Sbjct  366  GWFVHKRWKQIPQVDIEPTSGLPYKLRRPAGLDVQKGSVLSKVPLLHLHCRELVLPNIAK  425

Query  166  FLEL  155
            FL L
Sbjct  426  FLLL  429



>gb|EMS66956.1| RNA pseudourine synthase 3, mitochondrial [Triticum urartu]
Length=400

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 187/270 (69%), Gaps = 47/270 (17%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSK---  563
            T ES + LH + + +K  +  SQ           RYWALVIG+P E EG+I APL+K   
Sbjct  146  TRESFTRLHWLFTSIKLARTASQ-----------RYWALVIGTPTESEGVISAPLTKGSR  194

Query  562  -----------------------------VVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
                                         V+LD+GK ERVILA  S ++ +Q+AVTEYRV
Sbjct  195  DHARPQENSSLRCSNRCPKIGHRQEGNRDVLLDDGKAERVILAHPSGIDGAQEAVTEYRV  254

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +GP INGCSWIELRP   RKHQLRVHCAEALGTPIVGDYKYGWFVH++WKQ P+ D EP 
Sbjct  255  MGPTINGCSWIELRPLTGRKHQLRVHCAEALGTPIVGDYKYGWFVHQRWKQNPQPDFEPF  314

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            TGEPY++RRPEGL+VQKGSVLSKVPLLHLHCRE+V+PNIAKFL   SN+    + N    
Sbjct  315  TGEPYKLRRPEGLEVQKGSVLSKVPLLHLHCREMVVPNIAKFL---SNTGEWHD-NGTPW  370

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            +  KP+LLRF+AP+P+HMKISWN+MSSYL+
Sbjct  371  SKEKPNLLRFIAPLPAHMKISWNIMSSYLV  400



>ref|XP_010911043.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Elaeis 
guineensis]
Length=146

 Score =   233 bits (594),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 125/150 (83%), Gaps = 4/150 (3%)
 Frame = -2

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +GP INGCSW+ELRP   RKHQLRVHCAEALGTPIVGDYKYGWF+H++WKQMPRVD EP 
Sbjct  1    MGPTINGCSWVELRPLTGRKHQLRVHCAEALGTPIVGDYKYGWFMHQRWKQMPRVDYEPM  60

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T  PY++RRPEGL+VQKGSVLSKVPLLHLHCRE+V+P+ AKFL     S+   +      
Sbjct  61   TRSPYKLRRPEGLEVQKGSVLSKVPLLHLHCREMVIPHFAKFL----RSSGEWHDEGTPW  116

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            T  KPDLLRFVAPMPSHMKISWN+MSSYL+
Sbjct  117  TSDKPDLLRFVAPMPSHMKISWNVMSSYLV  146



>gb|EYU24288.1| hypothetical protein MIMGU_mgv1a0228501mg, partial [Erythranthe 
guttata]
Length=126

 Score =   222 bits (565),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = -2

Query  403  LRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLS  224
            LRVHCAEALGTPIVGDYKYGWFVH KWKQMPR+D EPTTGEPY+MRRPEGLDVQKGSVLS
Sbjct  1    LRVHCAEALGTPIVGDYKYGWFVHSKWKQMPRLDFEPTTGEPYKMRRPEGLDVQKGSVLS  60

Query  223  KVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISW  44
            KVPLLHLH RE+VLPNI KF+ELH   + S NYNV  +  +KPD+LRFV PMP HMKISW
Sbjct  61   KVPLLHLHSREMVLPNIEKFIELH--KHMSGNYNVDPELCAKPDILRFVVPMPKHMKISW  118

Query  43   NLMSSYLI  20
            NLMSSYL+
Sbjct  119  NLMSSYLV  126



>ref|XP_010647894.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X2 [Vitis vinifera]
Length=430

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 160/240 (67%), Gaps = 17/240 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH   S  ++K F +   D   K  +  RRYWALVIGSP+   GLI APL KV
Sbjct  203  TQTSATILH---SIFREKTFGASNNDIDTKKRILQRRYWALVIGSPRRPRGLISAPLGKV  259

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+D+GK+ER+ +  N +  +SQ A+TEYRV+    +G +W+EL P   RKHQLRVHCAE 
Sbjct  260  VVDDGKSERITIVDNVQTMSSQHAITEYRVIKSSCHGYTWLELSPLTGRKHQLRVHCAEV  319

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWKQ+ + +IE    E    R+  P GLD++ GS+L K P LH
Sbjct  320  LGTPIVGDYKYGWQAHRKWKQLFQSNIEKNLDENLSNRKTHPFGLDLESGSILDKQPHLH  379

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT-VSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+++VLPN++  L+         N  + ++  +S+ + L FVAP+PSHM+ SW++++S
Sbjct  380  LHCKQMVLPNVSLALQ---------NLQLSAECDLSELESLEFVAPLPSHMQRSWDILNS  430



>ref|XP_002282614.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X1 [Vitis vinifera]
 emb|CBI40257.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 160/240 (67%), Gaps = 17/240 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH   S  ++K F +   D   K  +  RRYWALVIGSP+   GLI APL KV
Sbjct  249  TQTSATILH---SIFREKTFGASNNDIDTKKRILQRRYWALVIGSPRRPRGLISAPLGKV  305

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+D+GK+ER+ +  N +  +SQ A+TEYRV+    +G +W+EL P   RKHQLRVHCAE 
Sbjct  306  VVDDGKSERITIVDNVQTMSSQHAITEYRVIKSSCHGYTWLELSPLTGRKHQLRVHCAEV  365

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWKQ+ + +IE    E    R+  P GLD++ GS+L K P LH
Sbjct  366  LGTPIVGDYKYGWQAHRKWKQLFQSNIEKNLDENLSNRKTHPFGLDLESGSILDKQPHLH  425

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT-VSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+++VLPN++  L+         N  + ++  +S+ + L FVAP+PSHM+ SW++++S
Sbjct  426  LHCKQMVLPNVSLALQ---------NLQLSAECDLSELESLEFVAPLPSHMQRSWDILNS  476



>ref|XP_006847251.1| hypothetical protein AMTR_s00015p00025410 [Amborella trichopoda]
 gb|ERN08832.1| hypothetical protein AMTR_s00015p00025410 [Amborella trichopoda]
Length=457

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 156/239 (65%), Gaps = 14/239 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES +LLH +  D       +    +S  +  R+YWALVIG+P+  EGLI APLSK++L
Sbjct  232  TQESTTLLHSIFRDKTCGASFNVDIKNSKIILKRKYWALVIGNPQPSEGLISAPLSKLLL  291

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK+ER+ ++++S+ ++++ A+TEYRVL    +G +W+EL P   RKHQLRVHCAE LG
Sbjct  292  DDGKSERITVSEDSKNKSARHAITEYRVLRSSGHGFTWLELYPRTGRKHQLRVHCAEVLG  351

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPI+GDYKYGW  H+KWK  P +  E    E    + P GLD++ GSV  K P LHLHCR
Sbjct  352  TPILGDYKYGWNAHRKWKPFPTLKFE----ERLNRKAPFGLDLEGGSVSDKKPRLHLHCR  407

Query  193  ELVLPNIA-KFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ++ LPN++  F  LH  S          D +SK + L  VAP+P HM+ SW++++S L 
Sbjct  408  QMTLPNMSLAFQHLHEQS---------VDDLSKLEKLDLVAPLPLHMRRSWDILNSELF  457



>ref|XP_006487001.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X3 [Citrus sinensis]
Length=275

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC--KVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH   S  ++K F +   D+    K+  R YWALV+G+P+  +G+I APL KV
Sbjct  48   TQTSATVLH---SIFREKTFSASKEDNDNEKKILQRWYWALVVGTPRCSKGVISAPLGKV  104

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  N ++ ++Q AVT Y+V+ P  +G +W++L P   RKHQLRVHCAE 
Sbjct  105  VVDNGKSDRITVVNNDQIMSAQHAVTRYQVIKPSCHGYTWLKLSPLTGRKHQLRVHCAEV  164

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWKQ    D+   + E  P       GLD++ GS+L K P LH
Sbjct  165  LGTPIVGDYKYGWQTHRKWKQFHPSDLSKDSNEEIPKEKTLHFGLDLESGSILEKQPRLH  224

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+E+ LPN+++ ++    S+           VSK + L+ VAP+PSHM+ SW++++S
Sbjct  225  LHCKEMTLPNVSQAIQKVQLSSGC--------DVSKLETLKLVAPLPSHMQRSWDVLNS  275



>gb|KDO59819.1| hypothetical protein CISIN_1g023907mg [Citrus sinensis]
Length=275

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC--KVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH   S  ++K F +   D+    ++  R YWALV+G+P+  +G+I APL KV
Sbjct  48   TQTSATVLH---SIFREKTFSASKEDNDNEKRILQRWYWALVVGTPRCSKGVISAPLGKV  104

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  N ++ ++Q AVT Y+V+ P  +G +W++L P   RKHQLRVHCAE 
Sbjct  105  VVDNGKSDRITVVNNDQIMSAQHAVTRYQVIKPSCHGYTWLKLSPLTGRKHQLRVHCAEV  164

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWKQ    D+   + E  P       GLD++ GS+L K P LH
Sbjct  165  LGTPIVGDYKYGWQTHRKWKQFHPSDLSKDSNEEIPKEKTLHFGLDLESGSILEKQPRLH  224

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+E+ LPN+++ ++    S+           VSK + L+ VAP+PSHM+ SW++++S
Sbjct  225  LHCKEMTLPNVSQAIQKVQLSSGC--------DVSKLETLKLVAPLPSHMQRSWDVLNS  275



>ref|XP_006486999.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006487000.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X2 [Citrus sinensis]
Length=362

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC--KVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH +    ++K F +   D+    K+  R YWALV+G+P+  +G+I APL KV
Sbjct  135  TQTSATVLHSIF---REKTFSASKEDNDNEKKILQRWYWALVVGTPRCSKGVISAPLGKV  191

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  N ++ ++Q AVT Y+V+ P  +G +W++L P   RKHQLRVHCAE 
Sbjct  192  VVDNGKSDRITVVNNDQIMSAQHAVTRYQVIKPSCHGYTWLKLSPLTGRKHQLRVHCAEV  251

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWKQ    D+   + E  P       GLD++ GS+L K P LH
Sbjct  252  LGTPIVGDYKYGWQTHRKWKQFHPSDLSKDSNEEIPKEKTLHFGLDLESGSILEKQPRLH  311

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+E+ LPN+++ ++    S+           VSK + L+ VAP+PSHM+ SW++++S
Sbjct  312  LHCKEMTLPNVSQAIQKVQLSSGC--------DVSKLETLKLVAPLPSHMQRSWDVLNS  362



>gb|KDO59820.1| hypothetical protein CISIN_1g023907mg [Citrus sinensis]
Length=236

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 143/212 (67%), Gaps = 10/212 (5%)
 Frame = -2

Query  658  DDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTE  479
            D+  ++  R YWALV+G+P+  +G+I APL KVV+DNGK++R+ +  N ++ ++Q AVT 
Sbjct  33   DNEKRILQRWYWALVVGTPRCSKGVISAPLGKVVVDNGKSDRITVVNNDQIMSAQHAVTR  92

Query  478  YRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDI  299
            Y+V+ P  +G +W++L P   RKHQLRVHCAE LGTPIVGDYKYGW  H+KWKQ    D+
Sbjct  93   YQVIKPSCHGYTWLKLSPLTGRKHQLRVHCAEVLGTPIVGDYKYGWQTHRKWKQFHPSDL  152

Query  298  EPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNY  125
               + E  P       GLD++ GS+L K P LHLHC+E+ LPN+++ ++    S+     
Sbjct  153  SKDSNEEIPKEKTLHFGLDLESGSILEKQPRLHLHCKEMTLPNVSQAIQKVQLSSGC---  209

Query  124  NVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
                  VSK + L+ VAP+PSHM+ SW++++S
Sbjct  210  -----DVSKLETLKLVAPLPSHMQRSWDVLNS  236



>ref|XP_007042534.1| Ribosomal pseudouridine synthase, putative [Theobroma cacao]
 gb|EOX98365.1| Ribosomal pseudouridine synthase, putative [Theobroma cacao]
Length=477

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 157/238 (66%), Gaps = 13/238 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S ++LH V  +      +    D+  ++  +RYWALVIGSP+  +G+I APL KVV+
Sbjct  250  TQMSATILHSVFREETNDASKDDV-DNEKRILQKRYWALVIGSPRRPKGMIVAPLRKVVV  308

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  NS++ +SQ A TEY+V+    +G +W+EL P   RKHQLRVHCAE LG
Sbjct  309  DDGKSDRITVFDNSQIVSSQRAKTEYQVIKTTSHGYTWLELSPLTGRKHQLRVHCAEVLG  368

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKYGW  H++W+ +P  D++ ++ +  P     P GL++  GS+ +K P LHLH
Sbjct  369  TPIVGDYKYGWQAHRRWQHLPESDLKKSSNDKCPEENMLPFGLNMDSGSISAKRPRLHLH  428

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSD-TVSKPDLLRFVAPMPSHMKISWNLMSS  29
            CRE++ PN+++ L+         N  + +D  +SK   L  VAP+PS+M+ SW++M+S
Sbjct  429  CREMIFPNVSQALQ---------NLQLSTDHDLSKLKSLEVVAPLPSYMQKSWDIMNS  477



>ref|XP_004511295.1| PREDICTED: RNA pseudourine synthase 4, mitochondrial-like [Cicer 
arietinum]
Length=458

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 151/241 (63%), Gaps = 19/241 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S  +LH +  D  K    S   D   ++  RRYWALVIG P+   GLI +PL KVV+
Sbjct  231  TQTSTVVLHSIFRD--KTSRASDHNDTEKRILQRRYWALVIGRPRRSGGLITSPLGKVVV  288

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGK++R+ +  NS L +SQ AVTEYRVLG   +G +W+EL P   RKHQLRVHCAE LG
Sbjct  289  DNGKSDRITIVNNSTLVSSQHAVTEYRVLGSSSDGYTWLELSPLTGRKHQLRVHCAEVLG  348

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLHLHC  197
            TPIVGDYKYGW  HKKW      ++E +T E  +    P GL++ KGS+  K P LHLHC
Sbjct  349  TPIVGDYKYGWQAHKKWGHFDLCNLEDSTEELLKEETLPFGLNLNKGSISDKHPRLHLHC  408

Query  196  RELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSHMKISWNLMS  32
            ++++LPNI++ L+           +V+S + S  DL     L+  A +P +M+ SW++ +
Sbjct  409  KQIILPNISQALQ-----------DVQSLSASNCDLSVVEALKLEAELPPYMQRSWDVTN  457

Query  31   S  29
            S
Sbjct  458  S  458



>ref|XP_009378853.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009378854.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Pyrus 
x bretschneideri]
Length=361

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 154/237 (65%), Gaps = 13/237 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+   ++LH +  + K     +   DD+ ++  RRYWALVIGSP++++GLI APL KVV+
Sbjct  134  TQTIAAVLHSIFRE-KTVGASNDVTDDAKRILQRRYWALVIGSPRQRKGLISAPLVKVVV  192

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGK+ER+  A +S+  +SQ A+T+Y+V+G    G +W+EL P   RKHQLRVHCAE L 
Sbjct  193  DNGKSERITAANDSQTLSSQHAITKYKVIGSSCPGFTWLELTPLTGRKHQLRVHCAEVLR  252

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKYGW  H+ WK +   + E    E  R RR  P  L++  GS+  K P LHLH
Sbjct  253  TPIVGDYKYGWQTHRNWKPLSSSNTESHWNEELRPRRNLPFDLNMDSGSISEKTPRLHLH  312

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDT-VSKPDLLRFVAPMPSHMKISWNLMS  32
            C+++VLPN+  +L L       +N  + SD  +S+ + L  VAP+PS+M+ SW++ +
Sbjct  313  CKQMVLPNV--YLAL-------QNVKLHSDCDLSELESLELVAPLPSYMQRSWDITN  360



>ref|XP_010271251.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=472

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 147/234 (63%), Gaps = 13/234 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S ++LH   S  ++K F +   D+   +  RRYWALVIG+PK   GLI APL KVVL
Sbjct  249  TQTSATILH---SIFREKTFGASINDNDKMILQRRYWALVIGTPKRANGLISAPLGKVVL  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK+ER+ +  N    +SQ AVT+Y+V+    +G +W+EL P   RKHQLRVHCAE LG
Sbjct  306  DDGKSERMTVDTNGNAISSQHAVTKYQVMKSSAHGYTWLELCPLTGRKHQLRVHCAEVLG  365

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  H+KWK +   + +     P     P GLD + GS+  K P LHLHCR
Sbjct  366  TPIVGDYKYGWQAHRKWKPLSWSNPQKNKKLPRSKESPFGLDSEGGSIAEKQPHLHLHCR  425

Query  193  ELVLPNIAKFLE-LHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            +++ PNIA  L+ L S+SN           +S+ + L  VAP+P HM+ SW ++
Sbjct  426  QMIFPNIALALQHLQSSSNCD---------LSELESLNLVAPLPPHMQRSWGIL  470



>ref|XP_009341344.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Pyrus 
x bretschneideri]
Length=486

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 155/238 (65%), Gaps = 13/238 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+   ++LH +  + K     +   DD+ ++  RRYWALVIGSP++++GLI APL KVV+
Sbjct  259  TQTIAAVLHSIFRE-KTVGASNDVTDDAKRILQRRYWALVIGSPRQRKGLISAPLVKVVV  317

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGK+ER+  A +S+  +SQ A+T+Y+V+G    G +W+EL P   RKHQLRVHCAE L 
Sbjct  318  DNGKSERITAANDSQTLSSQHAITKYKVIGSSCPGFTWLELTPLTGRKHQLRVHCAEVLR  377

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKYGW  H+ WK +   + E    E  R RR  P  L++  GS+  K P LHLH
Sbjct  378  TPIVGDYKYGWQTHRNWKPLSSSNTESHWNEELRPRRNLPFDLNMDSGSIFEKTPRLHLH  437

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDT-VSKPDLLRFVAPMPSHMKISWNLMSS  29
            C+++VLPN+  +L L       +N  + SD  +S+ + L  VAP+PS+M+ SW++ +S
Sbjct  438  CKQMVLPNV--YLAL-------QNVKLHSDCDLSELESLELVAPLPSYMQRSWDITNS  486



>ref|XP_011001179.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X2 [Populus euphratica]
Length=471

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 155/235 (66%), Gaps = 12/235 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S ++LH +  + K     +    D  ++  R+YWALVIGSP+ ++GLI APL KVV+
Sbjct  245  TQTSATVLHAIFRE-KTLAASNDDVGDKRRILQRKYWALVIGSPRRQKGLISAPLGKVVV  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGK++R+ + +NS+  +SQ AVT+YRV+    +G +W+EL P   RKHQLRVHCAE LG
Sbjct  304  DNGKSDRITVVENSQNLSSQHAVTQYRVIESS-HGFTWLELSPLTGRKHQLRVHCAEVLG  362

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKY W  H+ WKQ+P  +IE  + E  R  +  P  LD+  G +  K P LHLH
Sbjct  363  TPIVGDYKYAWQAHRNWKQLPWSNIEDNSNEKSRSEKILPFALDLDSGGISEKHPRLHLH  422

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            C+++VLP+++K L+   + + S +Y+      S+   L+F AP+P +MK SW+++
Sbjct  423  CKQMVLPDVSKALQ---DVHLSSDYD-----FSQLASLKFDAPLPPYMKRSWDIL  469



>ref|XP_011001172.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X1 [Populus euphratica]
Length=475

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 154/238 (65%), Gaps = 14/238 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSD---LKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S ++LH +  +          S    D  ++  R+YWALVIGSP+ ++GLI APL K
Sbjct  245  TQTSATVLHAIFREKTLAASNDVSSTDVGDKRRILQRKYWALVIGSPRRQKGLISAPLGK  304

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VV+DNGK++R+ + +NS+  +SQ AVT+YRV+    +G +W+EL P   RKHQLRVHCAE
Sbjct  305  VVVDNGKSDRITVVENSQNLSSQHAVTQYRVIESS-HGFTWLELSPLTGRKHQLRVHCAE  363

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLL  209
             LGTPIVGDYKY W  H+ WKQ+P  +IE  + E  R  +  P  LD+  G +  K P L
Sbjct  364  VLGTPIVGDYKYAWQAHRNWKQLPWSNIEDNSNEKSRSEKILPFALDLDSGGISEKHPRL  423

Query  208  HLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            HLHC+++VLP+++K L+   + + S +Y+      S+   L+F AP+P +MK SW+++
Sbjct  424  HLHCKQMVLPDVSKALQ---DVHLSSDYD-----FSQLASLKFDAPLPPYMKRSWDIL  473



>ref|XP_006422925.1| hypothetical protein CICLE_v10028283mg [Citrus clementina]
 gb|ESR36165.1| hypothetical protein CICLE_v10028283mg [Citrus clementina]
Length=494

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 157/242 (65%), Gaps = 21/242 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC--KVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH   S  ++K F +   D+    ++  R YWALV+G+P+  +G+I APL KV
Sbjct  267  TQTSATVLH---SIFREKTFSASKEDNDNEKRILQRWYWALVVGTPRCSKGVISAPLRKV  323

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  N ++ ++Q AVT Y+V+ P  +G +W++L P   RKHQLRVHCAE 
Sbjct  324  VVDNGKSDRITVVNNDQIMSAQHAVTRYQVIKPSCHGYTWLKLSPLTGRKHQLRVHCAEV  383

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWKQ    D+   + +  P       GLD++ GS+L K P LH
Sbjct  384  LGTPIVGDYKYGWQTHRKWKQFHPSDLNKDSNDETPKEKTLHFGLDLESGSILEKQPGLH  443

Query  205  LHCRELVLPNIAKFL---ELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+E+ LPN+++ +   +L S  +           VSK + L+ VAP+PSHM+ SW+++
Sbjct  444  LHCKEMTLPNVSQAIQKVQLSSGCD-----------VSKLESLKLVAPLPSHMQRSWDVL  492

