BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051C08

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010556278.1|  PREDICTED: uncharacterized protein LOC104825617    114   3e-27   Tarenaya hassleriana [spider flower]
emb|CDP16686.1|  unnamed protein product                                113   5e-27   Coffea canephora [robusta coffee]
ref|XP_004145671.1|  PREDICTED: uncharacterized protein LOC101216973    109   1e-25   Cucumis sativus [cucumbers]
pdb|3BBN|U  Chain U, Homology Model For The Spinach Chloroplast 3...    109   2e-25   Spinacia oleracea
ref|XP_009111557.1|  PREDICTED: uncharacterized protein LOC103836981    107   6e-25   Brassica rapa
ref|XP_007031852.1|  Ribosomal protein S21 family protein isoform 1     107   6e-25   
ref|XP_007215062.1|  hypothetical protein PRUPE_ppa012283mg             107   6e-25   Prunus persica
ref|XP_011098868.1|  PREDICTED: uncharacterized protein LOC105177419    107   6e-25   Sesamum indicum [beniseed]
ref|XP_008450090.1|  PREDICTED: uncharacterized protein LOC103491780    107   7e-25   
emb|CDY20060.1|  BnaA09g01910D                                          107   7e-25   Brassica napus [oilseed rape]
ref|XP_010029006.1|  PREDICTED: WAS protein family homolog 1-like       107   8e-25   Eucalyptus grandis [rose gum]
emb|CDY00166.1|  BnaC09g01350D                                          107   9e-25   
ref|XP_004233297.1|  PREDICTED: uncharacterized protein LOC101248838    107   1e-24   Solanum lycopersicum
ref|XP_006357191.1|  PREDICTED: uncharacterized protein LOC102602305    107   2e-24   Solanum tuberosum [potatoes]
ref|XP_009596045.1|  PREDICTED: uncharacterized protein LOC104092213    106   2e-24   Nicotiana tomentosiformis
emb|CAN82190.1|  hypothetical protein VITISV_031115                     106   2e-24   Vitis vinifera
ref|XP_009129445.1|  PREDICTED: uncharacterized protein LOC103854264    105   3e-24   Brassica rapa
ref|XP_002268728.2|  PREDICTED: uncharacterized protein LOC100241260    106   4e-24   Vitis vinifera
ref|XP_010034667.1|  PREDICTED: uncharacterized protein LOC104423937    104   4e-24   
gb|EYU45400.1|  hypothetical protein MIMGU_mgv1a014829mg                105   4e-24   Erythranthe guttata [common monkey flower]
emb|CDY34174.1|  BnaA02g28660D                                          105   4e-24   Brassica napus [oilseed rape]
ref|XP_006447081.1|  hypothetical protein CICLE_v10016867mg             105   5e-24   Citrus clementina [clementine]
gb|KDO63954.1|  hypothetical protein CISIN_1g030105mg                   105   5e-24   Citrus sinensis [apfelsine]
ref|XP_006395478.1|  hypothetical protein EUTSA_v10004988mg             104   1e-23   Eutrema salsugineum [saltwater cress]
gb|KCW53039.1|  hypothetical protein EUGRSUZ_J02332                     103   2e-23   Eucalyptus grandis [rose gum]
ref|XP_008231132.1|  PREDICTED: uncharacterized protein LOC103330346    103   2e-23   Prunus mume [ume]
gb|KHG24194.1|  30S ribosomal S21, chloroplastic                        103   2e-23   Gossypium arboreum [tree cotton]
ref|XP_009776818.1|  PREDICTED: uncharacterized protein LOC104226503    103   2e-23   Nicotiana sylvestris
ref|XP_010111583.1|  30S ribosomal protein S21                          103   3e-23   Morus notabilis
ref|XP_010554107.1|  PREDICTED: uncharacterized protein LOC104823979    102   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_002875359.1|  hypothetical protein ARALYDRAFT_484499             102   5e-23   Arabidopsis lyrata subsp. lyrata
emb|CDY28492.1|  BnaC02g36680D                                          102   6e-23   Brassica napus [oilseed rape]
ref|XP_006290382.1|  hypothetical protein CARUB_v10018089mg             102   8e-23   Capsella rubella
ref|XP_010680113.1|  PREDICTED: uncharacterized protein LOC104895343    101   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011003928.1|  PREDICTED: uncharacterized protein LOC105110550    101   1e-22   Populus euphratica
ref|XP_006604143.1|  PREDICTED: uncharacterized protein LOC100780245    100   2e-22   