Query  34   SS  29
            +S
Sbjct  493  NS  494



>gb|KDP45903.1| hypothetical protein JCGZ_15463 [Jatropha curcas]
Length=470

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 155/239 (65%), Gaps = 16/239 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWD--DSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH V    ++K F +   D  D  ++  R+YWALVIGSP+ ++GLI APL KV
Sbjct  241  TQTSTTVLHSVF---REKTFAASNDDIGDRRRILQRKYWALVIGSPRCQKGLISAPLGKV  297

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            ++DNGK++R+ + +N    +SQ AVT YRVL       +W+EL P   RKHQLRVHCAE 
Sbjct  298  LVDNGKSDRITVIENVHNTSSQHAVTHYRVLESF-QDYTWLELSPLTGRKHQLRVHCAEV  356

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+KWK +   D+E T  +  P     P G+D + GS+  K P LH
Sbjct  357  LGTPIVGDYKYGWQAHRKWKHLHWSDLEKTLHDKVPCEKMLPLGIDFESGSISEKQPRLH  416

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+++VLPN+++ L+   ++  S +YN      S  + +   AP+PS+M+ SW+++SS
Sbjct  417  LHCKQMVLPNVSQALQ---DAKISPDYN-----FSDMETIELDAPLPSYMQRSWDILSS  467



>ref|XP_008236380.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Prunus 
mume]
Length=483

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 156/242 (64%), Gaps = 21/242 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKF--QSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH +    ++K F   +   DD+ ++  RRYWALVIGSP++++GLI APL KV
Sbjct  256  TQTSATVLHSIF---REKTFGASNDVIDDAKRILQRRYWALVIGSPRQRKGLISAPLGKV  312

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  +S+   SQ A+T+Y+V+G    G +W+EL P   RKHQLRVHCAE 
Sbjct  313  VVDNGKSDRITIVNDSQTLPSQHAITKYKVIGSPCPGYTWLELTPLTGRKHQLRVHCAEV  372

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            L TPIVGDYKYGW  H+ WK +   + E  + E  P     P  L+++ GSV  K P LH
Sbjct  373  LQTPIVGDYKYGWQTHRNWKPLAWSNNECHSDEEFPKTKNLPFDLNMESGSVSEKNPRLH  432

Query  205  LHCRELVLPNIAKFLE---LHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+++VLPN+   L+   LHS+S+           +S+ + L  VAP+PS M+ SWN+ 
Sbjct  433  LHCKQMVLPNVNLALQNVKLHSDSD-----------LSELESLELVAPLPSFMQRSWNIT  481

Query  34   SS  29
            +S
Sbjct  482  NS  483



>gb|KEH27320.1| RNA pseudouridine synthase [Medicago truncatula]
Length=390

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 150/241 (62%), Gaps = 18/241 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S +LLH +  + K  +  ++  D    +  RRYWALV+G P+   G++ APL KVV+
Sbjct  162  TKTSTALLHSIFRE-KTSRASNEENDTEKIILQRRYWALVLGCPRRSGGVVNAPLGKVVV  220

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGK++R+ +  NS L +SQ AVTEYRV+    +G +W+EL P   RKHQLRVHCAE LG
Sbjct  221  DNGKSDRITIVDNSALLSSQHAVTEYRVISSSSHGFTWLELSPLTGRKHQLRVHCAEVLG  280

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLHLHC  197
            TPIVGDYKYG   HKKW Q    ++E +T E  +    P GL++ KGS+  K P LHLHC
Sbjct  281  TPIVGDYKYGRQAHKKWGQFDFSNLEDSTEEHLKEEALPFGLNLNKGSISDKHPRLHLHC  340

Query  196  RELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSHMKISWNLMS  32
            +++VLPNI++ L+           NV+S + S  DL     L   A +P +MK SW + +
Sbjct  341  KQIVLPNISQALQ-----------NVQSVSDSSYDLSAVESLELEADLPPYMKKSWEVTN  389

Query  31   S  29
            S
Sbjct  390  S  390



>ref|XP_010096290.1| RNA pseudourine synthase 4 [Morus notabilis]
 gb|EXB63685.1| RNA pseudourine synthase 4 [Morus notabilis]
Length=470

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 153/240 (64%), Gaps = 17/240 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK---VTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S ++LH   S  ++K F +   D++ K   V  RRYWA VIGSP+   GLI APL K
Sbjct  243  TQTSATVLH---SIFREKTFGASN-DETVKGKIVLQRRYWAFVIGSPRHPNGLISAPLRK  298

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VVLDNGK++R+ +   S   +SQ A+T+Y+V+G   +G +W+EL P   RKHQLRVHCAE
Sbjct  299  VVLDNGKSDRITVVNGSHTLSSQHAITKYKVIGSSSHGYTWLELSPLTGRKHQLRVHCAE  358

Query  382  ALGTPIVGDYKYGWFVHKKWKQM--PRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLL  209
             LGTP+VGDYKYGW  H+ WK +  P  D +     P R   P GL++  GS+  K P L
Sbjct  359  VLGTPMVGDYKYGWQAHRDWKPLHWPDPDNKCIEVLPKRKNLPFGLNMDNGSISEKHPRL  418

Query  208  HLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            HLHC+++VLPNI+  L+   N  R  +Y      +S+ + L+  AP+PS+M+ SW+L +S
Sbjct  419  HLHCKQMVLPNISHVLQ---NVQRYSDYE-----LSRLERLKLDAPLPSYMQRSWHLTNS  470



>ref|XP_002518674.1| ribosomal pseudouridine synthase, putative [Ricinus communis]
 gb|EEF43599.1| ribosomal pseudouridine synthase, putative [Ricinus communis]
Length=536

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 160/239 (67%), Gaps = 16/239 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWD--DSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S  +LH V    ++K F +   D  +  ++  R+YWALVIGSP+ ++G+I APL KV
Sbjct  310  TQTSTMVLHSVF---REKTFAASNHDIGERRRILQRKYWALVIGSPRRQKGIISAPLGKV  366

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+D+GK++R+ + +N+   + Q AVT+YRV+    +G +W+EL P   RKHQLRVHCAE 
Sbjct  367  VVDDGKSDRITVVENAESTSFQHAVTQYRVMESS-HGYAWLELSPITGRKHQLRVHCAEV  425

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW VH+KWKQ+P  ++E  + E    ++  P G+D++ GS+  K P LH
Sbjct  426  LGTPIVGDYKYGWQVHRKWKQLPFPNLEKISNENALCKKILPFGIDLESGSISEKHPRLH  485

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC+++VLP++++ L        S NY+  SD  S    +   AP+PS+M+ SW++++S
Sbjct  486  LHCKQMVLPDVSQALR---GVQTSSNYDF-SDLKS----IELDAPLPSYMQRSWDILNS  536



>ref|XP_008812838.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Phoenix 
dactylifera]
Length=476

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 153/239 (64%), Gaps = 19/239 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVT----YRRYWALVIGSPKEKEGLICAPLS  566
            T+ S  +LH +      ++  S A  D  K T     R+Y ALVIG+PK  +GLI APL+
Sbjct  249  TQTSALILHSIF-----REKTSGALSDDIKTTRRTLQRKYLALVIGTPKHSKGLISAPLA  303

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            K+VL++GK+ER+ +   ++  +S  A+TEYRV+    +G +W+EL P   RKHQLRVHCA
Sbjct  304  KIVLEDGKSERITIVMGTKSTSSHHALTEYRVIRSSAHGFTWLELCPLTGRKHQLRVHCA  363

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLH  206
            EALGTPIVGDYKYGW+ H+KW+ MP  +   +  E    +RP GLD+  GS+  K P LH
Sbjct  364  EALGTPIVGDYKYGWYAHRKWEPMPWPE-SMSEDEKLPKKRPFGLDLDGGSIAEKQPYLH  422

Query  205  LHCRELVLPNI-AKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            LHC++++LPNI A   +L S++       V  D  SK + +  VAP+P HM+ SW+++S
Sbjct  423  LHCKQMILPNISAALCQLQSSA-------VDHD-FSKLEKINLVAPLPLHMQESWDILS  473



>ref|XP_007199810.1| hypothetical protein PRUPE_ppa004969mg [Prunus persica]
 gb|EMJ01009.1| hypothetical protein PRUPE_ppa004969mg [Prunus persica]
Length=483

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 156/242 (64%), Gaps = 21/242 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKF--QSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH +    ++K F   +   DD+ ++  RRYWALVIGSP++++GLI APL KV
Sbjct  256  TQTSATVLHSIF---REKTFGASNDEIDDAKRILQRRYWALVIGSPRQRKGLISAPLGKV  312

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  +S+   SQ A+T+Y+V+G    G +W+EL P   RKHQLRVHCAE 
Sbjct  313  VVDNGKSDRITIVNDSQTLPSQHAITKYKVIGSPCPGYTWLELTPLTGRKHQLRVHCAEV  372

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            L TPIVGDYKYGW  H+ WK +   + E  + E  P R   P  L+++ GSV  K P LH
Sbjct  373  LRTPIVGDYKYGWQTHRNWKPLAWSNNECHSDEEFPKRKNLPFDLNMESGSVSEKNPRLH  432

Query  205  LHCRELVLPNIAKFLE---LHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+++VLPN+   L+   LHS+S+           +S+ + L  VA +PS M+ SWN+ 
Sbjct  433  LHCKQMVLPNVNLALQNVKLHSDSD-----------LSELESLELVAALPSFMQRSWNIT  481

Query  34   SS  29
            +S
Sbjct  482  NS  483



>ref|XP_003635999.1| RNA pseudourine synthase [Medicago truncatula]
 gb|KEH27321.1| RNA pseudouridine synthase [Medicago truncatula]
Length=430

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/241 (45%), Positives = 150/241 (62%), Gaps = 18/241 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S +LLH +  + K  +  ++  D    +  RRYWALV+G P+   G++ APL KVV+
Sbjct  202  TKTSTALLHSIFRE-KTSRASNEENDTEKIILQRRYWALVLGCPRRSGGVVNAPLGKVVV  260

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            DNGK++R+ +  NS L +SQ AVTEYRV+    +G +W+EL P   RKHQLRVHCAE LG
Sbjct  261  DNGKSDRITIVDNSALLSSQHAVTEYRVISSSSHGFTWLELSPLTGRKHQLRVHCAEVLG  320

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLHLHC  197
            TPIVGDYKYG   HKKW Q    ++E +T E  +    P GL++ KGS+  K P LHLHC
Sbjct  321  TPIVGDYKYGRQAHKKWGQFDFSNLEDSTEEHLKEEALPFGLNLNKGSISDKHPRLHLHC  380

Query  196  RELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSHMKISWNLMS  32
            +++VLPNI++ L+           NV+S + S  DL     L   A +P +MK SW + +
Sbjct  381  KQIVLPNISQALQ-----------NVQSVSDSSYDLSAVESLELEADLPPYMKKSWEVTN  429

Query  31   S  29
            S
Sbjct  430  S  430



>ref|XP_010943216.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X2 [Elaeis guineensis]
Length=475

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 152/226 (67%), Gaps = 9/226 (4%)
 Frame = -2

Query  706  LVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVI  527
            LVL  + ++K      D +C+   R+Y ALVIG+PK  +GLI APL+K+VL++GK+ER+ 
Sbjct  254  LVLHSIFREKTSGALSDTTCRALQRKYLALVIGTPKRWKGLISAPLTKIVLEDGKSERIT  313

Query  526  LAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKY  347
            + ++++  +S  A+TEY+V+    +G +W+EL P   RKHQLRVH AEALGTPIVGDYKY
Sbjct  314  IVKDTKTASSHHALTEYQVIRSSAHGFTWLELCPLTGRKHQLRVHLAEALGTPIVGDYKY  373

Query  346  GWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAK  167
            GW+ H+KW+ MP  +      +  + + P GL++  GS+  K P LHLHC++++LPNI+ 
Sbjct  374  GWYAHRKWEPMPWPESMSEDEKLPKNKPPFGLELDGGSIAEKQPFLHLHCKQMILPNISA  433

Query  166  FL-ELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
             L +L S+S       V  D + + + L  VAP+P HM++SW+++S
Sbjct  434  ALWQLQSSS-------VDHDFL-ELEKLNLVAPLPLHMRVSWDILS  471



>ref|XP_006346360.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Solanum 
tuberosum]
Length=467

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 149/244 (61%), Gaps = 25/244 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S LH   S  ++K F SQ  D   K  +  ++YWALVIG P+   G+I APL K+
Sbjct  240  TQLSASALH---SIFREKTFDSQNEDLESKKRILQKKYWALVIGCPRRSGGIISAPLGKL  296

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQLRVHCAEA
Sbjct  297  VLDNGKSERITIMSDVRAPSAQYAVTEYRIIGSSEKGYTWLELSPLTGRKHQLRVHCAEA  356

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQ--KGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+K K +P        G     ++P+  +++   GS+  K P LH
Sbjct  357  LGTPIVGDYKYGWQAHRKLKHLPLPTSVLNLGVQIPRQKPDPFNLRLGNGSISDKQPHLH  416

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSHMKISWN  41
            LHC+E+VLPNI+  L+             ++  VS  DL     ++ VAP+P HM+ SW+
Sbjct  417  LHCKEMVLPNISLALQ-------------RAQVVSDTDLVDVESIKLVAPLPFHMQKSWD  463

Query  40   LMSS  29
             +SS
Sbjct  464  CLSS  467



>gb|KJB12280.1| hypothetical protein B456_002G009500 [Gossypium raimondii]
Length=479

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 153/241 (63%), Gaps = 18/241 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSD--LKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH V  +  L   K  S   D+  +V  +RYWALVIGSP+  +G I APL KV
Sbjct  251  TQMSAAILHSVFREETLGASKHDS---DNEKRVLQKRYWALVIGSPRRPKGTISAPLRKV  307

Query  559  VLDNGKTERV-ILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            V+D+GK++R+ +   N+ + +SQ A+TEYRV+    +G +W+EL P   RKHQLRVHCAE
Sbjct  308  VVDDGKSDRITVFEHNNTILSSQRAITEYRVIKTSTHGFTWLELSPLTGRKHQLRVHCAE  367

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLL  209
             LGTPIVGDYKYGW  H++++ +   D+   + E        P GL++  GS+  K   L
Sbjct  368  VLGTPIVGDYKYGWQAHRRFQNLAESDLRKNSNEKVAKENMLPFGLNMDSGSISEKHLRL  427

Query  208  HLHCRELVLPNIAKFLELHSNSNRSRN-YNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            HLHCRE++LPN+++ L         RN  +   D +SK   L+ VAP+PS+M+ SW++++
Sbjct  428  HLHCREMILPNVSQVL---------RNPKSFTDDDLSKLKSLKIVAPLPSYMQKSWDILN  478

Query  31   S  29
            S
Sbjct  479  S  479



>ref|XP_004230733.2| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Solanum 
lycopersicum]
Length=478

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 150/250 (60%), Gaps = 37/250 (15%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S LH   S  ++K F SQ  D   K  +  ++YWALVIG P+   G+I APL K+
Sbjct  251  TQLSASALH---SIFREKTFDSQNEDLESKKRILQKKYWALVIGCPRRSGGIISAPLGKL  307

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQLRVHCAEA
Sbjct  308  VLDNGKSERITIMSDVREPSAQYAVTEYRIIGSSEKGYTWLELSPLTGRKHQLRVHCAEA  367

Query  379  LGTPIVGDYKYGWFVHKKWKQMPR--------VDIEPTTGEPYRMRRPEGLDVQKGSVLS  224
            LGTPIVGDYKYGW  H+K K +P         V+I     +P+ +R      +  GS+  
Sbjct  368  LGTPIVGDYKYGWQAHRKLKHLPLPTSVLNLVVEIPRQKPDPFNLR------LGNGSISD  421

Query  223  KVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSH  59
            K P LHLHC+E+VLPNI+  L+             ++  VS  DL     ++ VAP+P H
Sbjct  422  KQPHLHLHCKEMVLPNISLALQ-------------RAQVVSDADLVDVESIKLVAPLPFH  468

Query  58   MKISWNLMSS  29
            M+ SW+ +S+
Sbjct  469  MQKSWDCLSA  478



>ref|XP_010943215.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X1 [Elaeis guineensis]
Length=478

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 153/229 (67%), Gaps = 12/229 (5%)
 Frame = -2

Query  706  LVLSDLKKKKFQSQAWDD---SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTE  536
            LVL  + ++K      DD   +C+   R+Y ALVIG+PK  +GLI APL+K+VL++GK+E
Sbjct  254  LVLHSIFREKTSGALSDDIKTTCRALQRKYLALVIGTPKRWKGLISAPLTKIVLEDGKSE  313

Query  535  RVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGD  356
            R+ + ++++  +S  A+TEY+V+    +G +W+EL P   RKHQLRVH AEALGTPIVGD
Sbjct  314  RITIVKDTKTASSHHALTEYQVIRSSAHGFTWLELCPLTGRKHQLRVHLAEALGTPIVGD  373

Query  355  YKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPN  176
            YKYGW+ H+KW+ MP  +      +  + + P GL++  GS+  K P LHLHC++++LPN
Sbjct  374  YKYGWYAHRKWEPMPWPESMSEDEKLPKNKPPFGLELDGGSIAEKQPFLHLHCKQMILPN  433

Query  175  IAKFL-ELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            I+  L +L S+S       V  D + + + L  VAP+P HM++SW+++S
Sbjct  434  ISAALWQLQSSS-------VDHDFL-ELEKLNLVAPLPLHMRVSWDILS  474



>ref|XP_002313876.2| hypothetical protein POPTR_0009s09860g [Populus trichocarpa]
 gb|EEE87831.2| hypothetical protein POPTR_0009s09860g [Populus trichocarpa]
Length=471

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 155/238 (65%), Gaps = 18/238 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC---KVTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S ++LH +     ++K  + + DD     ++  R+YWALVIGSP+  +GLI APL K
Sbjct  245  TQTSATVLHAIF----REKTLAASNDDVGNKRRILQRKYWALVIGSPRRPKGLISAPLGK  300

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VV+DNGK++R+ + +NS+  +SQ AVT+YRV+    +G +W+EL P   RKHQLRVHCAE
Sbjct  301  VVVDNGKSDRITVVENSQNLSSQHAVTQYRVIESS-HGFTWLELSPLTGRKHQLRVHCAE  359

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLL  209
             LGTPIVGDYKY W  H+ WKQ+   +IE  + +     +  P  LD+  GS+  K P L
Sbjct  360  VLGTPIVGDYKYAWQAHRNWKQLQWSNIEDNSNDKSLSEKILPFALDLDSGSISEKHPRL  419

Query  208  HLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            HLHC+++VLP+++K L+   +   S +Y+      S+   L+F AP+P +MK SW+++
Sbjct  420  HLHCKQMVLPDVSKALQ---DVQLSSDYD-----FSQLASLKFDAPLPPYMKKSWDIL  469



>ref|XP_007199809.1| hypothetical protein PRUPE_ppa004969mg [Prunus persica]
 gb|EMJ01008.1| hypothetical protein PRUPE_ppa004969mg [Prunus persica]
Length=481

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 157/243 (65%), Gaps = 25/243 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKF--QSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH +    ++K F   +   DD+ ++  RRYWALVIGSP++++GLI APL KV
Sbjct  256  TQTSATVLHSIF---REKTFGASNDEIDDAKRILQRRYWALVIGSPRQRKGLISAPLGKV  312

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGC-SWIELRPHASRKHQLRVHCAE  383
            V+DNGK++R+ +  +S+   SQ A+T+Y+V+G   + C +W+EL P   RKHQLRVHCAE
Sbjct  313  VVDNGKSDRITIVNDSQTLPSQHAITKYKVIG---SPCYTWLELTPLTGRKHQLRVHCAE  369

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLL  209
             L TPIVGDYKYGW  H+ WK +   + E  + E  P R   P  L+++ GSV  K P L
Sbjct  370  VLRTPIVGDYKYGWQTHRNWKPLAWSNNECHSDEEFPKRKNLPFDLNMESGSVSEKNPRL  429

Query  208  HLHCRELVLPNIAKFLE---LHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNL  38
            HLHC+++VLPN+   L+   LHS+S+           +S+ + L  VA +PS M+ SWN+
Sbjct  430  HLHCKQMVLPNVNLALQNVKLHSDSD-----------LSELESLELVAALPSFMQRSWNI  478

Query  37   MSS  29
             +S
Sbjct  479  TNS  481



>ref|XP_009805028.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=481

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 147/250 (59%), Gaps = 37/250 (15%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S+LH V    ++K F +Q  D   K  V  +RYWALVIG P+  +GLI  PL KV
Sbjct  254  TQLSASVLHSVF---REKTFGTQTEDLESKKRVLQKRYWALVIGCPRRSKGLISVPLGKV  310

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQLRVHCAE 
Sbjct  311  VLDNGKSERITIMSDVREPSAQFAVTEYRIIGSSEKGYTWLELSPLTGRKHQLRVHCAEV  370

Query  379  LGTPIVGDYKYGWFVHKKWKQMPR--------VDIEPTTGEPYRMRRPEGLDVQKGSVLS  224
            LGTPIVGDYKYGW  H+K K +            I     +P+ +R      +  GS+  
Sbjct  371  LGTPIVGDYKYGWQAHRKLKHLSSSTSIVNLGARILEQEADPFSLR------LGNGSISD  424

Query  223  KVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSH  59
            K P LHLHC+E+VLPN +  L+             ++  VS  DL     ++ VAP+PSH
Sbjct  425  KQPHLHLHCKEMVLPNFSLALQ-------------QARVVSGADLVHVESIKLVAPLPSH  471

Query  58   MKISWNLMSS  29
            M+ SW+ +SS
Sbjct  472  MQKSWDCLSS  481



>ref|XP_009805027.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=496

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 147/250 (59%), Gaps = 37/250 (15%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S+LH V    ++K F +Q  D   K  V  +RYWALVIG P+  +GLI  PL KV
Sbjct  269  TQLSASVLHSVF---REKTFGTQTEDLESKKRVLQKRYWALVIGCPRRSKGLISVPLGKV  325

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQLRVHCAE 
Sbjct  326  VLDNGKSERITIMSDVREPSAQFAVTEYRIIGSSEKGYTWLELSPLTGRKHQLRVHCAEV  385

Query  379  LGTPIVGDYKYGWFVHKKWKQMPR--------VDIEPTTGEPYRMRRPEGLDVQKGSVLS  224
            LGTPIVGDYKYGW  H+K K +            I     +P+ +R      +  GS+  
Sbjct  386  LGTPIVGDYKYGWQAHRKLKHLSSSTSIVNLGARILEQEADPFSLR------LGNGSISD  439

Query  223  KVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSH  59
            K P LHLHC+E+VLPN +  L+             ++  VS  DL     ++ VAP+PSH
Sbjct  440  KQPHLHLHCKEMVLPNFSLALQ-------------QARVVSGADLVHVESIKLVAPLPSH  486

Query  58   MKISWNLMSS  29
            M+ SW+ +SS
Sbjct  487  MQKSWDCLSS  496



>ref|XP_009629273.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=357

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 145/237 (61%), Gaps = 15/237 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S+LH V    ++K F +Q  D   K  V  +RYWALVIG P+  +G+I  PL+KV
Sbjct  130  TQLSASVLHSVF---REKTFGTQTEDLESKKRVLQKRYWALVIGCPRRSKGVISVPLAKV  186

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQLRVHCAE 
Sbjct  187  VLDNGKSERITIMSDVREPSAQFAVTEYRIIGSSEKGYTWLELSPLTGRKHQLRVHCAEV  246

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+K K +         G   P +   P  L +  GS+  K P LH
Sbjct  247  LGTPIVGDYKYGWQAHRKLKHLSSSISTVNLGARIPEQEADPFSLCLGNGSISDKQPHLH  306

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+E+VLPNI+  L+     + +   +V+S        ++ VA +PSHM+ SW+ +
Sbjct  307  LHCKEMVLPNISLALQQARVVSGADLIDVES--------IKLVAHLPSHMQKSWDCL  355



>gb|ACR37582.1| unknown [Zea mays]
Length=272

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 146/238 (61%), Gaps = 18/238 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S SL+H +     ++K      D + +V  R+Y ALVIG P+  +GL+ APL+KVVL
Sbjct  47   TQFSASLMHAIF----REKTADALGDGTQQVLQRKYVALVIGRPRHPKGLLSAPLAKVVL  102

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +G++ER+ +   S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  103  QDGRSERLTVCAGSNTASVQDALTEYRVIESFPQGYTWLELFPRTGRKHQLRVHCAEVLG  162

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR---PEGLDVQKGSVLSKVPLLHL  203
            TPIVGDYKYG   H+ W  +P     P T +   +++   P GL +  GSV  + P LHL
Sbjct  163  TPIVGDYKYGRQAHQNWMPLPM----PQTIDKEMLKKRKLPFGLTLGGGSVAEQQPQLHL  218

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            HC++++LP+I+  ++   +S+   ++       S  + L FVAP+P HM++SW ++ S
Sbjct  219  HCKQMILPDISAAMQQLRSSDADHDF-------SDLEKLSFVAPLPLHMQLSWKILLS  269



>ref|XP_003516775.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X1 [Glycine max]
 gb|KHN30421.1| RNA pseudourine synthase 4, mitochondrial [Glycine soja]
Length=427

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 149/241 (62%), Gaps = 23/241 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK---VTYRRYWALVIGSPKEKEGLICAPLSK  563
            T  S ++LH +      ++  S+A DD  K   +  RRYWALV+G P+  +GL+ A L K
Sbjct  202  THTSTTVLHSIF-----REKTSRASDDIGKEKRILQRRYWALVLGCPRRPKGLVTASLGK  256

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VV+DNG+++R+ +  NS L +SQ A+TEYRV+     G +W+EL P   RKHQLRVHCAE
Sbjct  257  VVVDNGRSDRITIVDNSTLMSSQHAITEYRVIASSSQGYTWLELTPLTGRKHQLRVHCAE  316

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLH  206
             LGTPIVGDYKYGW  H+KW      ++E +  E     + P GL++ KGS+    P LH
Sbjct  317  VLGTPIVGDYKYGWQAHRKWGHFDLPNVEDSREELLNEEKLPFGLNLNKGSISENHPRLH  376

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT---VSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+++VLPNI++ L+           NV+S +   +S  + L  VA +P +M+ SW++ 
Sbjct  377  LHCKQMVLPNISQALQ-----------NVQSASSCDLSLVEELELVADLPPYMQRSWDVT  425

Query  34   S  32
            +
Sbjct  426  N  426



>ref|XP_006573909.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X2 [Glycine max]
Length=429

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 149/241 (62%), Gaps = 23/241 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK---VTYRRYWALVIGSPKEKEGLICAPLSK  563
            T  S ++LH +      ++  S+A DD  K   +  RRYWALV+G P+  +GL+ A L K
Sbjct  204  THTSTTVLHSIF-----REKTSRASDDIGKEKRILQRRYWALVLGCPRRPKGLVTASLGK  258

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VV+DNG+++R+ +  NS L +SQ A+TEYRV+     G +W+EL P   RKHQLRVHCAE
Sbjct  259  VVVDNGRSDRITIVDNSTLMSSQHAITEYRVIASSSQGYTWLELTPLTGRKHQLRVHCAE  318

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLH  206
             LGTPIVGDYKYGW  H+KW      ++E +  E     + P GL++ KGS+    P LH
Sbjct  319  VLGTPIVGDYKYGWQAHRKWGHFDLPNVEDSREELLNEEKLPFGLNLNKGSISENHPRLH  378

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT---VSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+++VLPNI++ L+           NV+S +   +S  + L  VA +P +M+ SW++ 
Sbjct  379  LHCKQMVLPNISQALQ-----------NVQSASSCDLSLVEELELVADLPPYMQRSWDVT  427

Query  34   S  32
            +
Sbjct  428  N  428



>ref|XP_010507743.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X1 [Camelina sativa]
Length=482

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P+ K+G I APL KVV+
Sbjct  252  TQTAATVLHSIFRE-KTTGASAYGVKKNIKSLKRKYIALVIGCPRRKKGQISAPLRKVVV  310

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  311  DDGKSDRITVDDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  370

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  HK  + +   +  PT     +   P GLD+  G V SK P LHLH +
Sbjct  371  TPIVGDYKYGWQAHKTREPLVSSENTPTK----QSSSPFGLDLDGGDVSSKQPHLHLHSK  426

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE    S+ S   ++ S        L+F AP+PSHM++S+NL+ S
Sbjct  427  QIDLPNISQLLEKMEVSSDSDISDIGS--------LKFDAPLPSHMQLSFNLLKS  473



>ref|XP_010466089.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Camelina 
sativa]
Length=482

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 146/235 (62%), Gaps = 13/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P+ K+G I APL KVV+
Sbjct  252  TQTAATVLHSIFRE-KTTGASAYGVKKNIKSLKRKYIALVIGCPRRKKGQISAPLRKVVV  310

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  311  DDGKSDRITVDDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  370

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  HK  + +   +  PT     +   P GLD+  G V SK P LHLH +
Sbjct  371  TPIVGDYKYGWQAHKTREPLVSSENTPTK----QSSSPFGLDLDGGDVSSKQPHLHLHSK  426

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE    S+ S   ++ S        L+F AP+PSHM++S+NL+ S
Sbjct  427  QIDLPNISQLLEKMELSSDSDISDIGS--------LKFDAPLPSHMQLSFNLLKS  473



>ref|XP_007157229.1| hypothetical protein PHAVU_002G053600g [Phaseolus vulgaris]
 gb|ESW29223.1| hypothetical protein PHAVU_002G053600g [Phaseolus vulgaris]
Length=432

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 151/241 (63%), Gaps = 23/241 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDS---CKVTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S ++LH +      ++  S+A DD+    ++  RRYWALV+G P+  +GL+ A L K
Sbjct  207  TQTSTTVLHSIF-----REKTSRALDDTEEEKRILQRRYWALVLGRPRCSKGLVTASLGK  261

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VV+DNGK++R+ +  NS   +SQ A+TEYRV+     G +W+EL P   RKHQLRVHCAE
Sbjct  262  VVVDNGKSDRITVVDNSTSLSSQHAITEYRVIASSSQGYTWLELSPLTGRKHQLRVHCAE  321

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLH  206
             LGTPIVGDYKYGW  H+KW      ++E +  E  +    P GL++  GS+    P LH
Sbjct  322  VLGTPIVGDYKYGWQAHRKWGNFDLSNVEDSCEEHLKEETLPFGLNLNNGSISENRPRLH  381

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT---VSKPDLLRFVAPMPSHMKISWNLM  35
            LHC+++VLPNI++ L+           NV+S +   +S+ + L+ VA +P +M+ SW++ 
Sbjct  382  LHCKKIVLPNISEALQ-----------NVQSFSNCDLSQVEGLQLVADLPPYMQRSWDIT  430

Query  34   S  32
            S
Sbjct  431  S  431



>ref|XP_009629272.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=464

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 145/242 (60%), Gaps = 25/242 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S+LH V    ++K F +Q  D   K  V  +RYWALVIG P+  +G+I  PL+KV
Sbjct  237  TQLSASVLHSVF---REKTFGTQTEDLESKKRVLQKRYWALVIGCPRRSKGVISVPLAKV  293

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQLRVHCAE 
Sbjct  294  VLDNGKSERITIMSDVREPSAQFAVTEYRIIGSSEKGYTWLELSPLTGRKHQLRVHCAEV  353

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE--PYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+K K +         G   P +   P  L +  GS+  K P LH
Sbjct  354  LGTPIVGDYKYGWQAHRKLKHLSSSISTVNLGARIPEQEADPFSLCLGNGSISDKQPHLH  413

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSHMKISWN  41
            LHC+E+VLPNI+  L+             ++  VS  DL     ++ VA +PSHM+ SW+
Sbjct  414  LHCKEMVLPNISLALQ-------------QARVVSGADLIDVESIKLVAHLPSHMQKSWD  460

Query  40   LM  35
             +
Sbjct  461  CL  462



>emb|CDO97224.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 143/239 (60%), Gaps = 15/239 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S + LH   S  ++K  ++  +D   K  +  + YWALVIGSP+  +G+I  PL KV
Sbjct  250  TQLSATTLH---SIFREKTLEASEYDLDSKRRIVRKTYWALVIGSPRRSKGIISKPLGKV  306

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+DNGK++R+ +  + +   +Q AVTEY V+G   +G SW+EL P   RKHQLRVHCAE 
Sbjct  307  VVDNGKSDRITVLDDVQSSLAQYAVTEYEVIGSSCHGYSWLELSPLTGRKHQLRVHCAEV  366

Query  379  LGTPIVGDYKYGWFVHKKWKQ--MPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLH  206
            LGTPIVGDYKYGW  H+  K      +  +   G P     P  L++  GS+L K P LH
Sbjct  367  LGTPIVGDYKYGWQAHRNLKNPGPSALTRDHNEGLPEEGLDPFSLNLGNGSILDKQPRLH  426

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHCRE+VLPNI+  L+        R  ++    +     ++F AP+PSHM+ SWN + S
Sbjct  427  LHCREMVLPNISLALQ--------RAKSITDLDLEDVKTIKFDAPLPSHMQKSWNALGS  477



>ref|XP_010487888.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Camelina 
sativa]
Length=481

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 146/233 (63%), Gaps = 13/233 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P+ K+G I APL KVV+
Sbjct  252  TQTAATVLHSIFRE-KTTGASAYGVKKNIKSLKRKYMALVIGCPRRKKGQISAPLRKVVV  310

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  311  DDGKSDRITVDDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  370

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  HK   + P V  E T  +  +   P GLD+  G V SK P LHLH +
Sbjct  371  TPIVGDYKYGWQAHK--TREPLVSSENTPSK--QSSSPFGLDLDGGDVSSKQPHLHLHSK  426

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            ++ LPNI++ LE    S+ S   ++ S        L+F AP+PSHM++S+NL+
Sbjct  427  QIDLPNISQLLEKMEVSSDSDISDIGS--------LKFDAPLPSHMQLSFNLL  471



>ref|XP_009145786.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Brassica 
rapa]
Length=474

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 146/236 (62%), Gaps = 15/236 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + +LLH +  + K     +     + K   R+Y ALVIG P+ + G I APL KVV+
Sbjct  245  TQTAATLLHSIFRE-KTSGASAYGVKKNIKSLKRKYLALVIGCPRRQRGQISAPLRKVVV  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  304  DDGKSDRITVNVNGELVSTQHAITEYRVVESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPI+GDYKYGW  HK   + P V  E T  +P     P GLD++ G V SK P LHLH +
Sbjct  364  TPILGDYKYGWQAHK--TREPFVSPENTRTKPS--PSPFGLDMEGGDVSSKQPHLHLHSK  419

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDT-VSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI + LE            V  D+ +S  D L+F AP+P+HM++S+NL+ S
Sbjct  420  QIDLPNICQLLE---------KLEVSPDSDISDLDGLKFDAPLPTHMQLSFNLLKS  466



>gb|EYU42699.1| hypothetical protein MIMGU_mgv1a006097mg [Erythranthe guttata]
Length=457

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 149/239 (62%), Gaps = 18/239 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC---KVTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S ++LH V    ++K F   A ++ C   K+  ++YWALVIGSP+ +EGLI  PL K
Sbjct  232  TQLSTTILHSVF---REKTFG--ASNNVCGNKKILQKKYWALVIGSPRRREGLISVPLVK  286

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VVLDNGK+ER+ +A+N+   ++Q AVTEYRV+     G SW+EL P   RKHQLRVHCAE
Sbjct  287  VVLDNGKSERITVAENNNTLSAQHAVTEYRVIASSSRGYSWLELSPLTGRKHQLRVHCAE  346

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPE--GLDVQKGSVLSKVPLL  209
             LGTPIVGDYKYGW  HKK         +P  G+     + +   L+++ GS+  K   L
Sbjct  347  VLGTPIVGDYKYGWQAHKKLGHHLDSVSDPKWGDEISKVKNDTFALELESGSISDKQFRL  406

Query  208  HLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            HLHC+E+ LP+I + L+  S ++      +KS T+         A +P+HM+ SW+L+S
Sbjct  407  HLHCKEMSLPDITQALKYASINSDLDTAEMKSITLE--------ACLPAHMQRSWSLLS  457



>ref|XP_003576723.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Brachypodium 
distachyon]
Length=465

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 146/236 (62%), Gaps = 14/236 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S S+LH +     ++K      D + +V  R+Y ALVIG+P+  +GL+ APL+KV+L
Sbjct  240  TQLSASILHAIF----REKTADALADGTQQVLQRKYVALVIGTPRHSKGLLSAPLAKVLL  295

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +GK+ER+ +       + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  296  QDGKSERLTVKAGPNTTSVQDALTEYRVIESCPQGFTWLELFPLTGRKHQLRVHCAEVLG  355

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLHLHC  197
            TPIVGDYKYG   H+ W  +P    +    E  + RR P GL +  GSV+ + P LHLHC
Sbjct  356  TPIVGDYKYGRQAHQNWSPLPAP--QAIEEELLKKRRLPFGLVLGGGSVVEEQPQLHLHC  413

Query  196  RELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            +++VLP+I+  ++   + +  R++       S  + L FVAP+P HM++SW ++ S
Sbjct  414  KQMVLPDISAAVQGLQSEDADRDF-------SDLEKLSFVAPLPQHMRLSWEVLKS  462



>gb|KGN43882.1| hypothetical protein Csa_7G072200 [Cucumis sativus]
Length=311

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 148/239 (62%), Gaps = 21/239 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAW----DDSCKVTYRRYWALVIGSPKEKEGLICAPLS  566
            T  S SLLH V    ++K F++       D   K+  +RYWALVIGSP+  +GLI APL 
Sbjct  90   TSTSTSLLHSVF---REKTFEASKHANHVDSEKKILLKRYWALVIGSPRRSKGLITAPLG  146

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            K+VLD+G++E++++  N+     Q A+T+Y+V+    +G +W+EL P   RKHQLRVHCA
Sbjct  147  KIVLDDGRSEQIMVIDNAEPMPFQQAITQYKVIKSH-HGYTWLELCPLTGRKHQLRVHCA  205

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLH  206
            E LGTPIVGDYKYGW  HK WK     +     G+  +   P GLD + GS+    P LH
Sbjct  206  EVLGTPIVGDYKYGWQAHKNWKPFCS-NFHKNQGK--KQFLPFGLDFESGSIAENNPRLH  262

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC++L LP+++    LH++S       +  D  S+ + L   AP+PS+M+ SW++++S
Sbjct  263  LHCKQLTLPDVS--FALHNDS-------LDRD-CSRLECLELDAPLPSYMQKSWDIINS  311



>ref|XP_011092538.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Sesamum 
indicum]
Length=454

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 146/237 (62%), Gaps = 14/237 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKF-QSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVV  557
            T+ + ++LH   S  ++K F  S    DS K+  +RYWALVIGSP+ +EGLI  PL KVV
Sbjct  229  TQLTATILH---SIFREKTFGASDDVPDSKKILQKRYWALVIGSPRRREGLISVPLGKVV  285

Query  556  LDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEAL  377
            +DNGK+ER+ +   ++  ++Q AVTEYRV+     G +W+EL P   RKHQLRVHCAE L
Sbjct  286  IDNGKSERITVVDTTKTVSAQHAVTEYRVIASSPCGYTWLELLPLTGRKHQLRVHCAEVL  345

Query  376  GTPIVGDYKYGWFVHKKW--KQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHL  203
            GTPIVGDYKYGW  HK+   + +   D+              G D + GS+  K   LHL
Sbjct  346  GTPIVGDYKYGWQAHKRLGSRLVYASDLRWHNKISEVQHDTVGFDSEIGSISDKQLRLHL  405

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            HC+E++LPNI+  L+        RN     DT +  + ++ VAP+P+HM+ SW+L++
Sbjct  406  HCKEMILPNISLALQ-------HRNGISDLDTAAT-ESIKLVAPLPAHMQRSWDLLN  454



>ref|XP_008651548.1| PREDICTED: LOC100285271 isoform X1 [Zea mays]
Length=466

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 146/238 (61%), Gaps = 18/238 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S SL+H +     ++K      D + +V  R+Y ALVIG P+  +GL+ APL+KVVL
Sbjct  241  TQFSASLMHAIF----REKTADALGDGTQQVLQRKYVALVIGRPRHPKGLLSAPLAKVVL  296

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +G++ER+ +   S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  297  QDGRSERLTVCAGSNTASVQDALTEYRVIESFPQGYTWLELFPRTGRKHQLRVHCAEVLG  356

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR---PEGLDVQKGSVLSKVPLLHL  203
            TPIVGDYKYG   H+ W  +P     P T +   +++   P GL +  GSV  + P LHL
Sbjct  357  TPIVGDYKYGRQAHQNWMPLPM----PQTIDKEMLKKRKLPFGLTLGGGSVAEQQPQLHL  412

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            HC++++LP+I+  ++   +S+   ++       S  + L FVAP+P HM++SW ++ S
Sbjct  413  HCKQMILPDISAAMQQLRSSDADHDF-------SDLEKLSFVAPLPLHMQLSWKILLS  463



>ref|XP_009396599.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=469

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 156/243 (64%), Gaps = 22/243 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYR----RYWALVIGSPKEKEGLICAPLS  566
            T+ S ++LH +      ++  S A  D   VT R    +Y ALVIG+P+  +GLI APL+
Sbjct  243  TQTSATILHSLF-----REKTSGALADDINVTQRPLQRKYLALVIGTPRHSKGLISAPLA  297

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            K+VL++GK+ER+I+A + +  +SQ A+TEY+V+    +  +W+EL P   RKHQLRVHCA
Sbjct  298  KIVLEDGKSERIIIADDGKSASSQHALTEYKVIRSS-HDYTWLELFPLTGRKHQLRVHCA  356

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPY-RMRRPEGLDVQKGSVLSKVPLL  209
            E LGTPIVGD+KYG   H+KW+ M R+      GE   + + P GL++  GS+  K+P L
Sbjct  357  EVLGTPIVGDHKYGRHAHRKWEPM-RLPESIIKGEKIPKEKLPFGLELDGGSISEKLPGL  415

Query  208  HLHCRELVLPNIAKFL-ELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMS  32
            HLHC+++VLPNI+  L +L S+++            SK + L  VAP+PSHM+ SW ++S
Sbjct  416  HLHCKQMVLPNISVALQQLQSSTDHD---------FSKVEKLNLVAPLPSHMQRSWEILS  466

Query  31   SYL  23
            S L
Sbjct  467  SLL  469



>ref|XP_010691670.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 149/237 (63%), Gaps = 17/237 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S ++LH +  +      + +  D   K+  +RY ALV G PK+ +GLI  PL+KVVL
Sbjct  251  TQTSATILHSIFREKTIGISEDREIDWGKKILQKRYLALVFGVPKQSKGLISVPLAKVVL  310

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            ++GK+ER+ ++ ++   +SQ AVTEYRV+   + G +W+EL P   RKHQLRVHCAE L 
Sbjct  311  NDGKSERITISDSA--SSSQHAVTEYRVIATSVYGYTWLELCPVTGRKHQLRVHCAEVLR  368

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKYGW  H++W+ +     +P+  E     +  P G+  + GS+  K P LHLH
Sbjct  369  TPIVGDYKYGWQAHRRWEPL-----QPSPNEQSGETKLHPLGIGPECGSISEKQPHLHLH  423

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            C+++VLPNI+  LE  S  +    Y+      SK + L  VAP+PSHM+ SWNL++S
Sbjct  424  CKQMVLPNISTILEQISLDS---EYD-----FSKLESLNLVAPLPSHMQRSWNLLNS  472



>ref|XP_004956276.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Setaria 
italica]
Length=465

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 145/238 (61%), Gaps = 18/238 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S S++H +     ++K      D + +V  R+Y ALVIG P+  +GL+ APL+K+VL
Sbjct  240  TQLSASIMHAIF----REKTADALADGTQQVLQRKYVALVIGRPRHPKGLLSAPLAKIVL  295

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +GK+ER+ +   S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  296  QDGKSERLTVCAGSNPASVQDALTEYRVIESCPQGYTWLELFPRTGRKHQLRVHCAEVLG  355

Query  373  TPIVGDYKYGWFVHKKWKQMP---RVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHL  203
            TPIVGDYKYG   H+ W  +P    +D+E       + + P GL +  GSV    P LHL
Sbjct  356  TPIVGDYKYGRQAHQNWMPLPIPQAMDVEMLK----KRKLPFGLALGGGSVAEDQPQLHL  411

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            HC++++LP+I+  ++   +S  + N+       S  + L FVAP+P HM++SW ++ S
Sbjct  412  HCKQMILPDISAAMQRLQSSESNHNF-------SDLEKLSFVAPLPLHMRLSWEILKS  462



>ref|XP_008454996.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Cucumis 
melo]
Length=471

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 144/239 (60%), Gaps = 21/239 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAW----DDSCKVTYRRYWALVIGSPKEKEGLICAPLS  566
            T  S SLLH V    ++K F +       D   K+  +RYWALVIGSP+  +GLI APL 
Sbjct  250  TSTSTSLLHSVF---REKTFDASKHANHVDSEKKILLKRYWALVIGSPRRSKGLITAPLG  306

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            K+VLD+G++ER+++  N+     Q A+T Y+V+    +G +W+EL P   RKHQLRVHCA
Sbjct  307  KIVLDDGRSERIMVIDNAEPMPFQQAITRYKVIKSH-HGYTWLELCPLTGRKHQLRVHCA  365

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLH  206
            E LGTPIVGDYKYGW  HK WK     +     G+  +   P GLD + GS+    P LH
Sbjct  366  EVLGTPIVGDYKYGWQAHKNWKPF-HYNFHKNQGK--KQFLPFGLDFESGSIAETNPRLH  422

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC++L LP+++    LH++S             S+ + L   AP+PS+M+ SW++++S
Sbjct  423  LHCKQLTLPDVS--FALHNDS--------LDQDCSRLECLELDAPLPSYMQKSWDIINS  471



>gb|EEE69173.1| hypothetical protein OsJ_28343 [Oryza sativa Japonica Group]
Length=465

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 149/238 (63%), Gaps = 18/238 (8%)
 Frame = -2

Query  724  SISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNG  545
            S S+LH +     ++K      D +  V  R+Y ALVIG+P+  +GL+ APL+K++L +G
Sbjct  243  STSMLHAIF----REKTADALADGTQHVLQRKYVALVIGTPRHPKGLLSAPLAKILLQDG  298

Query  544  KTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPI  365
            K+ER+ +  +S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LGTPI
Sbjct  299  KSERLTIRASSNAASVQDALTEYRVIESCPQGYTWLELFPRTGRKHQLRVHCAEVLGTPI  358

Query  364  VGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR---PEGLDVQKGSVLSKVPLLHLHCR  194
            VGDYKYG   H+KW  +P     P T +   +R+   P GL V  GS+  + P LHLHC+
Sbjct  359  VGDYKYGRQAHQKWMPLPL----PRTIDEELLRKRKLPFGLVVGGGSIAEEQPQLHLHCK  414

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ++VLP+++  + LH    R ++ +V  D  S  + L FVAP+P HM++SW ++ S  I
Sbjct  415  QMVLPDVS--VALH----RLQSSDVNPD-FSDLEKLNFVAPLPLHMRLSWEILKSVKI  465



>gb|EEC84066.1| hypothetical protein OsI_30347 [Oryza sativa Indica Group]
Length=465

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 149/238 (63%), Gaps = 18/238 (8%)
 Frame = -2

Query  724  SISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNG  545
            S S+LH +     ++K      D +  V  R+Y ALVIG+P+  +GL+ APL+K++L +G
Sbjct  243  STSMLHAIF----REKTADALADGTQHVLQRKYVALVIGTPRHPKGLLSAPLAKILLQDG  298

Query  544  KTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPI  365
            K+ER+ +  +S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LGTPI
Sbjct  299  KSERLTVRASSNAASVQDALTEYRVIESCPQGYTWLELFPRTGRKHQLRVHCAEVLGTPI  358

Query  364  VGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR---PEGLDVQKGSVLSKVPLLHLHCR  194
            VGDYKYG   H+KW  +P     P T +   +R+   P GL V  GS+  + P LHLHC+
Sbjct  359  VGDYKYGRQAHQKWMPLPL----PRTIDEELLRKRKLPFGLVVGGGSIAEEQPQLHLHCK  414

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            ++VLP+++  + LH    R ++ +V  D  S  + L FVAP+P HM++SW ++ S  I
Sbjct  415  QMVLPDVS--VALH----RLQSSDVNPD-FSDLEKLNFVAPLPLHMRLSWEILKSVKI  465



>ref|XP_004954753.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like, 
partial [Setaria italica]
Length=509

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 145/238 (61%), Gaps = 18/238 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S S++H +     ++K      D + +V  R+Y ALVIG P+  +GL+ APL+K+VL
Sbjct  284  TQLSASIMHAIF----REKTADALADGTQQVLQRKYVALVIGRPRHSKGLLSAPLAKIVL  339

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +GK+ER+ +   S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  340  QDGKSERLTVCAGSNPASVQDALTEYRVIESCPQGYTWLELFPRTGRKHQLRVHCAEVLG  399

Query  373  TPIVGDYKYGWFVHKKWKQMP---RVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHL  203
            TPIVGDYKYG   H+ W  +P    +D+E       + + P GL +  GSV    P LHL
Sbjct  400  TPIVGDYKYGRQAHQNWMPLPIPQAMDVEMLK----KRKLPFGLALGGGSVAEDQPQLHL  455

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            HC++++LP+I+  ++   +S  + N+       S  + L FVAP+P HM++SW ++ S
Sbjct  456  HCKQMILPDISAAMQRLQSSESNHNF-------SDLEKLSFVAPLPLHMRLSWEILKS  506



>ref|XP_006297582.1| hypothetical protein CARUB_v10013603mg [Capsella rubella]
 gb|EOA30480.1| hypothetical protein CARUB_v10013603mg [Capsella rubella]
Length=476

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P+ + G I APL KVV+
Sbjct  247  TQTAATVLHSIFRE-KTSGASAYGVKKNIKSLKRKYMALVIGCPRRQRGQISAPLRKVVV  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  306  DDGKSDRITVNDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  365

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  HK   + P V  E T  +P     P GLD+  G V SK P LHLH +
Sbjct  366  TPIVGDYKYGWQAHK--SREPLVTSENTPTKP--QSSPFGLDLDGGDVSSKQPHLHLHSK  421

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE        +        +S  D L+F AP+P+HM++S+NL+ S
Sbjct  422  QIDLPNISQLLE--------KMQVSSDSDISDIDSLKFDAPLPTHMQLSFNLLKS  468



>ref|XP_004137095.1| PREDICTED: RNA pseudourine synthase 4, mitochondrial-like [Cucumis 
sativus]
Length=466

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 148/239 (62%), Gaps = 21/239 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAW----DDSCKVTYRRYWALVIGSPKEKEGLICAPLS  566
            T  S SLLH V    ++K F++       D   K+  +RYWALVIGSP+  +GLI APL 
Sbjct  245  TSTSTSLLHSVF---REKTFEASKHANHVDSEKKILLKRYWALVIGSPRRSKGLITAPLG  301

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            K+VLD+G++E++++  N+     Q A+T+Y+V+    +G +W+EL P   RKHQLRVHCA
Sbjct  302  KIVLDDGRSEQIMVIDNAEPMPFQQAITQYKVIKSH-HGYTWLELCPLTGRKHQLRVHCA  360

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLH  206
            E LGTPIVGDYKYGW  HK WK     +     G+  +   P GLD + GS+    P LH
Sbjct  361  EVLGTPIVGDYKYGWQAHKNWKPFCS-NFHKNQGK--KQFLPFGLDFESGSIAENNPRLH  417

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC++L LP+++    LH++S       +  D  S+ + L   AP+PS+M+ SW++++S
Sbjct  418  LHCKQLTLPDVS--FALHNDS-------LDRD-CSRLECLELDAPLPSYMQKSWDIINS  466



>ref|XP_004305959.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=476

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 149/244 (61%), Gaps = 25/244 (10%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK----VTYRRYWALVIGSPKEKEGLICAPLS  566
            T+ S ++LH V    ++K F   A DD  K    +  RRY ALVIGSP+++EGLI  PL 
Sbjct  239  TQTSATVLHSVF---REKTFG--ASDDVIKHAKSILQRRYLALVIGSPRQQEGLISVPLG  293

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            KVV+DNGK++R+ +   ++   SQ A+T+Y+V+G    G +W+EL P   RKHQLRVHCA
Sbjct  294  KVVVDNGKSDRITILNKAQCLPSQHAITKYKVIGSSCPGFTWLELIPLTGRKHQLRVHCA  353

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPL  212
            E LGTPIVGDYKYGW  HK WK +     E  + E    R+  P  L++  GS+  K   
Sbjct  354  EVLGTPIVGDYKYGWRTHKDWKPVAWSKTECHSNEERSKRKNLPFDLNMDSGSIDEKNLR  413

Query  211  LHLHCRELVLPNIAKFLE---LHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWN  41
            LHLH +++VLPN++  L+   LH+  +           +S  + +  VAPMPS+M+ SW+
Sbjct  414  LHLHSKQMVLPNVSLALQNVKLHAECD-----------LSGLESIELVAPMPSYMQKSWD  462

Query  40   LMSS  29
            + +S
Sbjct  463  ITNS  466



>gb|EMT04250.1| RNA pseudourine synthase 4, mitochondrial [Aegilops tauschii]
Length=468

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 145/237 (61%), Gaps = 16/237 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S S+LH +     ++K      D + +V  R+Y ALV+G+P+  +GL+ APL+KV+L
Sbjct  243  TQLSASILHAIF----REKTADALADGTQQVLQRKYVALVMGTPRHPKGLLSAPLAKVLL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +GK+ER+ +       + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  299  QDGKSERLTVRAGPNTTSVQDALTEYRVIESCPRGFTWLELFPLTGRKHQLRVHCAEVLG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPY--RMRRPEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKYG   H+ W  +P   +  T  E    + R P GL +  GSV  + P LHLH
Sbjct  359  TPIVGDYKYGRQAHQDWTPLP---VPQTVDEELLRKQRLPFGLVLGGGSVAEEQPQLHLH  415

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            C++++LP+I+  ++   + +  R++       S  + L FVAP+P HM++SW ++ S
Sbjct  416  CKQMMLPDISAAVQGLQSEDAERDF-------SGLEKLSFVAPLPLHMRLSWEVLKS  465



>ref|XP_004170490.1| PREDICTED: RNA pseudourine synthase 4, mitochondrial-like [Cucumis 
sativus]
Length=471

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 147/239 (62%), Gaps = 21/239 (9%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAW----DDSCKVTYRRYWALVIGSPKEKEGLICAPLS  566
            T  S SLLH V    ++K F++       D   K+  +RYWALVIGSP+  +GLI APL 
Sbjct  250  TSTSTSLLHSVF---REKTFEASKHANHVDSEKKILLKRYWALVIGSPRRSKGLITAPLG  306

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCA  386
            K+VLD+G++E++++  N+     Q A+T+Y+V+    +G +W+EL P   RKHQLRVHCA
Sbjct  307  KIVLDDGRSEQIMVIDNAEPMPFQQAITQYKVIKSH-HGYTWLELCPLTGRKHQLRVHCA  365

Query  385  EALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLH  206
            E LGTPIVGDYKYGW  HK WK     +     G+   +  P GLD + GS+    P LH
Sbjct  366  EVLGTPIVGDYKYGWQAHKNWKPFCS-NFHKNQGKKQFL--PFGLDFESGSIAENSPRLH  422

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            LHC++L LP+++    LH++S       +  D  S+ + L   AP+PS+M+ SW++++ 
Sbjct  423  LHCKQLTLPDVS--FALHNDS-------LDRD-CSRLECLELDAPLPSYMQKSWDIING  471



>gb|EMS51241.1| RNA pseudourine synthase 4, mitochondrial [Triticum urartu]
Length=468

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 144/237 (61%), Gaps = 16/237 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S S+LH +     ++K      D + +V  R+Y ALV+G+P+  +GL+ APL+KV+L
Sbjct  243  TQLSASILHAIF----REKTADALADGTQQVLQRKYVALVMGTPRHPKGLLSAPLAKVLL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +GK+ER+ +       + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  299  QDGKSERLTVRAGPNTTSVQDALTEYRVIESCPRGFTWLELFPLTGRKHQLRVHCAEVLG  358

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPY--RMRRPEGLDVQKGSVLSKVPLLHLH  200
            TPIVGDYKYG   H+ W  +P   +  T  E    + R P GL +  GSV  + P LHLH
Sbjct  359  TPIVGDYKYGRQAHQDWTPLP---VPQTVDEELLRKQRLPFGLVLGGGSVAEEQPQLHLH  415

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            C++++LP+I+   +   + +  R++       S  + L FVAP+P HM++SW ++ S
Sbjct  416  CKQMMLPDISTAFQGLQSEDAERDF-------SGLEKLSFVAPLPLHMRLSWEVLKS  465



>emb|CDY46174.1| BnaA05g20610D [Brassica napus]
Length=474

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 145/235 (62%), Gaps = 13/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + +LLH +  + K     +     + K   R+Y ALVIG P+ + G I APL KVV+
Sbjct  245  TQTAATLLHSIFRE-KTSGASAYGVKKNIKSLKRKYLALVIGCPRRQRGQISAPLRKVVV  303

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  304  DDGKSDRITVNDNGELVSTQHAITEYRVVESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  363

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPI+GDYKYGW  HK   + P V  E T  +P     P GLD++ G V SK P LHLH +
Sbjct  364  TPILGDYKYGWQAHK--TREPFVSPENTQTKPSSS--PFGLDMEGGDVSSKQPHLHLHSK  419

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI + LE    S+ S   ++          L+F AP+P+HM++S+NL+ S
Sbjct  420  QIDLPNICQLLEKLEVSSDSDISDLDG--------LKFDAPLPTHMQLSFNLLKS  466



>dbj|BAK06727.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=472

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 145/238 (61%), Gaps = 18/238 (8%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S S+LH +     ++K      D + +V  R+Y ALV+G+P+  +GL+ APL+KV+L
Sbjct  247  TQLSASILHAIF----REKTADALADGTQQVLQRKYVALVMGTPRHPKGLLSAPLAKVLL  302

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +GK+ER+ +       + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  303  QDGKSERLTVRAGPNTTSVQDALTEYRVIESCPQGFTWLELFPLTGRKHQLRVHCAEVLG  362

Query  373  TPIVGDYKYGWFVHKKWKQMP---RVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHL  203
            TPIVGDYKYG   H+ W  +P    VD E       + R P GL +  GS+  + P LHL
Sbjct  363  TPIVGDYKYGRQAHQDWTPLPVSQTVDKELL----RKQRLPFGLVLGGGSIAEQQPQLHL  418

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            HC++++LP+I+  ++   + +  R++       S  + L FVAP+P HM++SW ++ S
Sbjct  419  HCKQMMLPDISAAVQGLQSEDADRDF-------SDLEKLSFVAPLPLHMRLSWEVLKS  469



>ref|NP_188575.1| RNA pseudourine synthase 4 [Arabidopsis thaliana]
 sp|Q9LT72.1|PUS4_ARATH RecName: Full=RNA pseudouridine synthase 4, mitochondrial; AltName: 
Full=RNA pseudouridylate synthase 4; AltName: Full=RNA-uridine 
isomerase 4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02469.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF00800.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABO45695.1| At3g19440 [Arabidopsis thaliana]
 gb|AEE76240.1| RNA pseudourine synthase 4 [Arabidopsis thaliana]
Length=477

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 141/235 (60%), Gaps = 13/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P  + G I APL KVV+
Sbjct  248  TQTAATVLHSIFRE-KTTGASAYGVKKNVKSLKRKYMALVIGCPPRQRGQISAPLRKVVV  306

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK+ER+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  307  DDGKSERITVNDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  366

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  HK  +     +  PT     +   P GLD+  G V SK P LHLH +
Sbjct  367  TPIVGDYKYGWQAHKAREPFVSSENNPTK----QSSSPFGLDLDGGDVSSKQPHLHLHSK  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE        +        +S  D L+F AP+PSHM++S+NL+ S
Sbjct  423  QIDLPNISQLLE--------KMQVSSDSDISDLDSLKFDAPLPSHMQLSFNLLKS  469



>ref|XP_006406501.1| hypothetical protein EUTSA_v10020633mg [Eutrema salsugineum]
 gb|ESQ47954.1| hypothetical protein EUTSA_v10020633mg [Eutrema salsugineum]
Length=477

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     + +   + K   R+Y ALVIG P+ + G I APL KVV+
Sbjct  248  TQTAATVLHSIFRE-KTSGASAYSVKKNIKSLKRKYLALVIGCPRRQRGQISAPLRKVVV  306

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  307  DDGKSDRITVNDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  366

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPI+GDYKYGW  HK   + P V    T  +P     P GLD+  G V SK P LHLH +
Sbjct  367  TPILGDYKYGWQAHK--SREPFVSSGNTPTKPS--LSPFGLDLDGGDVSSKQPHLHLHSK  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE        +         S+ D L+F AP+P+HM++S+NL+ S
Sbjct  423  QIDLPNISQLLE--------QLEVSSDSDSSEHDCLKFDAPLPAHMQLSFNLLKS  469



>ref|XP_002883182.1| pseudouridine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59441.1| pseudouridine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 148/237 (62%), Gaps = 17/237 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWD--DSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ + ++LH +    ++K   + A+    + K   R+Y ALVIG P+ ++G I APL KV
Sbjct  248  TQTAATVLHSIF---REKTCGASAYGVKKNIKSLKRKYMALVIGCPRRQKGQISAPLRKV  304

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEA  380
            V+D+GK++R+ +  N  L ++Q A+TEY+V+    +G +W+ELRP   RKHQLRVHCAE 
Sbjct  305  VVDDGKSDRITVNDNGELVSTQHAITEYKVIESSPHGYTWLELRPLTGRKHQLRVHCAEV  364

Query  379  LGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLH  200
            LGTPI+GDYKYGW  HK   + P V  E T  +P     P GLD+  G V SK P LHLH
Sbjct  365  LGTPILGDYKYGWQAHK--AREPFVSSETTPTKPS--SSPFGLDLDGGDVSSKQPHLHLH  420

Query  199  CRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
             +++ LPNI++ LE        +        +S  D L+F AP+PSHM++S+NL+ S
Sbjct  421  SKQIDLPNISQLLE--------KMQVSSDSDISDLDSLKFDAPLPSHMQLSFNLLKS  469



>ref|XP_006651552.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Oryza 
brachyantha]
Length=447

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 144/241 (60%), Gaps = 27/241 (11%)
 Frame = -2

Query  730  EESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLD  551
            + S ++LH       ++K      D +  V  R+Y ALVIG+P+  +GL+ APL+KV+L 
Sbjct  224  QRSTTMLHATF----REKTADALADGTQHVLQRKYLALVIGTPRHPKGLLSAPLAKVLLQ  279

Query  550  NGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGT  371
            +GK+ER+ +  +S   + QDA+TEYRV+    +G +W+EL P   RKHQLRVHCAE LGT
Sbjct  280  DGKSERLTVRASSNAASVQDALTEYRVIEYCPHGYTWLELFPRTGRKHQLRVHCAEVLGT  339

Query  370  PIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR--PEGLDVQKGSVLSKVPLLHLHC  197
            PIVGDYKYG   H+ W  +P   +  T  E    +R  P GL V  GS+  + P LHLHC
Sbjct  340  PIVGDYKYGRQAHQNWMPLP---LPRTINEELLRKRKLPFGLVVGGGSIAEEQPQLHLHC  396

Query  196  RELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL-----LRFVAPMPSHMKISWNLMS  32
            +++VLP+I+  +           + ++SD    PD      L FVAP+P HM++SW ++ 
Sbjct  397  KQMVLPDISVAV-----------HRLQSDV--DPDFSDLEKLNFVAPLPLHMRLSWEILK  443

Query  31   S  29
            S
Sbjct  444  S  444



>gb|KHG26351.1| hypothetical protein F383_00972 [Gossypium arboreum]
Length=505

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 148/266 (56%), Gaps = 42/266 (16%)
 Frame = -2

Query  733  TEESISLLHLVLSD--LKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S ++LH V  +  L   K  S   D+  +V  +RYWALVIGSP+  +G I APL KV
Sbjct  251  TQMSAAILHSVFREETLGASKHDS---DNEKRVLQKRYWALVIGSPRRPKGTISAPLQKV  307

Query  559  VLDNGKTERV-ILAQNSRLEASQDAVTEYRV--------------------------LGP  461
            V+D+GK++R+ +   N  + +SQ A+TEYRV                          L  
Sbjct  308  VVDDGKSDRITVFEHNKTILSSQRAITEYRVIKTSTHGNIIVTLVSKSDFGIAYPLMLSD  367

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE  281
            +  G +W+EL P   RKHQLRVHCAE LGTPIVGDYKYGW  H++ + +   D+   + E
Sbjct  368  LNAGFTWLELSPLTGRKHQLRVHCAEVLGTPIVGDYKYGWQAHRRLQNLAESDLRKNSNE  427

Query  280  PYRMRR--PEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT  107
                    P GL++  GS+  K   LHLHCRE++L N+++ L+           +   D 
Sbjct  428  KVAKENMLPFGLNMDSGSISEKQLRLHLHCREMILLNVSQVLQ--------NPKSFTDDD  479

Query  106  VSKPDLLRFVAPMPSHMKISWNLMSS  29
            +SK   L  VAP+PS+M+ SW++++S
Sbjct  480  LSKLKSLEIVAPLPSYMQKSWDILNS  505



>ref|XP_010538615.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial [Tarenaya 
hassleriana]
Length=469

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 142/236 (60%), Gaps = 13/236 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S +LLH V  + K           + +   R+YWALVIG P+   GLI APL KVV+
Sbjct  242  TQTSAALLHSVFRE-KTSSVSVYGVGKNRRTLKRKYWALVIGRPRRPRGLISAPLRKVVV  300

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  +  L +SQ A+TE+RVL    +G SW+EL P   RKHQLRVHCAE LG
Sbjct  301  DDGKSDRITVHGDGELMSSQHAITEFRVLESSSHGYSWLELCPLTGRKHQLRVHCAEVLG  360

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLHLHC  197
            TPI+GD KYGW  H+  K +      P + E    +  P GL+++ G + SK P LHLH 
Sbjct  361  TPILGDLKYGWQSHRTRKHLSS---SPESSEKTAAKMFPFGLNLEGGDISSKQPHLHLHS  417

Query  196  RELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            +E+VLP+I++ LE     +      +KS        L+F AP+P+HM+IS +++ S
Sbjct  418  KEIVLPDISELLEKLEVCSDYDPSGLKS--------LKFDAPLPTHMQISRDILKS  465



>emb|CDX99223.1| BnaC05g33380D [Brassica napus]
Length=477

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/235 (43%), Positives = 143/235 (61%), Gaps = 14/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + +LLH +  + K     +     + K   R+Y ALVIG P+ + G I APL K+V+
Sbjct  249  TQTAATLLHSIFRE-KTSGASAYGVKKNIKSLKRKYLALVIGCPRRQRGQISAPLRKLVV  307

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQLRVHCAE LG
Sbjct  308  DDGKSDRITVNDNGELVSTQHAITEYRVVESSPHGYTWLELRPLTGRKHQLRVHCAEVLG  367

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPI+GDYKYGW  HK   + P V  E T     +   P GLD++ G V SK P LHLH +
Sbjct  368  TPILGDYKYGWQAHK--TREPFVSPENTR---TKTSSPFGLDMEGGDVSSKQPHLHLHSK  422

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI + LE        +        +S  D L+F AP+P+HM++S+NL+ S
Sbjct  423  QIDLPNICQLLE--------KLEVSSDSDISDLDSLKFDAPLPTHMQLSFNLLKS  469



>gb|KFK39271.1| hypothetical protein AALP_AA3G222700 [Arabis alpina]
Length=474

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 141/235 (60%), Gaps = 10/235 (4%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P+ + G I APL KVV+
Sbjct  243  TQTAATVLHSIFRE-KTTGASAYGVKKNIKSLKRKYLALVIGCPRRQRGQISAPLRKVVV  301

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G SW+ELRP   RKHQLRVHCAE LG
Sbjct  302  DDGKSDRITVNDNGELVSTQHAITEYRVIESSPHGYSWLELRPLTGRKHQLRVHCAEVLG  361

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPI+GDYKYGW  HK  +        PT         P GLD++ G V SK P LHLH +
Sbjct  362  TPILGDYKYGWQSHKSREPFVSSANTPTKPS-PSPSSPFGLDLEGGDVSSKQPHLHLHSK  420

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE        +        +S  D L+F AP+P+HM++S+NL+ S
Sbjct  421  QIDLPNISQLLE--------KMQVSSDSDLSDLDSLKFDAPLPTHMQLSFNLLKS  467



>ref|XP_001759658.1| predicted protein [Physcomitrella patens]
 gb|EDQ75570.1| predicted protein, partial [Physcomitrella patens]
Length=283

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 120/200 (60%), Gaps = 11/200 (6%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP-M  458
            R Y ALVIG P++KEG I APL+KVV D+GK +++ +   S   A Q+A+T+Y+VLG  +
Sbjct  85   RCYLALVIGVPEKKEGRISAPLAKVVSDSGKLDKMRVVHGSHPNA-QEAITDYKVLGSSL  143

Query  457  INGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEP  278
              GCSW+ELRP   RKHQ+RVHCAE LG PIVGDYKYGW   + W    R   E T    
Sbjct  144  FAGCSWLELRPLTGRKHQIRVHCAEVLGMPIVGDYKYGWRALRLWPPTDRT--EDTKSSV  201

Query  277  YRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSK  98
              +R       + G V S  P LHLHCR+L+LP++A+  +  S    S     +      
Sbjct  202  LGLR-------ESGHVWSSKPYLHLHCRQLILPDVAQAFKSQSRERSSAQTGARVSGSQF  254

Query  97   PDLLRFVAPMPSHMKISWNL  38
             + L  +AP+P HM +SWN+
Sbjct  255  AEPLEIIAPLPPHMVVSWNM  274



>ref|XP_010065966.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW63695.1| hypothetical protein EUGRSUZ_G01349 [Eucalyptus grandis]
Length=473

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 143/237 (60%), Gaps = 17/237 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC---KVTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S + LH     L ++K      +DS    ++  R+YWALVIGSP+  +G+I APL K
Sbjct  249  TKTSATFLH----SLFREKTVGALNNDSASRKRLLQRKYWALVIGSPRRSKGVISAPLGK  304

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            V++DNGK++R+ +   S+   S  A+TEY V+    +G +W++L P   RKHQLRVHCAE
Sbjct  305  VLMDNGKSDRITIINGSQTIPSYHAITEYEVIESR-HGYTWLQLSPLTGRKHQLRVHCAE  363

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLH  206
            ALGTPIVGDYKYGW  H+ +K     + E +     + R  P GLD+  GS+  + P LH
Sbjct  364  ALGTPIVGDYKYGWQAHRNFKNWQVSNSEESFSRKLKGRALPFGLDLDNGSISDEQPRLH  423

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            LH  +++LPNIA  L+   N   S  Y+     +S+ + L  VAP+P +M+ S + +
Sbjct  424  LHSNQVLLPNIALALQ---NMQLSSGYD-----LSELETLELVAPLPPYMQKSLDFL  472



>ref|XP_002985813.1| hypothetical protein SELMODRAFT_123269 [Selaginella moellendorffii]
 gb|EFJ12990.1| hypothetical protein SELMODRAFT_123269 [Selaginella moellendorffii]
Length=355

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 122/197 (62%), Gaps = 20/197 (10%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            R+Y ALVIGSP   +G I APL K+VL++GK++RV++A + + E +  A+TEY+VL   +
Sbjct  137  RKYIALVIGSPTADKGFISAPLLKMVLEDGKSDRVLIAADPKSENAIPAITEYQVLKRSV  196

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPY  275
             GC+W++LRP   RKHQLRVHCA+ LG PIVGD KYG+  HKKW  M   ++     +  
Sbjct  197  LGCTWLQLRPLTGRKHQLRVHCAQGLGLPIVGDMKYGFNTHKKW--MAERNMNTVDPQDI  254

Query  274  RMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKP  95
            + R     +   GSV+SK PLLHLH REL +P             R R      D    P
Sbjct  255  KAR-----NKMAGSVVSKNPLLHLHSRELTIP-------------RLRKKPGAVDFGLDP  296

Query  94   DLLRFVAPMPSHMKISW  44
            + +RFVAP+P+HM+ SW
Sbjct  297  ERMRFVAPLPTHMESSW  313



>ref|XP_002984751.1| hypothetical protein SELMODRAFT_121195 [Selaginella moellendorffii]
 gb|EFJ14001.1| hypothetical protein SELMODRAFT_121195 [Selaginella moellendorffii]
Length=355

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 122/197 (62%), Gaps = 20/197 (10%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            R+Y ALVIGSP   +G I APL K+VL++GK++RV++A + + E +  A+TEY+VL   +
Sbjct  137  RKYIALVIGSPTADKGFISAPLLKMVLEDGKSDRVLIAADPKSENAIPAITEYQVLKRSV  196

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPY  275
             GC+W++LRP   RKHQLRVHCA+ LG PIVGD KYG+  HKKW  M   ++     +  
Sbjct  197  LGCTWLQLRPLTGRKHQLRVHCAQGLGLPIVGDMKYGFNTHKKW--MAERNMNTVDPQDI  254

Query  274  RMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKP  95
            + R     +   GSV+SK PLLHLH REL +P             R R      D    P
Sbjct  255  KAR-----NKMAGSVVSKNPLLHLHSRELTIP-------------RLRKKPGAVDFGLDP  296

Query  94   DLLRFVAPMPSHMKISW  44
            + +RFVAP+P+HM+ SW
Sbjct  297  ERMRFVAPLPTHMESSW  313



>ref|XP_010507750.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X2 [Camelina sativa]
Length=481

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 141/235 (60%), Gaps = 14/235 (6%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ + ++LH +  + K     +     + K   R+Y ALVIG P+ K+G I APL KVV+
Sbjct  252  TQTAATVLHSIFRE-KTTGASAYGVKKNIKSLKRKYIALVIGCPRRKKGQISAPLRKVVV  310

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
            D+GK++R+ +  N  L ++Q A+TEYRV+    +G +W+ELRP   RKHQ+     + LG
Sbjct  311  DDGKSDRITVDDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQV-FGTFKVLG  369

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCR  194
            TPIVGDYKYGW  HK  + +   +  PT     +   P GLD+  G V SK P LHLH +
Sbjct  370  TPIVGDYKYGWQAHKTREPLVSSENTPTK----QSSSPFGLDLDGGDVSSKQPHLHLHSK  425

Query  193  ELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            ++ LPNI++ LE    S+ S   ++ S        L+F AP+PSHM++S+NL+ S
Sbjct  426  QIDLPNISQLLEKMEVSSDSDISDIGS--------LKFDAPLPSHMQLSFNLLKS  472



>ref|NP_001151637.1| LOC100285271 [Zea mays]
 gb|ACG43607.1| RNA binding protein [Zea mays]
Length=439

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 130/208 (63%), Gaps = 11/208 (5%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S SL+H +     ++K      D + +V  R+Y ALVIG P+  +GL+ APL+KVVL
Sbjct  237  TQFSASLMHAIF----REKTADALGDGTQQVLQRKYVALVIGRPRHPKGLLSAPLAKVVL  292

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALG  374
             +G++ER+ +   S   + QDA+TEYRV+     G +W+EL P   RKHQLRVHCAE LG
Sbjct  293  QDGRSERLTVCAGSNTASVQDALTEYRVIESFPQGYTWLELFPRTGRKHQLRVHCAEVLG  352

Query  373  TPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR---PEGLDVQKGSVLSKVPLLHL  203
            TPIVGDYKYG   H+ W  +P     P T +   +++   P GL +  GSV  + P LHL
Sbjct  353  TPIVGDYKYGRQAHQNWMPLPM----PQTIDKEMLKKRKLPFGLTLGGGSVAEQQPQLHL  408

Query  202  HCRELVLPNIAKFLELHSNSNRSRNYNV  119
            HC++++LP+I+  ++   +S+   ++++
Sbjct  409  HCKQMILPDISAAMQQLRSSDADHDFSI  436



>ref|XP_010024063.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW60478.1| hypothetical protein EUGRSUZ_H03207 [Eucalyptus grandis]
Length=473

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 142/237 (60%), Gaps = 17/237 (7%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSC---KVTYRRYWALVIGSPKEKEGLICAPLSK  563
            T+ S + LH     L ++K      +DS    ++  R+YWALVIGSP+  +G+I APL K
Sbjct  249  TQTSATFLH----SLFREKTVGALNNDSASRKRLLQRKYWALVIGSPRRSKGVISAPLGK  304

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            V++DNGK++R+ +    +   S  A+TEY V+    +G +W++L P   RKHQLRVHCAE
Sbjct  305  VLMDNGKSDRITIINGRQTIPSYHAITEYEVIESR-HGYTWLQLSPLTGRKHQLRVHCAE  363

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR-PEGLDVQKGSVLSKVPLLH  206
            ALGTPIVGDYKYGW  H+ +K     + E +     + R  P GLD+  GS+  + P LH
Sbjct  364  ALGTPIVGDYKYGWQAHRNFKNWQVSNSEESFSRKLKGRALPFGLDLDNGSISDERPRLH  423

Query  205  LHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            LH  +++LPNIA  L+   N   S  Y+     +S+ + L  VAP+P +M+ S + +
Sbjct  424  LHSNQVLLPNIALALQ---NMQLSSGYD-----LSELETLELVAPLPPYMQKSLDFL  472



>ref|XP_010693154.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010693155.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=123

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES S L  +  ++   K    AW+DSC+ T+ RYWALV+GSP+EKEG+ICAPL+KV+L
Sbjct  4    TKESASYLQHLFININVAKTSCLAWNDSCEATFTRYWALVVGSPREKEGVICAPLTKVLL  63

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHC  389
            D+GKTERV+LA  S LE SQ+A+TEYRVLGPMINGCSWIELRP  SRKHQ    C
Sbjct  64   DDGKTERVMLAHPSGLEDSQEAMTEYRVLGPMINGCSWIELRPLTSRKHQEECIC  118



>gb|KJB56431.1| hypothetical protein B456_009G119600 [Gossypium raimondii]
Length=370

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ LH + +D+   K   +AW+D+C   ++RYWALVIG+PKE EGLI +PLSK++L
Sbjct  239  TKESINHLHWLFNDINPAKSSCKAWNDACDAKFQRYWALVIGTPKENEGLIRSPLSKILL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQL  401
            D+GKTERVILAQN  LE SQ+AVTEYRVLGPMINGCSW+ELRP  SRKHQ+
Sbjct  299  DDGKTERVILAQNVGLEPSQEAVTEYRVLGPMINGCSWVELRPLTSRKHQV  349



>gb|KJB56432.1| hypothetical protein B456_009G119600 [Gossypium raimondii]
Length=350

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESI+ LH + +D+   K   +AW+D+C   ++RYWALVIG+PKE EGLI +PLSK++L
Sbjct  239  TKESINHLHWLFNDINPAKSSCKAWNDACDAKFQRYWALVIGTPKENEGLIRSPLSKILL  298

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQ  404
            D+GKTERVILAQN  LE SQ+AVTEYRVLGPMINGCSW+ELRP  SRKHQ
Sbjct  299  DDGKTERVILAQNVGLEPSQEAVTEYRVLGPMINGCSWVELRPLTSRKHQ  348



>ref|XP_010695900.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=136

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES S L  +   +   K    AW+D+C  T+ RYWALV+GSP+EKEG+ICAPL+KV+L
Sbjct  4    TKESASYLQQLFIIINVAKTSCLAWNDACGATFMRYWALVVGSPREKEGVICAPLTKVLL  63

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQL  401
            D+GKTERV+LA  S LEASQ+A+TEYRVL PMINGCSWIELRP  SRKHQ 
Sbjct  64   DDGKTERVMLAHPSGLEASQEAMTEYRVLVPMINGCSWIELRPLTSRKHQF  114



>ref|XP_010271255.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=440

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = -2

Query  562  VVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAE  383
            VVLD+GK+ER+ +  N    +SQ AVT+Y+V+    +G +W+EL P   RKHQLRVHCAE
Sbjct  271  VVLDDGKSERMTVDTNGNAISSQHAVTKYQVMKSSAHGYTWLELCPLTGRKHQLRVHCAE  330

Query  382  ALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHL  203
             LGTPIVGDYKYGW  H+KWK +   + +     P     P GLD + GS+  K P LHL
Sbjct  331  VLGTPIVGDYKYGWQAHRKWKPLSWSNPQKNKKLPRSKESPFGLDSEGGSIAEKQPHLHL  390

Query  202  HCRELVLPNIAKFLE-LHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLM  35
            HCR+++ PNIA  L+ L S+SN           +S+ + L  VAP+P HM+ SW ++
Sbjct  391  HCRQMIFPNIALALQHLQSSSNCD---------LSELESLNLVAPLPPHMQRSWGIL  438



>gb|EYU24287.1| hypothetical protein MIMGU_mgv1a0228502mg, partial [Erythranthe 
guttata]
Length=306

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ESIS LH + SD++K    S+ W D+C   Y+RYWALVIG P +KEG+ICAPL+KV+L
Sbjct  197  TKESISYLHWLFSDVRKAASFSKEWSDACDAMYQRYWALVIGVPNQKEGVICAPLTKVLL  256

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQ  404
            ++GKTE VIL+ NS LEASQ+A+T YRVLGPMINGCSWIEL P   RKHQ
Sbjct  257  NDGKTEMVILSHNSGLEASQEAITRYRVLGPMINGCSWIELHPLTRRKHQ  306



>ref|XP_010093260.1| hypothetical protein L484_000201 [Morus notabilis]
 gb|EXC38149.1| hypothetical protein L484_000201 [Morus notabilis]
Length=95

 Score =   146 bits (369),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 4/99 (4%)
 Frame = -2

Query  316  MPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNR  137
            MP+V+IEPTTG+PY++RRPEGLDVQKGSV+SKVPLLHL CRELVLPNIAKFL +    + 
Sbjct  1    MPQVNIEPTTGKPYKLRRPEGLDVQKGSVMSKVPLLHLQCRELVLPNIAKFLRVFDRKSE  60

Query  136  SRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSSYLI  20
            +++  ++    SKPDLLRFVA MPSHMKISWNLMSSYL+
Sbjct  61   NQDPALE----SKPDLLRFVARMPSHMKISWNLMSSYLV  95



>ref|XP_004515177.1| PREDICTED: RNA pseudourine synthase 3, mitochondrial-like isoform 
X2 [Cicer arietinum]
Length=360

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T++S+S L  + S++   K   +AW+D+C+ TY+RYWALVIG+PKEKEG+I APLSKV+L
Sbjct  246  TKDSVSHLQWLFSNINNTKSSCKAWNDACESTYQRYWALVIGTPKEKEGIIHAPLSKVLL  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQL  401
            ++GKTERVILA  S +E  Q+AVTEYRVLGP INGCSW+ELRP   RKHQ+
Sbjct  306  NDGKTERVILAHESSIEPHQEAVTEYRVLGPKINGCSWVELRPLTYRKHQV  356



>tpg|DAA60656.1| TPA: hypothetical protein ZEAMMB73_133926 [Zea mays]
Length=503

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 119/195 (61%), Gaps = 16/195 (8%)
 Frame = -2

Query  604  PKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRP  425
            P++++   C    +VVL +G++ER+ +   S   + QDA+TEYRV+     G +W+EL P
Sbjct  319  PRQRQTSRC--WEEVVLQDGRSERLTVCAGSNTASVQDALTEYRVIESFPQGYTWLELFP  376

Query  424  HASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRR---PEG  254
               RKHQLRVHCAE LGTPIVGDYKYG   H+ W  +P     P T +   +++   P G
Sbjct  377  RTGRKHQLRVHCAEVLGTPIVGDYKYGRQAHQNWMPLPM----PQTIDKEMLKKRKLPFG  432

Query  253  LDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVA  74
            L +  GSV  + P LHLHC++++LP+I+  ++   +S+   ++       S  + L FVA
Sbjct  433  LTLGGGSVAEQQPQLHLHCKQMILPDISAAMQQLRSSDADHDF-------SDLEKLSFVA  485

Query  73   PMPSHMKISWNLMSS  29
            P+P HM++SW ++ S
Sbjct  486  PLPLHMQLSWKILLS  500



>gb|KCW70916.1| hypothetical protein EUGRSUZ_F04033 [Eucalyptus grandis]
Length=403

 Score =   113 bits (282),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ES++ L  + SD+KK     QAW+D+C+ T +RYWALVIGSPKEKEGLICAPLSKV+L
Sbjct  255  TKESVAHLQWLFSDMKKTDSSFQAWNDACRATNQRYWALVIGSPKEKEGLICAPLSKVLL  314

Query  553  DNGKTERVILAQNSRLE  503
            D+GKTERVILA+NS LE
Sbjct  315  DDGKTERVILARNSGLE  331


 Score = 72.8 bits (177),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -1

Query  473  CAGSYDQWMFVDRIAPACKQKASAPCALCRSAWYSNCG*LQVRLVRS*EVEADAPG*Y*A  294
            C GSY++WMF+DRIAP+ + +AS  C LCRS  +S+ G LQV LVR+ E+EA+A   + A
Sbjct  333  CIGSYNKWMFLDRIAPSYQPQASGSCTLCRSTGHSDSGGLQVWLVRAPEMEANAQSRFRA  392

Query  293  HNRGTIQNAKA  261
            ++  TIQ A+A
Sbjct  393  YHGETIQVAEA  403



>tpg|DAA60657.1| TPA: hypothetical protein ZEAMMB73_133926 [Zea mays]
Length=549

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 115/228 (50%), Gaps = 60/228 (26%)
 Frame = -2

Query  565  KVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP-------------------------  461
            +VVL +G++ER+ +   S   + QDA+TEYRV+                           
Sbjct  330  EVVLQDGRSERLTVCAGSNTASVQDALTEYRVIESFPQDIKSDVDRNKFVQVMGVGIGSV  389

Query  460  ---------------------MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
                                 MI G +W+EL P   RKHQLRVHCAE LGTPIVGDYKYG
Sbjct  390  SSKICGAVKLLLVKSTTICLLMILGYTWLELFPRTGRKHQLRVHCAEVLGTPIVGDYKYG  449

Query  343  WFVHKKWKQMPRVDIEPTTGEPYRMRR---PEGLDVQKGSVLSKVPLLHLHCRELVLPNI  173
               H+ W  +P     P T +   +++   P GL +  GSV  + P LHLHC++++LP+I
Sbjct  450  RQAHQNWMPLPM----PQTIDKEMLKKRKLPFGLTLGGGSVAEQQPQLHLHCKQMILPDI  505

Query  172  AKFLELHSNSNRSRNYNVKSDTVSKPDLLRFVAPMPSHMKISWNLMSS  29
            +  ++   +S+   ++       S  + L FVAP+P HM++SW ++ S
Sbjct  506  SAAMQQLRSSDADHDF-------SDLEKLSFVAPLPLHMQLSWKILLS  546



>ref|XP_010326297.1| PREDICTED: RNA pseudouridine synthase 3, mitochondrial-like [Solanum 
lycopersicum]
Length=113

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 80/112 (71%), Gaps = 7/112 (6%)
 Frame = -2

Query  406  QLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVL  227
             LRVHC EAL TPIVG YKY  FV++KWKQM RVDIEPT  + YRM RP GL VQKG+VL
Sbjct  5    NLRVHCVEALETPIVGKYKYSGFVYRKWKQMLRVDIEPTIRKTYRMERPGGLAVQKGNVL  64

Query  226  SKVPLLHLHCRELVLPNIAKFLELH-SNSNRSRNYNVKSDTVSKPDLLRFVA  74
            SKVPLLHLHCRELVL  ++  L      + +  NY+      SKPDLLRFV+
Sbjct  65   SKVPLLHLHCRELVLLILSNLLSFMVEKTMKHFNYS------SKPDLLRFVS  110



>ref|XP_009805029.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial isoform 
X3 [Nicotiana sylvestris]
Length=381

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 5/114 (4%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCK--VTYRRYWALVIGSPKEKEGLICAPLSKV  560
            T+ S S+LH V    ++K F +Q  D   K  V  +RYWALVIG P+  +GLI  PL KV
Sbjct  269  TQLSASVLHSVF---REKTFGTQTEDLESKKRVLQKRYWALVIGCPRRSKGLISVPLGKV  325

Query  559  VLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLR  398
            VLDNGK+ER+ +  + R  ++Q AVTEYR++G    G +W+EL P   RKHQ R
Sbjct  326  VLDNGKSERITIMSDVREPSAQFAVTEYRIIGSSEKGYTWLELSPLTGRKHQGR  379



>ref|XP_010279041.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=157

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = -2

Query  406  QLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVL  227
            +LRVHCAE LGTPIVGDYKYGW  H+KWK +   + +     P     P GL  + GS++
Sbjct  54   KLRVHCAEVLGTPIVGDYKYGWQAHRKWKPLSWSNSQKNKKLPRSKECPFGLSSEGGSIV  113

Query  226  SKVPLLHLHCRELVLPNIAKFLE-LHSNSN  140
             K P LHLHCR+++LPNI+  L+ L S+SN
Sbjct  114  EKQPHLHLHCRQMILPNISLALQHLKSSSN  143



>ref|XP_010271260.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X3 [Nelumbo nucifera]
Length=369

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 3/111 (3%)
 Frame = -2

Query  733  TEESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVL  554
            T+ S ++LH   S  ++K F +   D+   +  RRYWALVIG+PK   GLI APL KVVL
Sbjct  249  TQTSATILH---SIFREKTFGASINDNDKMILQRRYWALVIGTPKRANGLISAPLGKVVL  305

Query  553  DNGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQL  401
            D+GK+ER+ +  N    +SQ AVT+Y+V+    +G +W+EL P   RKHQ+
Sbjct  306  DDGKSERMTVDTNGNAISSQHAVTKYQVMKSSAHGYTWLELCPLTGRKHQV  356



>ref|XP_010279040.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=172

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = -2

Query  406  QLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVL  227
            +LRVHCAE LGTPIVGDYKYGW  H+KWK +   + +     P     P GL  + GS++
Sbjct  54   KLRVHCAEVLGTPIVGDYKYGWQAHRKWKPLSWSNSQKNKKLPRSKECPFGLSSEGGSIV  113

Query  226  SKVPLLHLHCRELVLPNIAKFLE-LHSNSN  140
             K P LHLHCR+++LPNI+  L+ L S+SN
Sbjct  114  EKQPHLHLHCRQMILPNISLALQHLKSSSN  143



>ref|XP_005714249.1| unnamed protein product [Chondrus crispus]
 emb|CDF34430.1| unnamed protein product [Chondrus crispus]
Length=399

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 93/204 (46%), Gaps = 53/204 (26%)
 Frame = -2

Query  646  KVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVL  467
            ++  + YWALV GS K+K G I  P+      +GK  R                T+YRV+
Sbjct  235  RLVRKTYWALVEGSVKDKTGFIDLPI------DGKRAR----------------TDYRVI  272

Query  466  GPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTT  287
              +     W+EL P   RKHQLR+HCA+ LGTPIVGD KYG   H               
Sbjct  273  QSLDKKFVWLELSPRTGRKHQLRIHCADGLGTPIVGDGKYG---HGG-------------  316

Query  286  GEPYRMRRPEGLDVQK--GSVLSKV-PLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVK  116
                    PEGLD Q   G +LS + P LHL  RE+  P + + +   S   +       
Sbjct  317  --------PEGLDGQNVDGGLLSLMNPGLHLFSREIQFPKLTQHM---SGGGKRSKRTAG  365

Query  115  SDTVSKPDLLRFVAPMPSHMKISW  44
            SD    P +    AP+P HMK +W
Sbjct  366  SDGTGFPTIT-ARAPLPPHMKDTW  388



>ref|WP_014240363.1| pseudouridine synthase [Azospirillum brasilense]
 emb|CCC98114.1| Pseudouridine synthase [Azospirillum brasilense Sp245]
Length=229

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 7/97 (7%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWA+V G+P E++G I  PL KV   +G   R+++A +      Q A+T+YRVLG   
Sbjct  90   KTYWAVVAGTPPEEQGRIELPLKKVTNKSGGW-RIVVADDG-----QSAITDYRVLG-RG  142

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            NG +W+EL+PH  R HQ+RVHCA ALG P++GD +YG
Sbjct  143  NGTTWLELKPHTGRTHQIRVHCATALGCPLLGDPQYG  179



>ref|WP_035673581.1| pseudouridine synthase [Azospirillum brasilense]
Length=229

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 7/97 (7%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWA+V GSP E++G I  PL KV   +G   R+++A +      Q AVT+YRVLG   
Sbjct  90   KTYWAVVAGSPPEEQGRIELPLKKVTNKSGGW-RIVVADDG-----QSAVTDYRVLG-RG  142

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            +G +W+EL+PH  R HQ+RVHCA ALG P++GD +YG
Sbjct  143  DGTTWLELKPHTGRTHQIRVHCATALGCPLLGDPQYG  179



>ref|WP_038527907.1| pseudouridine synthase [Azospirillum brasilense]
 gb|EZQ08646.1| pseudouridine synthase [Azospirillum brasilense]
 gb|AIB11742.1| pseudouridine synthase [Azospirillum brasilense]
Length=229

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (66%), Gaps = 7/97 (7%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWA+V G+P E++G I  PL KV    G   R+++A +      Q AVT+YRVLG   
Sbjct  90   KTYWAVVAGTPPEEQGRIELPLKKVTNKTGGW-RIVVADDG-----QSAVTDYRVLG-RG  142

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
             G +W+EL+PH  R HQ+RVHCA ALG P++GD +YG
Sbjct  143  EGMTWLELKPHTGRTHQIRVHCATALGCPLLGDPQYG  179



>gb|EFA78208.1| Probable ribosomal large subunit pseudouridine synthase C protein 
[Polysphondylium pallidum PN500]
Length=702

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 91/198 (46%), Gaps = 54/198 (27%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWAL+  +P  KEG I APL KVV D    E +++A     + ++ A+TEY+V+   +  
Sbjct  551  YWALLTSTPNPKEGRIRAPLKKVVQDG---EEMVIATKETGDGAKLAITEYKVVESSLTN  607

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             S++ L P   R HQLRVHCA  L +PIVGD KYG                         
Sbjct  608  ASFVSLWPETGRTHQLRVHCASILSSPIVGDKKYG-------------------------  642

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
             + + +  Q  SVL K   LHLH R +           H  +N+                
Sbjct  643  -KNDSVAFQ--SVLGKKIPLHLHARRVEF--------FHPETNKK---------------  676

Query  88   LRFVAPMPSHMKISWNLM  35
            +  VAP+P +++ SW+++
Sbjct  677  IDVVAPLPKNLENSWDML  694



>dbj|GAM19537.1| hypothetical protein SAMD00019534_027120 [Acytostelium subglobosum 
LB1]
Length=646

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 93/203 (46%), Gaps = 54/203 (27%)
 Frame = -2

Query  643  VTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLG  464
            +  + YWAL+ G P  KEG I APL K++ +NG  E  ++A     + ++ A+TEY+V+ 
Sbjct  485  IIRKTYWALLKGVPSPKEGRIRAPLKKII-ENG--EEKVVATTKTGDGAKLAITEYKVME  541

Query  463  PMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTG  284
              +   S++ L P   R HQLRVHCA  LG PI+GD KYG     K++ +          
Sbjct  542  STVADTSFVTLWPETGRTHQLRVHCASILGAPIIGDTKYGGNHLGKFQTL----------  591

Query  283  EPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTV  104
                             +  K+P LHLH R +           H  +N+           
Sbjct  592  -----------------LGRKIP-LHLHARRVQFS--------HPVTNK-----------  614

Query  103  SKPDLLRFVAPMPSHMKISWNLM  35
                L+  VAP+P  ++ SW LM
Sbjct  615  ----LMDIVAPLPEALENSWTLM  633



>ref|WP_029603870.1| pseudouridine synthase [Kozakia baliensis]
Length=342

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 84/199 (42%), Gaps = 60/199 (30%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P    G+I  PL+K+   NG    +++A + + E +  A TEY V+      
Sbjct  173  YWAVVVGRPMPGSGVIDQPLAKLGAGNGA---LVIAADRKDEDAASARTEYEVVDAAGKK  229

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             SW+ L P   R HQLRVHC E LGTPI+GD +YG                       + 
Sbjct  230  ISWLALEPLTGRTHQLRVHC-ETLGTPIIGDPRYGG----------------------KA  266

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
              PEG   +          LHLH R L LP        H    R                
Sbjct  267  AHPEGFTDR----------LHLHARALDLP--------HPAGGR----------------  292

Query  88   LRFVAPMPSHMKISWNLMS  32
            L+  AP+P HMK ++  M 
Sbjct  293  LQVAAPLPPHMKTTFKEMG  311



>gb|EFL90075.1| rRNA pseudouridylate synthase C [Ahrensia sp. R2A130]
Length=338

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 94/205 (46%), Gaps = 56/205 (27%)
 Frame = -2

Query  646  KVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVL  467
            + T + YWALV G P++KEG I   L K   ++G  +R+ +A++    A   AV+ YRV+
Sbjct  174  RTTQKTYWALVRGIPRQKEGRISTYLVKEQTEDG--DRMRVAKHGERHADH-AVSFYRVI  230

Query  466  GPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTT  287
                   SW+EL PH  R HQLRVH A+ +G PI+GD KY  F  + W +MP        
Sbjct  231  DSNPRTVSWVELSPHTGRTHQLRVH-ADHIGHPIIGDNKY--FSTENW-EMP--------  278

Query  286  GEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT  107
                            G +  +   LHLH R + +P        H + N+          
Sbjct  279  ----------------GGIQKR---LHLHARRIRIP--------HPDENQP---------  302

Query  106  VSKPDLLRFVAPMPSHMKISWNLMS  32
                  L   AP+P HM  SWNL +
Sbjct  303  -----TLDVTAPLPPHMVQSWNLFA  322



>ref|WP_040304703.1| pseudouridine synthase [Ahrensia sp. R2A130]
Length=336

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 94/205 (46%), Gaps = 56/205 (27%)
 Frame = -2

Query  646  KVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVL  467
            + T + YWALV G P++KEG I   L K   ++G  +R+ +A++    A   AV+ YRV+
Sbjct  172  RTTQKTYWALVRGIPRQKEGRISTYLVKEQTEDG--DRMRVAKHGERHADH-AVSFYRVI  228

Query  466  GPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTT  287
                   SW+EL PH  R HQLRVH A+ +G PI+GD KY  F  + W +MP        
Sbjct  229  DSNPRTVSWVELSPHTGRTHQLRVH-ADHIGHPIIGDNKY--FSTENW-EMP--------  276

Query  286  GEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT  107
                            G +  +   LHLH R + +P        H + N+          
Sbjct  277  ----------------GGIQKR---LHLHARRIRIP--------HPDENQP---------  300

Query  106  VSKPDLLRFVAPMPSHMKISWNLMS  32
                  L   AP+P HM  SWNL +
Sbjct  301  -----TLDVTAPLPPHMVQSWNLFA  320



>ref|XP_003290575.1| hypothetical protein DICPUDRAFT_81306 [Dictyostelium purpureum]
 gb|EGC32890.1| hypothetical protein DICPUDRAFT_81306 [Dictyostelium purpureum]
Length=583

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWAL+ G+PK +EG I APL KV++  G  E+VI A     + ++ A+TEY+V+   +
Sbjct  423  KTYWALIAGAPKPREGRIRAPLKKVMI--GGEEKVIPALKIG-DGAKLAITEYKVIQSSL  479

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            +  S++ L P   R HQLRVHCA  L  PI+GD KYG
Sbjct  480  DNQSFVALWPETGRTHQLRVHCASVLNAPIIGDTKYG  516



>emb|CCG09371.1| Pseudouridine synthase [Rhodospirillum photometricum DSM 122]
Length=372

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 86/171 (50%), Gaps = 45/171 (26%)
 Frame = -2

Query  679  KFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEA  500
            +F + A+    + T + YWALV+G P  ++G +   L+K     G+ ER+++ +    E 
Sbjct  183  RFLTAAF--RARDTLKVYWALVVGRPPLEQGTMRGALAKEA--RGRGERMVVNE----ED  234

Query  499  SQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWK  320
             + A+T++RV+   +  C+W++LRP   R HQLRVHC E +G PI+GD KYG        
Sbjct  235  GRPAITDFRVIDQAVGACAWLDLRPRTGRTHQLRVHCLE-MGIPILGDGKYG--------  285

Query  319  QMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPL---LHLHCRELVLPN  176
                                      +G+ L ++P+   LHLH R L +P+
Sbjct  286  -------------------------GQGAFLPELPVARRLHLHARALAIPH  311



>ref|WP_043337633.1| pseudouridine synthase [Belnapia moabensis]
Length=327

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V   P+ ++G I  PL+K  LD  + ER+   ++   +A   AVT++R L  +   
Sbjct  173  YWAVVTPPPQIEDGRIDIPLAK--LDGPRGERMQAVEDP--DAGARAVTDFRTLDSVRGR  228

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
             +W+EL+P   R HQLRVHCAE LGTPI+GD KYG
Sbjct  229  AAWLELKPLTGRTHQLRVHCAEGLGTPILGDGKYG  263



>ref|WP_020401271.1| hypothetical protein [Kordiimonas gwangyangensis]
Length=326

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 89/206 (43%), Gaps = 63/206 (31%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             K T +RYWALVIG+PK+++G I   + K  +     ER+I++     +  Q ++T+Y V
Sbjct  170  TKETDKRYWALVIGTPKQRDGRIILKMEKAPIKG--NERMIVS-----DKGQHSLTDYAV  222

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +        W+ L+PH  R HQLR+HCAE +G PIVGD KYG                  
Sbjct  223  VESAGQKACWLALKPHTGRTHQLRLHCAE-MGHPIVGDGKYG------------------  263

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
                       G D      +SK   LHLH + +  P        H    R         
Sbjct  264  -----------GADAFLSGSISKK--LHLHSQSVSFP--------HPEGGR---------  293

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMS  32
                   +   AP+P HM  S++++ 
Sbjct  294  -------MSVSAPLPDHMAASFDMLG  312



>ref|XP_004350370.1| putative ribosomal large subunit pseudouridine synthase C protein 
[Dictyostelium fasciculatum]
 gb|EGG13666.1| putative ribosomal large subunit pseudouridine synthase C protein 
[Dictyostelium fasciculatum]
Length=720

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 68/105 (65%), Gaps = 5/105 (5%)
 Frame = -2

Query  658  DDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTE  479
            DD+  +  + YWAL+  +P  +EG I APL K+V +NG+ E+V+  + +    ++ A+TE
Sbjct  554  DDNSII--KTYWALLTSTPNPREGRIRAPLQKIV-ENGQ-EKVVATKETG-NGAKLAITE  608

Query  478  YRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            YRV+   +   S++ L P   R HQLRVHCA  LG+PI+GD KYG
Sbjct  609  YRVIENSMADTSFVALWPETGRTHQLRVHCASILGSPIIGDVKYG  653



>ref|WP_011390409.1| pseudouridine synthase [Rhodospirillum rubrum]
 ref|YP_427743.1| ribosomal large subunit pseudouridine synthase C [Rhodospirillum 
rubrum ATCC 11170]
 gb|ABC23456.1| ribosomal large subunit pseudouridine synthase C [Rhodospirillum 
rubrum ATCC 11170]
 gb|AEO49194.1| ribosomal large subunit pseudouridine synthase C [Rhodospirillum 
rubrum F11]
Length=330

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 75/153 (49%), Gaps = 37/153 (24%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P   +G I   L+KV    G+ ER+ + +    E  + AVT++RV+      
Sbjct  177  YWAIVVGRPPMLQGTIKGALAKVA--GGRGERMEINE----EEGKRAVTDFRVVDQAAKA  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
            C+W+EL P   R HQLRVHC E +GTPI+GD KYG          P   +E T   P RM
Sbjct  231  CAWVELHPRTGRTHQLRVHCLE-MGTPILGDGKYGG---------PGAFLEGTE-LPKRM  279

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIA  170
                                HLH R L LP+ A
Sbjct  280  --------------------HLHARALALPHPA  292



>ref|WP_019013199.1| hypothetical protein [Elioraea tepidiphila]
Length=330

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 85/200 (43%), Gaps = 62/200 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+ +G P  +EG I APL+K     G  ERV+LA     +A++ A+T+YR L      
Sbjct  175  YWAVTVGVPTPREGRIDAPLAKRPGQRG--ERVVLAGRDEDDAAR-AITDYRTLDAAGRR  231

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+EL P   R HQLRVHC   +G PI+GD KYG                         
Sbjct  232  AAWLELAPLTGRTHQLRVHCV-GIGCPILGDAKYGG------------------------  266

Query  268  RRPEGLDVQKGSVLSKVP-LLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPD  92
                      G++L   P  LHLH R + +P        H                    
Sbjct  267  ---------PGAMLEGFPEQLHLHARGIAIP--------HPEGG----------------  293

Query  91   LLRFVAPMPSHMKISWNLMS  32
            +LR  AP+P HM+ ++  + 
Sbjct  294  VLRAEAPLPPHMRATFAALG  313



>ref|NP_001062556.1| Os09g0103500 [Oryza sativa Japonica Group]
 sp|Q69K07.1|PUS4_ORYSJ RecName: Full=RNA pseudouridine synthase 4, mitochondrial; AltName: 
Full=RNA pseudouridylate synthase 4; AltName: Full=RNA-uridine 
isomerase 4; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD34146.1| ribosomal large subunit pseudouridine synthase C-like [Oryza 
sativa Japonica Group]
 dbj|BAD36694.1| ribosomal large subunit pseudouridine synthase C-like [Oryza 
sativa Japonica Group]
 dbj|BAF24470.1| Os09g0103500 [Oryza sativa Japonica Group]
Length=448

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = -2

Query  724  SISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNG  545
            S S+LH +     ++K      D +  V  R+Y ALVIG+P+  +GL+ APL+K++L +G
Sbjct  243  STSMLHAIF----REKTADALADGTQHVLQRKYVALVIGTPRHPKGLLSAPLAKILLQDG  298

Query  544  KTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQ  404
            K+ER+ +  +S   + QDA+TEYRV+     G +W+EL P   RKHQ
Sbjct  299  KSERLTIRASSNAASVQDALTEYRVIESCPQGYTWLELFPRTGRKHQ  345



>ref|WP_043358896.1| pseudouridine synthase [Belnapia sp. F-4-1]
Length=329

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V   P+ ++G I  PL+K  LD  + ER+   ++    A   AVT++R L  +   
Sbjct  173  YWAVVTPPPQIEDGRIDIPLAK--LDGPRGERMQAVEDPSEGAR--AVTDFRTLDAVRGR  228

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
             +W+EL+P   R HQLRVHCAE LGTPI+GD KYG
Sbjct  229  AAWLELKPLTGRTHQLRVHCAEGLGTPILGDGKYG  263



>gb|ABD27273.1| ribosomal large subunit pseudouridine synthase C [Novosphingobium 
aromaticivorans DSM 12444]
Length=436

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            SC+   + YWALV+G P  K+GLI  PL+K     G  E++++ ++ +    Q A + YR
Sbjct  178  SCRSARKIYWALVVGVPDVKDGLIELPLAKQPGTGG--EKMMVDESGQ---GQSARSRYR  232

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+    N  +W+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  233  VISRAGNAAAWVELQPLTGRTHQLRVHMA-AIGHPIVGDGKYG  274



>ref|WP_041551261.1| pseudouridine synthase [Novosphingobium aromaticivorans]
Length=431

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            SC+   + YWALV+G P  K+GLI  PL+K     G  E++++ ++ +    Q A + YR
Sbjct  173  SCRSARKIYWALVVGVPDVKDGLIELPLAKQPGTGG--EKMMVDESGQ---GQSARSRYR  227

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+    N  +W+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  228  VISRAGNAAAWVELQPLTGRTHQLRVHMA-AIGHPIVGDGKYG  269



>ref|WP_021999249.1| pseudouridine synthase [Acetobacter sp. CAG:977]
 emb|CCZ21564.1| pseudouridine synthase [Acetobacter sp. CAG:977]
Length=333

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV+G+P+ KEG I A L KV  + G     +  +N      Q+AVT YRV+      
Sbjct  180  YWALVVGNPEMKEGKINAKLLKVSGEQGGESVKVDMKNG-----QNAVTLYRVVDEAFKK  234

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
             SW+E+ P   R HQLRVHCA  +G PIVGD KYG
Sbjct  235  ASWLEMMPLTGRTHQLRVHCA-YMGHPIVGDGKYG  268



>ref|WP_024849769.1| pseudouridine synthase [Aminobacter sp. J41]
Length=328

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 90/202 (45%), Gaps = 62/202 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV G PK++EG I   L K    +G  +RV +A++   + +  AV+ YR++      
Sbjct  177  YWALVKGVPKKREGRISTWLVKEQTPDG--DRVRIAKHGE-DGADHAVSNYRIVDQAGQS  233

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+E+ PH  R HQLRVH A  +G PI+GD KY                E  T   +  
Sbjct  234  LTWLEMEPHTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEADTNWEF--  275

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPD-  92
              P G+  +          LHLH R +V+P+                          PD 
Sbjct  276  --PGGIQNR----------LHLHARRIVIPH--------------------------PDG  297

Query  91   --LLRFVAPMPSHMKISWNLMS  32
              ++   AP+P HM+ SWNL+ 
Sbjct  298  KGVIDITAPLPPHMRQSWNLLG  319



>ref|WP_007197145.1| pseudouridine synthase [Hoeflea phototrophica]
 gb|EDQ32170.1| pseudouridine synthase, RluA family [Hoeflea phototrophica DFL-43]
Length=329

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 90/205 (44%), Gaps = 57/205 (28%)
 Frame = -2

Query  646  KVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVL  467
            + T + YWALV G P+++EG I   L K   D+G  +R+ +A++    A   AV+ YR++
Sbjct  171  RTTKKTYWALVTGVPRDREGKISTWLVKEATDDG--DRMRVAKHGEPGADH-AVSYYRII  227

Query  466  GPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTT  287
                    W+EL P+  R HQLRVHC   LG PI+GD KY  + H K ++ P        
Sbjct  228  EKAAQNLCWLELEPYTGRTHQLRVHCLH-LGHPILGDPKY--YDHDKNREFP--------  276

Query  286  GEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT  107
                            G +  +   LHL  R + +P        H +  R          
Sbjct  277  ----------------GGMQKR---LHLLARHISVP--------HPDGGR----------  299

Query  106  VSKPDLLRFVAPMPSHMKISWNLMS  32
                  L   AP+P HM  SWNL+ 
Sbjct  300  ------LSVTAPLPPHMVQSWNLLG  318



>ref|XP_002672650.1| predicted protein [Naegleria gruberi]
 gb|EFC39906.1| predicted protein [Naegleria gruberi]
Length=624

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 73/127 (57%), Gaps = 13/127 (10%)
 Frame = -2

Query  706  LVLSDLKKKKFQSQAWDDSCKVTYRR-YWALVIGSPKEKEGLICAPLSKVVLD-----NG  545
            L+++  +    + Q W     V  ++ YWA+ +G P    G I     K+V+D     NG
Sbjct  471  LIVARNRAGAIRMQQWLQESTVPLKKCYWAVTVGVPTPTTGRI-----KMVIDIQKDANG  525

Query  544  KTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPI  365
              E+V+   N + ++S+ +V+EY+ +  M +  +W+ L P   RKHQLRVHCA ALG PI
Sbjct  526  -VEKVVPVDN-KTDSSKISVSEYKTIDHMTDKLAWVALYPVTGRKHQLRVHCASALGAPI  583

Query  364  VGDYKYG  344
            +GDYKYG
Sbjct  584  LGDYKYG  590



>gb|EKE08954.1| Pseudouridine synthase [uncultured bacterium]
Length=325

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 56/97 (58%), Gaps = 6/97 (6%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWALV G PK+KEG I   LSK    +G+  RV        E+   A T YR+L  + 
Sbjct  180  KTYWALVCGVPKKKEGSITLALSKKASVHGEKVRV------NTESGARATTYYRILETLG  233

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
               + +EL P   R HQLRVHCAE L TPI+GD KYG
Sbjct  234  TKMALLELTPKTGRMHQLRVHCAEGLKTPILGDGKYG  270



>ref|XP_006660410.1| PREDICTED: RNA pseudouridine synthase 4, mitochondrial-like [Oryza 
brachyantha]
Length=424

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = -2

Query  730  EESISLLHLVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLD  551
            + S ++LH       ++K      D +  V  R+Y ALVIG+P+  +GL+ APL+KV+L 
Sbjct  219  QRSTTMLHATF----REKTADALADGTQHVLQRKYLALVIGTPRHPKGLLSAPLAKVLLQ  274

Query  550  NGKTERVILAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQ  404
            +GK+ER+ +  +S     QDA+TEYRV+    +G +W+EL P   RKHQ
Sbjct  275  DGKSERLTVRASSNAAPVQDALTEYRVIEYCPHGYTWLELFPRTGRKHQ  323



>ref|WP_009452506.1| pseudouridine synthase [Nitratireductor indicus]
 gb|EKF40328.1| ribosomal large subunit pseudouridine synthase C [Nitratireductor 
indicus C115]
Length=328

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 92/206 (45%), Gaps = 57/206 (28%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G PK+ EG I   L K    +G  +R+ +A++   + S  AV+ YR+
Sbjct  170  ARDTKKTYWALVKGVPKKPEGRISTWLVKEQTPDG--DRMRVAKHGEPD-SDHAVSNYRL  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY +   + W+          
Sbjct  227  IEQAATNLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY-FEADQNWE----------  274

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
                     P GL  +          LHLH R +V+P        H +  R         
Sbjct  275  --------FPGGLQKR----------LHLHARRIVIP--------HPDGGR---------  299

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMS  32
                   +   AP+P HM+ SWNL+ 
Sbjct  300  -------IDVTAPLPPHMRQSWNLLG  318



>ref|WP_007066556.1| pseudouridine synthase [Fulvimarina pelagi]
 gb|EAU42582.1| ribosomal large subunit pseudouridine synthase C [Fulvimarina 
pelagi HTCC2506]
Length=328

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 91/203 (45%), Gaps = 57/203 (28%)
 Frame = -2

Query  640  TYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP  461
            T + YWA+V G P +KEG I   L K    +G  +R+ +A++   E +  A++ YRV+  
Sbjct  175  TKKLYWAVVKGVPAKKEGRISTYLKKEQTPDG--DRMRIARHGD-EGADHALSHYRVIDQ  231

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE  281
            +    +W+EL PH  R HQLRVH A  +G PI+GD KY  F H    + P          
Sbjct  232  VAQNFAWLELEPHTGRTHQLRVHAAH-IGHPILGDPKY--FEHDTNWEFP----------  278

Query  280  PYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVS  101
                          G V  +   LHLH R LV+P        H +               
Sbjct  279  --------------GGVQMR---LHLHARRLVIP--------HPSGG-------------  300

Query  100  KPDLLRFVAPMPSHMKISWNLMS  32
               ++  +AP+P HM+ ++NL  
Sbjct  301  ---MIDQIAPLPQHMRQTFNLFG  320



>ref|XP_638115.1| hypothetical protein DDB_G0285543 [Dictyostelium discoideum AX4]
 gb|EAL64609.1| hypothetical protein DDB_G0285543 [Dictyostelium discoideum AX4]
Length=718

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWAL+  +P  KEG I APL KVV+  G  E+V+    +  + ++ A+TEY+VL   +
Sbjct  561  KTYWALLGSTPTPKEGRIRAPLKKVVV--GGFEKVVPTLTTG-DGAKIAITEYKVLESSL  617

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
                +I L P   R HQLRVHCA  L TPI+GD KYG
Sbjct  618  TKHCFISLWPETGRTHQLRVHCASVLNTPIIGDPKYG  654



>ref|WP_025886626.1| pseudouridine synthase [Asaia prunellae]
Length=331

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 82/196 (42%), Gaps = 60/196 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P    G+I  PL+K+   NG    +++A     E +  A T+Y V+      
Sbjct  174  YWAIVVGRPMPGSGVIDQPLAKLGAGNGA---LMIAATRDDEDAVVAKTDYEVVDAAGKK  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             SW+ L+P   R HQLRVHC E LGTPI+GD KYG     K   M               
Sbjct  231  LSWLALKPLTGRTHQLRVHC-ETLGTPILGDPKYGG----KTAHM---------------  270

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
               EG           V  LHLH R L  P        H    R                
Sbjct  271  ---EGF----------VDRLHLHARALEFP--------HPAGGR----------------  293

Query  88   LRFVAPMPSHMKISWN  41
            LR  AP+PSHM+ ++ 
Sbjct  294  LRVAAPLPSHMRNTFK  309



>ref|WP_039096046.1| pseudouridine synthase, partial [Kirrobacter mercurialis]
Length=352

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 58/103 (56%), Gaps = 7/103 (7%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S +   + YWALVIG P   EG I AP+SK     G+   V  A+       Q A T YR
Sbjct  164  SGRSAKKVYWALVIGVPDVYEGFIDAPISKQPGTGGEKMHVDEAEG------QAARTRYR  217

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+    N  +W+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  218  VIDRAGNSAAWVELQPLTGRTHQLRVHMA-AIGHPIVGDGKYG  259



>ref|WP_040965006.1| pseudouridine synthase [Erythrobacter vulgaris]
Length=374

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S +   + YWALV+G P  KEG+I APL+K     G+   V        E    A T+YR
Sbjct  171  SGRSAKKIYWALVVGVPDIKEGVIEAPLAKQPGSGGEKMHV------DHEGGAPAKTKYR  224

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+       +W+EL+P   R HQLRVHCA A+G PIVGD KYG
Sbjct  225  VVDSAGKKTAWLELQPLTGRTHQLRVHCA-AMGHPIVGDGKYG  266



>emb|CDQ74527.1| unnamed protein product [Oncorhynchus mykiss]
Length=400

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 83/168 (49%), Gaps = 34/168 (20%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAP----------------LSKVVLDNGKTERVILAQNSRLE  503
            R+YW + +G P   EG+I  P                LS V   +   E V   + +R  
Sbjct  219  RKYWVVAVGVPVPSEGVIDIPVIEREVTGAQPHFKMGLSPVYRVSDGGEGVTKVRANR--  276

Query  502  ASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKW  323
             +Q AVT+YRVL    NGCS +EL+P    KHQLRVH A ALG+PI+GD+KY  +     
Sbjct  277  QAQGAVTQYRVLDSS-NGCSLVELQPITGVKHQLRVHMAYALGSPILGDHKYSHWTKLAP  335

Query  322  KQMPRVDIEPTTGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLP  179
            +++P        G   R+    GL+  K   L     LHLH R+L LP
Sbjct  336  QKLP-------DGVLRRL----GLEQSKARYLP----LHLHARQLTLP  368



>ref|WP_035528357.1| pseudouridine synthase [Hoeflea sp. BAL378]
 gb|KGF68702.1| pseudouridine synthase [Hoeflea sp. BAL378]
Length=329

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 90/205 (44%), Gaps = 57/205 (28%)
 Frame = -2

Query  646  KVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVL  467
            + T + YWALV G P+ KEG I   L K   ++G  +R+ +A++   E +  AV+ YRV+
Sbjct  171  RTTKKTYWALVKGVPRAKEGKISTWLVKEATEDG--DRMRIARHGE-EGADHAVSYYRVV  227

Query  466  GPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTT  287
                   +W+EL P+  R HQLR+HC   LG PI+GD KY +   K W+           
Sbjct  228  DQAAQNLAWLELEPYTGRTHQLRIHCLH-LGHPILGDPKY-FEYDKNWE-----------  274

Query  286  GEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT  107
                    P G+  +          LHL  R + +P        H +  R          
Sbjct  275  -------FPSGMQNR----------LHLLARHISVP--------HPDGGR----------  299

Query  106  VSKPDLLRFVAPMPSHMKISWNLMS  32
                  L   AP+P HM  SWNL+ 
Sbjct  300  ------LSVTAPLPPHMVQSWNLLG  318



>ref|WP_039196130.1| pseudouridine synthase [Aureimonas altamirensis]
 gb|KHJ53040.1| pseudouridine synthase [Aureimonas altamirensis]
Length=328

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 85/205 (41%), Gaps = 61/205 (30%)
 Frame = -2

Query  640  TYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP  461
            T + YWALV G P  KEG I   L+K     G   RV    +   + +  A++ YRV+  
Sbjct  175  TKKVYWALVKGVPAPKEGRISTYLAKEQTPEGDRMRVARHGD---DGADHALSHYRVIDQ  231

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE  281
            +    +W+E+ PH  R HQLRVH A  +G PI+GD KY  F H    + P          
Sbjct  232  VAQSFAWLEMEPHTGRTHQLRVHAAH-IGHPILGDPKY--FEHDTNWEFP----------  278

Query  280  PYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVS  101
                          G V  K   LHLH R +++P+                         
Sbjct  279  --------------GGVQKK---LHLHARRIIIPH-------------------------  296

Query  100  KPD--LLRFVAPMPSHMKISWNLMS  32
             PD   +  +AP+P HM  +WNL  
Sbjct  297  -PDGGFVDQIAPLPPHMVQTWNLFG  320



>ref|WP_019998934.1| pseudouridine synthase [Aureimonas ureilytica]
Length=330

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 92/203 (45%), Gaps = 55/203 (27%)
 Frame = -2

Query  640  TYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP  461
            T +RYWA++ G P+ K+G I   L K    +G  +R+ +A++   E +  A++ YRV+  
Sbjct  175  TQKRYWAILKGVPQPKDGRISTYLVKEATADG--DRMRVARHGE-EGADHALSHYRVIDQ  231

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE  281
            +    +W+EL P+  R HQLRVH    +G PI+GD KY  F H    + P          
Sbjct  232  VAQNFAWVELEPYTGRTHQLRVHALH-IGHPILGDPKY--FEHDTNWEFP----------  278

Query  280  PYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVS  101
                          G V +K   LHLH R +V+P        H +               
Sbjct  279  --------------GGVQNK---LHLHARRIVIP--------HPDG--------------  299

Query  100  KPDLLRFVAPMPSHMKISWNLMS  32
            +  ++  +AP+P HM  +WNL  
Sbjct  300  RGKMIDQIAPLPPHMVQTWNLFG  322



>ref|WP_039331683.1| pseudouridine synthase [Novosphingobium subterraneum]
 gb|KHS48729.1| ribosomal large subunit pseudouridine synthase C [Novosphingobium 
subterraneum]
Length=432

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S +   + YWALV+G P+ K+GLI  PL+K     G  E++++ ++ +    Q A + YR
Sbjct  178  SGRSARKIYWALVVGVPEVKDGLIELPLAKQPGTGG--EKMMVDESGQ---GQSARSRYR  232

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+    N  SW+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  233  VISRAGNSASWVELQPLTGRTHQLRVHMA-AIGHPIVGDGKYG  274



>ref|WP_028096591.1| pseudouridine synthase [Dongia sp. URHE0060]
Length=332

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 79/200 (40%), Gaps = 63/200 (32%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G PK   G I APLSK     G  ERV + ++      + A+T Y ++    N 
Sbjct  178  YWAVVVGIPKPDRGTIDAPLSKQA--GGYGERVGIDEDE----GRHAITRYAMIERAGNR  231

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWF-VHKKWKQMPRVDIEPTTGEPYR  272
             +W+ L P   R HQLR HC   LGTPI+GD KYG    H   + +PR            
Sbjct  232  AAWVALMPETGRTHQLRAHCV-ILGTPILGDGKYGGIDAHLARENLPRK-----------  279

Query  271  MRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPD  92
                                LHLH R + +P+  K                         
Sbjct  280  --------------------LHLHARSIKIPHPRK------------------------G  295

Query  91   LLRFVAPMPSHMKISWNLMS  32
             +   AP+P HMK +W    
Sbjct  296  WIEATAPLPPHMKTTWKFFG  315



>ref|WP_008597531.1| pseudouridine synthase [Nitratireductor pacificus]
 gb|EKF18409.1| ribosomal large subunit pseudouridine synthase C [Nitratireductor 
pacificus pht-3B]
Length=328

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 87/206 (42%), Gaps = 57/206 (28%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G PK++EG I   L K    +G   RV          S  AV+ YR+
Sbjct  170  ARETKKTYWALVKGVPKQREGRISTWLVKEQTPDGDRMRVTKHGEP---DSDHAVSNYRL  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY +   + W+          
Sbjct  227  IEQAGMTLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY-FEADQNWE----------  274

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
                     P GL  +          LHLH R +V+P        H +  R         
Sbjct  275  --------FPGGLQNR----------LHLHARRIVIP--------HPDQGR---------  299

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMS  32
                   +   AP+P HM+ SWNL+ 
Sbjct  300  -------IDVTAPLPPHMRQSWNLLG  318



>ref|WP_028641933.1| pseudouridine synthase [Novosphingobium acidiphilum]
Length=443

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 6/95 (6%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV+G P   +GLI  PLSK     G  E++++ ++    A Q A T YRV+    N 
Sbjct  185  YWALVVGVPAVYDGLIELPLSKQPGTGG--EKMMVDESG---AGQTARTRYRVIDRAGNS  239

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
             +W+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  240  AAWVELQPQTGRTHQLRVHMA-AIGHPIVGDGKYG  273



>ref|WP_010239011.1| pseudouridine synthase [Citromicrobium bathyomarinum]
Length=388

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV+G P++  G I APL+K     G+   V        E  Q A T YRV+    N 
Sbjct  184  YWALVVGVPEQHVGEIDAPLAKQPGTGGEKMHVDT------EGGQPAKTRYRVVERAGNR  237

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
             +W+EL P   R HQLRVHCA A+G PIVGD KYG
Sbjct  238  AAWLELEPLTGRTHQLRVHCA-AMGHPIVGDGKYG  271



>ref|WP_040994651.1| pseudouridine synthase [Mesorhizobium sp. SOD10]
 emb|CDX21595.1| Pseudouridine synthase [Mesorhizobium sp. SOD10]
Length=326

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 91/208 (44%), Gaps = 61/208 (29%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G P ++E  I   L K    +G  +RV +A++   + +  AV+ YRV
Sbjct  170  ARETKKTYWALVKGVPAKREDKISTWLVKEATPDG--DRVRIAKHGE-KGADHAVSYYRV  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY                E  
Sbjct  227  VEQAAQSLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEAD  270

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T   +    P G+  +          LHLH R +V+P+                      
Sbjct  271  TNWEF----PGGIQNR----------LHLHARRIVIPH----------------------  294

Query  109  TVSKPD--LLRFVAPMPSHMKISWNLMS  32
                PD  ++   APMP HM+ SWNL+ 
Sbjct  295  ----PDQGVIDVTAPMPPHMRQSWNLLG  318



>ref|WP_025823971.1| pseudouridine synthase [Asaia astilbis]
Length=331

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 83/196 (42%), Gaps = 60/196 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P    G+I  PL+K+   NG    +++A     E +  A T+Y V+      
Sbjct  174  YWAIVVGRPMPGSGVIDQPLAKLGAGNGA---LMIAATREDEDAVVAKTDYEVIDAAGKR  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+ L+P   R HQLRVHC E LGTPI+GD KYG                   G+   +
Sbjct  231  LTWLALKPLTGRTHQLRVHC-ETLGTPILGDPKYG-------------------GKAAHL  270

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
               EG   +          LHLH R L  P        H    R                
Sbjct  271  ---EGFTDR----------LHLHARALEFP--------HPAGGR----------------  293

Query  88   LRFVAPMPSHMKISWN  41
            LR  AP+PSHM+ ++ 
Sbjct  294  LRVAAPLPSHMRTTFK  309



>ref|WP_041006782.1| pseudouridine synthase [Mesorhizobium plurifarium]
 emb|CDX57627.1| Pseudouridine synthase [Mesorhizobium plurifarium]
 emb|CDX18710.1| Pseudouridine synthase [Mesorhizobium plurifarium]
Length=326

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 91/208 (44%), Gaps = 61/208 (29%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G P ++E  I   L K    +G  +RV +A++   + +  AV+ YRV
Sbjct  170  ARETKKTYWALVKGVPAKREDKISTWLVKEATPDG--DRVRIAKHGE-KGADHAVSYYRV  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY                E  
Sbjct  227  VEQAAQSLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEAD  270

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T   +    P G+  +          LHLH R +V+P+                      
Sbjct  271  TNWEF----PGGIQNR----------LHLHARRIVIPH----------------------  294

Query  109  TVSKPD--LLRFVAPMPSHMKISWNLMS  32
                PD  ++   APMP HM+ SWNL+ 
Sbjct  295  ----PDQGVIDVTAPMPPHMRQSWNLLG  318



>ref|WP_040982994.1| pseudouridine synthase [Mesorhizobium plurifarium]
 emb|CDX31114.1| Pseudouridine synthase [Mesorhizobium plurifarium]
Length=326

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 91/208 (44%), Gaps = 61/208 (29%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G P ++E  I   L K    +G  +RV +A++   + +  AV+ YRV
Sbjct  170  ARETKKTYWALVKGVPAKREDKISTWLVKEATPDG--DRVRIAKHGE-KGADHAVSYYRV  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY                E  
Sbjct  227  VEQAAQSLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEAD  270

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T   +    P G+  +          LHLH R +V+P+                      
Sbjct  271  TNWEF----PGGIQNR----------LHLHARRIVIPH----------------------  294

Query  109  TVSKPD--LLRFVAPMPSHMKISWNLMS  32
                PD  ++   APMP HM+ SWNL+ 
Sbjct  295  ----PDQGVIDVTAPMPPHMRQSWNLLG  318



>ref|WP_043744764.1| pseudouridine synthase [Magnetospirillum magneticum]
Length=330

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 90/200 (45%), Gaps = 62/200 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV G P+  +G I APL+K+    G  E+V + +    E  + AVT YRV+   +  
Sbjct  176  YWALVAGVPRYPQGRIDAPLAKLPGKAG--EKVAVDK----EDGKHAVTYYRVVDATLKR  229

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+EL P   R HQLR HC   LGTPI+GD KYG                         
Sbjct  230  AAWLELEPRTGRTHQLRAHCL-LLGTPIMGDGKYG-------------------------  263

Query  268  RRPEGLD-VQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPD  92
                G D + +G+ +S+   LHLH R + LP        H  + +               
Sbjct  264  ----GQDALVEGTGVSRK--LHLHARAVRLP--------HPRTGK---------------  294

Query  91   LLRFVAPMPSHMKISWNLMS  32
            +L  VAP+P H+K S++   
Sbjct  295  VLEVVAPLPPHIKASFDFFG  314



>ref|WP_002726010.1| pseudouridine synthase [Phaeospirillum molischianum]
 emb|CCG40057.1| Pseudouridine synthase [Phaeospirillum molischianum DSM 120]
Length=331

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 86/200 (43%), Gaps = 62/200 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV G PK ++G I APL K  L     E++ + +    E  + AVT YR++   +  
Sbjct  177  YWALVAGVPKLRQGRIDAPLGK--LGGKGVEKMGVDE----EDGRHAVTYYRIVDSALKR  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+E+ P   R HQLR HC   LGTPI+GD KYG                         
Sbjct  231  AAWLEMEPRTGRTHQLRAHCL-LLGTPILGDGKYG-------------------------  264

Query  268  RRPEGLDVQ-KGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPD  92
                G D   +G  LS+   LHLH R L LP        H  + +               
Sbjct  265  ----GKDAMIEGFGLSRK--LHLHARALRLP--------HPRTGKR--------------  296

Query  91   LLRFVAPMPSHMKISWNLMS  32
             L  VAP+P+H K  ++L  
Sbjct  297  -LEVVAPLPAHFKTGFDLFG  315



>ref|WP_021131582.1| 23S rRNA pseudouridylate synthase [Phaeospirillum fulvum]
 gb|EPY02436.1| 23S rRNA pseudouridylate synthase [Phaeospirillum fulvum MGU-K5]
Length=331

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 86/200 (43%), Gaps = 62/200 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV G PK ++G I APLSK  L     E++ + +    E  + A+T YR++   +  
Sbjct  177  YWALVAGVPKLRQGRIDAPLSK--LGGKGVEKMGVDE----EDGRHAITYYRIVDSALKR  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+E+ P   R HQLR HC   LGTPI+GD KYG                         
Sbjct  231  AAWLEMEPRTGRTHQLRAHCL-LLGTPILGDGKYG-------------------------  264

Query  268  RRPEGLDVQ-KGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPD  92
                G D   +G  LS+   LHLH R L LP        H  + +               
Sbjct  265  ----GKDAMIEGFGLSRK--LHLHARALRLP--------HPRTGKR--------------  296

Query  91   LLRFVAPMPSHMKISWNLMS  32
             L  +AP+P+H K  + L  
Sbjct  297  -LEVIAPLPAHFKTGFELFG  315



>ref|WP_019370883.1| pseudouridine synthase [Sphingomonas sp. ATCC 31555]
Length=367

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S +   + YWALV+G P  ++G I  P+ K     G+  +V + + S       A T YR
Sbjct  174  SSRTARKIYWALVMGVPDIEDGFIELPIGKQPGTGGEKMQVDMEEGS------PARTRYR  227

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+    N C+W+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  228  VIEQAGNRCAWVELQPFTGRTHQLRVHMA-AIGHPIVGDGKYG  269



>ref|WP_029008013.1| pseudouridine synthase [Azospirillum halopraeferens]
Length=227

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S  +  + YWA+V G P ++EG + APL+KV  + G   R+++       A Q AVT+YR
Sbjct  84   SDGLAEKTYWAVVAGGPPDEEGRVEAPLAKVA-NRGGGWRIVID-----PAGQRAVTDYR  137

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            VLG    G +W+E RP   R HQ+RVH A  LG P++GD +YG
Sbjct  138  VLG-RGEGWTWLECRPRTGRTHQIRVHAAH-LGCPLLGDPQYG  178



>ref|WP_013215522.1| pseudouridine synthase [Hyphomicrobium denitrificans]
 gb|ADJ23307.1| pseudouridine synthase, RluA family [Hyphomicrobium denitrificans 
ATCC 51888]
Length=327

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 86/206 (42%), Gaps = 57/206 (28%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             +   + YWALV G PK  +G + A L K    +G  +RV  A+    +A+  A T Y V
Sbjct  171  TRSAAKTYWALVKGVPKPPQGKVEAALVKASGPDG--DRVRKARPGEQDAAMHATTHYSV  228

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +    +  +W+ L+P   R+HQLR H    +G PIVGD KY   VH     MP  +IE  
Sbjct  229  VDRAAHKAAWVSLKPVTGRQHQLRAHM-HLIGHPIVGDNKYEGDVH-----MPAENIEKK  282

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
                                      LHLH R LV+P        H    ++        
Sbjct  283  --------------------------LHLHARRLVIP--------HPKGGKT--------  300

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMS  32
                   +   AP+P+HM  SW+L+ 
Sbjct  301  -------IDVTAPLPAHMLASWDLLG  319



>ref|WP_010667066.1| pseudouridine synthase [Acetobacter aceti]
Length=324

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 68/153 (44%), Gaps = 36/153 (24%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P    G I  PL+++    G    + +A +   E +Q A T+Y VL      
Sbjct  174  YWAVVVGRPDPMSGEIDQPLARLGAGPGS---ITIAADRNDEDAQSARTDYEVLDSAARK  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             SW+ L P   R HQLRVHC E+LGTPI+GD KYG                         
Sbjct  231  FSWLGLSPLTGRTHQLRVHC-ESLGTPILGDPKYGG------------------------  265

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIA  170
                     K  V      LHLH R LVLP+ A
Sbjct  266  --------DKAHVDGFADRLHLHARSLVLPHPA  290



>ref|WP_008837745.1| pseudouridine synthase [Mesorhizobium alhagi]
 gb|EHK55285.1| RluA family pseudouridine synthase [Mesorhizobium alhagi CCNWXJ12-2]
Length=328

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 87/199 (44%), Gaps = 57/199 (29%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWALV G PK++E  I   L K    +G  +RV +AQ+   + +  AV+ YR+L      
Sbjct  177  YWALVKGVPKKREDKISTWLIKEPTPDG--DRVRVAQHGE-KGADHAVSYYRILEQAGQT  233

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             SW+E+ PH  R HQLRVH A  +G PI+GD KY                E  T   +  
Sbjct  234  MSWLEMEPHTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEADTNWDF--  275

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
                      G V ++   LHLH R + +P+  K                         +
Sbjct  276  ---------PGGVQNR---LHLHARRIRIPHPDK------------------------GV  299

Query  88   LRFVAPMPSHMKISWNLMS  32
            +   APMP HM+ SWNL+ 
Sbjct  300  IDVTAPMPPHMRQSWNLIG  318



>ref|WP_014891235.1| pseudouridine synthase [Methylocystis sp. SC2]
 emb|CCJ07206.1| Pseudouridine synthase [Methylocystis sp. SC2]
Length=356

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 93/205 (45%), Gaps = 53/205 (26%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLIC------APLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVL  467
            YWALV G PK  +G I       A + K      + E++ +A++   +A Q ++T Y ++
Sbjct  184  YWALVEGVPKPAQGRISLYLAKGAGMEKSRGGARELEKMRVAKHGEADA-QHSLTYYAIV  242

Query  466  GPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTT  287
              +   C+W+ ++P   R HQLR H AEA+G PI GD KYG   H+   ++ R D     
Sbjct  243  DKVAPRCAWLSMKPLTGRTHQLRAH-AEAIGHPIFGDPKYG---HRPEDEVRRRD-----  293

Query  286  GEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDT  107
              P R   PEGLD +          LHL  R LVLP+                       
Sbjct  294  --PLRA-MPEGLDRK----------LHLLARRLVLPH-----------------------  317

Query  106  VSKPDLLRFVAPMPSHMKISWNLMS  32
              K  ++   AP+P HMK SW L  
Sbjct  318  -PKGGVIDVTAPLPDHMKKSWELFG  341



>ref|WP_040970394.1| pseudouridine synthase [Mesorhizobium sp. ORS3324]
 emb|CDX14207.1| Pseudouridine synthase [Mesorhizobium sp. ORS3324]
Length=328

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 92/208 (44%), Gaps = 61/208 (29%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G P ++E  I   L K    +G  +RV +A++   + +  AV+ YR+
Sbjct  170  ARETKKTYWALVKGVPPKREDKISTWLIKEQTPDG--DRVRIAKHGE-KGADHAVSYYRI  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY                E  
Sbjct  227  VEQAAQSLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEAD  270

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T   +    P G+  +          LHLH R +V+P+                      
Sbjct  271  TNWEF----PGGIQNR----------LHLHARRIVIPH----------------------  294

Query  109  TVSKPD--LLRFVAPMPSHMKISWNLMS  32
                PD  ++  VAPMP HM+ SWNL+ 
Sbjct  295  ----PDQGVIDVVAPMPPHMRQSWNLLG  318



>ref|WP_010544344.1| pseudouridine synthase [Sphingomonas elodea]
Length=367

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S +   + YWALV+G P  ++G I  P+ K     G+  +V + + S       A T YR
Sbjct  174  SGRTARKIYWALVMGVPDIEDGFIELPIGKQPGTGGEKMQVDMEEGS------PARTRYR  227

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+    N C+W+EL+P   R HQLRVH A A+G PIVGD KYG
Sbjct  228  VIEQAGNRCAWVELQPFTGRTHQLRVHMA-AIGHPIVGDGKYG  269



>ref|WP_024924791.1| MULTISPECIES: pseudouridine synthase [Mesorhizobium]
Length=327

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 89/206 (43%), Gaps = 57/206 (28%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G P ++E  I   L K    +G  +RV +A++   + +  AV+ YRV
Sbjct  171  ARETKKTYWALVKGVPPKREDKISTWLVKEPTPDG--DRVRVAKHGE-KGADHAVSYYRV  227

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY                E  
Sbjct  228  VEQAAQSLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEAD  271

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T   +    P G+  +          LHLH R +V+P+  K                   
Sbjct  272  TNWDF----PGGMQNR----------LHLHARRIVIPHPDK-------------------  298

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMS  32
                   +   APMP HM+ SWNL+ 
Sbjct  299  -----GFVDVTAPMPPHMRQSWNLLG  319



>ref|WP_026203778.1| pseudouridine synthase [Rhizobium giardinii]
Length=330

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 91/203 (45%), Gaps = 57/203 (28%)
 Frame = -2

Query  640  TYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP  461
            T + YWALV G P+++E  I   L K    +G  +R+ +A++   + +  A++ YR++  
Sbjct  174  TKKTYWALVKGVPRKREDKISTWLVKEQTPDG--DRMRIAKHGE-DGADHAISYYRIVEQ  230

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE  281
                 +W+E+ P+  R HQLRVH A  +G PI+GD KY              + EP+   
Sbjct  231  AGQNFAWLEMEPYTGRTHQLRVHAAH-IGHPIIGDPKY-------------FEAEPSWAF  276

Query  280  PYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVS  101
            P             G V ++   LHLH R + +P        H +  R            
Sbjct  277  P-------------GGVQNR---LHLHARHIDIP--------HPDGGR------------  300

Query  100  KPDLLRFVAPMPSHMKISWNLMS  32
                LR  APMP HM  SWNL+ 
Sbjct  301  ----LRISAPMPQHMVQSWNLIG  319



>ref|WP_042642232.1| pseudouridine synthase [Mesorhizobium sp. ORS3359]
 emb|CDX35593.1| Pseudouridine synthase [Mesorhizobium sp. ORS3359]
Length=326

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 91/208 (44%), Gaps = 61/208 (29%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             + T + YWALV G P ++E  I   L K    +G  +RV +A++   + +  AV+ YRV
Sbjct  170  ARETKKTYWALVKGVPPKREDKISTWLVKEATPDG--DRVRVAKHGE-KGADHAVSYYRV  226

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +       SW+E+ P+  R HQLRVH A  +G PI+GD KY                E  
Sbjct  227  VEQAAQSLSWLEMEPYTGRTHQLRVHAAH-IGCPIIGDPKY---------------FEAD  270

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
            T   +    P G+  +          LHLH R +V+P+                      
Sbjct  271  TNWEF----PGGIQNR----------LHLHARRIVIPH----------------------  294

Query  109  TVSKPD--LLRFVAPMPSHMKISWNLMS  32
                PD  ++   APMP HM+ SWNL+ 
Sbjct  295  ----PDQGVIDVTAPMPPHMRQSWNLLG  318



>ref|WP_034504892.1| pseudouridine synthase [Agrobacterium rhizogenes]
Length=332

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 87/203 (43%), Gaps = 57/203 (28%)
 Frame = -2

Query  640  TYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGP  461
            T + YW+LV G P++ E  I   L K    +G  +R+ +A++   E +  A+T YRVL  
Sbjct  175  TKKTYWSLVKGVPRKHEDKISTWLVKEATPDG--DRMRIAKHGE-EGADHAITYYRVLEM  231

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGE  281
                 +W+E+ P+  R HQLRVH    +G PI+GD KY              D +P    
Sbjct  232  AAQSLAWLEMEPYTGRTHQLRVHALH-MGHPIIGDPKY-------------FDDDPNWDF  277

Query  280  PYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVS  101
            P             G V  +   LHLH R + +P        H N  R            
Sbjct  278  P-------------GGVQKR---LHLHARHIDIP--------HPNGGR------------  301

Query  100  KPDLLRFVAPMPSHMKISWNLMS  32
                LR  AP+P HM  +WNL+ 
Sbjct  302  ----LRVTAPLPPHMVQTWNLLG  320



>ref|WP_036306420.1| membrane protein [Methylopila sp. 73B]
Length=338

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 88/199 (44%), Gaps = 56/199 (28%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWAL  G P+ K+G I   L+K   D  + ER+ +A +    AS  A+T Y V+  +   
Sbjct  181  YWALAPGVPRVKQGRISTYLAKGEGDGPEGERMQVASHGDAGASH-ALTYYAVVDQVGQK  239

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             +W+ L+P   R HQLR HCA  +G PIVGD KY  F  + W ++P              
Sbjct  240  MAWLSLKPVTGRTHQLRAHCAH-IGHPIVGDPKY--FNIENW-ELP--------------  281

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
                      G + ++   LHL  R LV+P                        +   D+
Sbjct  282  ----------GGIQNR---LHLLARRLVIP------------------------LPSGDM  304

Query  88   LRFVAPMPSHMKISWNLMS  32
            L   AP+P HM+ SWNL+ 
Sbjct  305  LDVSAPLPPHMQQSWNLLG  323



>ref|WP_012226160.1| pseudouridine synthase [Gluconacetobacter diazotrophicus]
 emb|CAP56217.1| putative ribosomal large subunit pseudouridine synthase A [Gluconacetobacter 
diazotrophicus PA1 5]
 gb|ACI50288.1| pseudouridine synthase, RluA family [Gluconacetobacter diazotrophicus 
PA1 5]
Length=325

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 70/153 (46%), Gaps = 36/153 (24%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P    G+I  PL++  L  G     ++A     +A+  A++EY VL      
Sbjct  175  YWAIVVGRPSPASGVIDQPLAR--LGAGPGALTVVASRKDADAAH-ALSEYEVLDAAGRK  231

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             SW+ L P   R HQLRVHC EALGTPI+GD KYG                         
Sbjct  232  LSWLALSPLTGRTHQLRVHC-EALGTPILGDPKYGGDTAH--------------------  270

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIA  170
              PEG           V  LHLH R L LP+ A
Sbjct  271  --PEGF----------VDRLHLHARTLDLPHPA  291



>ref|WP_006834593.1| pseudouridine synthase [Erythrobacter sp. SD-21]
 gb|EDL47757.1| pseudouridylate synthase [Erythrobacter sp. SD-21]
Length=376

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = -2

Query  652  SCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYR  473
            S +   + YWALV+G P  ++G+I APL+K     G+   V        E    A T+YR
Sbjct  171  SGRSAKKIYWALVVGVPDIRQGVIEAPLAKQPGSGGEKMHV------DHEGGAPAKTKYR  224

Query  472  VLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            V+       +W+EL+P   R HQLRVHCA A+G PIVGD KYG
Sbjct  225  VVESAGKKVAWLELQPMTGRTHQLRVHCA-AMGHPIVGDGKYG  266



>ref|WP_015597654.1| pseudouridine synthase [Hyphomicrobium denitrificans]
 gb|AGK57619.1| pseudouridine synthase [Hyphomicrobium denitrificans 1NES1]
Length=326

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 84/206 (41%), Gaps = 57/206 (28%)
 Frame = -2

Query  649  CKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRV  470
             +   + YWALV G PK  +G + A L K    +G  +RV  A+    + +  A T Y V
Sbjct  171  TRSAAKTYWALVKGVPKPPQGKVEAALVKASGPDG--DRVRKAKPGEQDVAMHATTHYSV  228

Query  469  LGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPT  290
            +    +  +W+ L+P   R+HQLR H    +G PIVGD KY   VH     MP  +IE  
Sbjct  229  IDRAAHKAAWVSLKPVTGRQHQLRAHM-HLIGHPIVGDNKYEGDVH-----MPAENIEKK  282

Query  289  TGEPYRMRRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSD  110
                                      LHLH R LV+P        H    +         
Sbjct  283  --------------------------LHLHARRLVIP--------HPKGGK---------  299

Query  109  TVSKPDLLRFVAPMPSHMKISWNLMS  32
                  ++   AP+P+HM  SW L+ 
Sbjct  300  ------IIDVTAPLPAHMAASWELLG  319



>ref|WP_023977683.1| MULTISPECIES: pseudouridine synthase [Asaia]
 gb|ETC99649.1| pseudouridine synthase [Asaia sp. SF2.1]
 emb|CDG38464.1| Ribosomal large subunit pseudouridine synthase C [Asaia platycodi 
SF2.1]
Length=331

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 81/196 (41%), Gaps = 60/196 (31%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWA+V+G P    G+I  PL+K+   NG    +++A     E +  A T+Y V+      
Sbjct  174  YWAIVVGRPMPGSGVIDQPLAKLGAGNGA---LMIAATRDDEDAVVAKTDYEVVDAAGKR  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKWKQMPRVDIEPTTGEPYRM  269
             SW+ L+P   R HQLRVHC E LGTPI+GD KYG     K   M               
Sbjct  231  LSWLALKPLTGRTHQLRVHC-ETLGTPILGDPKYGG----KAAHM---------------  270

Query  268  RRPEGLDVQKGSVLSKVPLLHLHCRELVLPNIAKFLELHSNSNRSRNYNVKSDTVSKPDL  89
               EG           +  LHLH R L  P        H    R                
Sbjct  271  ---EGF----------IDRLHLHARALEFP--------HPAGGR----------------  293

Query  88   LRFVAPMPSHMKISWN  41
            LR  AP+P HM+ ++ 
Sbjct  294  LRVAAPLPPHMRDTFK  309



>emb|CCQ75210.1| putative RNA pseudouridine synthase [Magnetospira sp. QH-2]
Length=215

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWA+V G+P   EG+I  P+ K+    G   R++ A +      Q AV+ Y+ LG   
Sbjct  81   KTYWAVVTGAPTPPEGIIDRPIKKLS-TKGSGWRMVTAADG-----QRAVSAYQTLGRSD  134

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            +G +W+EL P   R HQ+RVHCA A+G PI+GD +YG
Sbjct  135  DGLAWLELNPRTGRTHQIRVHCA-AVGCPIMGDEQYG  170



>ref|WP_007435118.1| pseudouridine synthase [Acetobacteraceae bacterium AT-5844]
 gb|EHM02820.1| pseudouridine synthase, RluA family [Acetobacteraceae bacterium 
AT-5844]
Length=326

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 6/121 (5%)
 Frame = -2

Query  706  LVLSDLKKKKFQSQAWDDSCKVTYRRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVI  527
            L+  D +   F ++A+    +   + YWA+V+G P+ + G I  PL+K      + ERV+
Sbjct  151  LLARDQRAASFLAKAF--RSRDAKKTYWAIVVGQPQYEAGRIDMPLAKQG-GGPQGERVV  207

Query  526  LAQNSRLEASQDAVTEYRVLGPMINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKY  347
             A+    +    AVTEY          +W+EL P   R HQLRVHCA AL TPI+GD KY
Sbjct  208  PAEG---KEGAFAVTEYTTRDVARRHATWLELHPLTGRTHQLRVHCASALETPILGDGKY  264

Query  346  G  344
            G
Sbjct  265  G  265



>ref|WP_008492315.1| pseudouridine synthase [Acidocella sp. MX-AZ02]
 gb|EKN01147.1| pseudouridine synthase [Acidocella sp. MX-AZ02]
Length=327

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWAL++G P   EG I  PL ++  D G+T R   A     EA Q A+T+YR+L      
Sbjct  174  YWALLVGLPDALEGRIDLPLKRI--DLGQTSRAEPASRKDKEA-QKAITDYRILDKAGRK  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKW  323
                EL PH  R HQLR HC  ALGTPI+GD  YG   H+ +
Sbjct  231  FCLAELSPHTGRMHQLRAHCL-ALGTPILGDEVYGSAYHEHF  271



>emb|CBS90560.1| Pseudouridine synthase [Azospirillum lipoferum 4B]
Length=235

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 56/97 (58%), Gaps = 4/97 (4%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWA+  G P  + G+I  PL K +          +  +    A Q AVTEYRVLG   
Sbjct  94   KTYWAVADGIPDAESGVIDLPLLKRIEPGASRSSWTILPDP---AGQPAVTEYRVLGTGA  150

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            +G SW+ELRP   R HQ+RVHCA A+G P+VG+  YG
Sbjct  151  DGRSWLELRPRTGRTHQIRVHCA-AIGCPLVGEPFYG  186



>ref|WP_026440287.1| pseudouridine synthase [Acidocella facilis]
Length=327

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMING  449
            YWAL++G P   EG I  PL ++  D G+T R   A     EA Q A+T+YR+L      
Sbjct  174  YWALLVGLPDALEGRIDLPLKRI--DLGQTSRAEPASRKDKEA-QKAITDYRILDKAGRK  230

Query  448  CSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYGWFVHKKW  323
                EL PH  R HQLR HC  ALGTPI+GD  YG   H+ +
Sbjct  231  FCLAELSPHTGRMHQLRAHCL-ALGTPILGDEVYGSAYHEHF  271



>ref|WP_044553313.1| pseudouridine synthase [Azospirillum lipoferum]
Length=231

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 56/97 (58%), Gaps = 4/97 (4%)
 Frame = -2

Query  634  RRYWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQDAVTEYRVLGPMI  455
            + YWA+  G P  + G+I  PL K +          +  +    A Q AVTEYRVLG   
Sbjct  90   KTYWAVADGIPDAESGVIDLPLLKRIEPGASRSSWTILPDP---AGQPAVTEYRVLGTGA  146

Query  454  NGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            +G SW+ELRP   R HQ+RVHCA A+G P+VG+  YG
Sbjct  147  DGRSWLELRPRTGRTHQIRVHCA-AIGCPLVGEPFYG  182



>ref|WP_009541243.1| Ribosomal large subunit pseudouridine synthase C [Caenispirillum 
salinarum]
 gb|EKV29278.1| Ribosomal large subunit pseudouridine synthase C [Caenispirillum 
salinarum AK4]
Length=325

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 15/99 (15%)
 Frame = -2

Query  628  YWALVIGSPKEKEGLICAPLSKVVLDNGKTERVILAQNSRLEASQD----AVTEYRVLGP  461
            YWA+V+G+PK  EG + APL+K     G+          R+E  +D    AVT +R +  
Sbjct  175  YWAVVVGAPKPSEGRLSAPLAKAPGKAGE----------RMEVDEDWGKPAVTVFRTVEA  224

Query  460  MINGCSWIELRPHASRKHQLRVHCAEALGTPIVGDYKYG  344
            +    +W+E+ P   R HQLRVH A A+GTPI+GD KYG
Sbjct  225  VAGKAAWLEMEPLTGRTHQLRVHAA-AMGTPILGDGKYG  262



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485