ref|XP_002300102.1|  GLUCOSE HYPERSENSITIVE 1 family protein            100   2e-22   Populus trichocarpa [western balsam poplar]
gb|KJB76406.1|  hypothetical protein B456_012G087400                    100   4e-22   Gossypium raimondii
ref|XP_002509528.1|  structural constituent of ribosome, putative       100   4e-22   Ricinus communis
ref|XP_008341307.1|  PREDICTED: uncharacterized protein LOC103404196  99.8    6e-22   
gb|KJB33968.1|  hypothetical protein B456_006G041200                  99.4    8e-22   Gossypium raimondii
gb|KHG22618.1|  30S ribosomal S21, chloroplastic                      99.4    8e-22   Gossypium arboreum [tree cotton]
gb|KDP46290.1|  hypothetical protein JCGZ_10130                       99.4    9e-22   Jatropha curcas
ref|XP_010026761.1|  PREDICTED: PERQ amino acid-rich with GYF dom...  98.2    3e-21   Eucalyptus grandis [rose gum]
gb|AAK64005.1|  AT3g27160/MYF5_3                                      97.8    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566809.1|  plastid ribosomal protein S21                       97.8    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514403.1|  PREDICTED: uncharacterized protein LOC104790...  97.8    4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008341156.1|  PREDICTED: uncharacterized protein LOC103404079  97.1    4e-21   
ref|XP_008379756.1|  PREDICTED: uncharacterized protein LOC103442719  98.2    4e-21   
ref|XP_009371656.1|  PREDICTED: uncharacterized protein LOC103960893  97.4    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_007151530.1|  hypothetical protein PHAVU_004G054500g           97.1    5e-21   Phaseolus vulgaris [French bean]
gb|KFK33636.1|  hypothetical protein AALP_AA5G039500                  97.4    5e-21   Arabis alpina [alpine rockcress]
ref|XP_010502676.1|  PREDICTED: uncharacterized protein LOC104779942  97.4    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010425453.1|  PREDICTED: uncharacterized protein LOC104710534  97.4    6e-21   Camelina sativa [gold-of-pleasure]
gb|KCW45061.1|  hypothetical protein EUGRSUZ_L013361                  95.5    9e-21   Eucalyptus grandis [rose gum]
ref|XP_010040601.1|  PREDICTED: PERQ amino acid-rich with GYF dom...  95.5    2e-20   Eucalyptus grandis [rose gum]
ref|XP_007161737.1|  hypothetical protein PHAVU_001G094500g           94.7    4e-20   Phaseolus vulgaris [French bean]
ref|XP_009803782.1|  PREDICTED: uncharacterized protein LOC104249101  93.2    1e-19   Nicotiana sylvestris
ref|XP_010248820.1|  PREDICTED: uncharacterized protein LOC104591611  93.6    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_004303982.1|  PREDICTED: uncharacterized protein LOC101292725  90.5    1e-18   Fragaria vesca subsp. vesca
gb|KHN47278.1|  30S ribosomal protein S21, chloroplastic              90.5    1e-18   Glycine soja [wild soybean]
ref|XP_003524616.1|  PREDICTED: uncharacterized protein LOC100777...  90.1    2e-18   Glycine max [soybeans]
ref|XP_006579865.1|  PREDICTED: uncharacterized protein LOC100777...  90.1    2e-18   Glycine max [soybeans]
ref|XP_003553848.1|  PREDICTED: uncharacterized protein LOC100790222  89.0    5e-18   Glycine max [soybeans]
gb|AFK33554.1|  unknown                                               88.6    7e-18   Lotus japonicus
ref|XP_011084004.1|  PREDICTED: uncharacterized protein LOC105166362  88.2    1e-17   Sesamum indicum [beniseed]
ref|XP_007037881.1|  Ribosomal protein S21 family protein, putative   87.4    3e-17   
ref|XP_010252601.1|  PREDICTED: uncharacterized protein LOC104594134  85.9    7e-17   Nelumbo nucifera [Indian lotus]
gb|EPS57315.1|  hypothetical protein M569_17505                       84.3    2e-16   Genlisea aurea
ref|XP_010932294.1|  PREDICTED: uncharacterized protein LOC105052998  84.7    2e-16   Elaeis guineensis
ref|XP_010928402.1|  PREDICTED: uncharacterized protein LOC105050179  84.3    2e-16   Elaeis guineensis
gb|KJB08063.1|  hypothetical protein B456_001G061300                  83.2    3e-16   Gossypium raimondii
gb|KJB08062.1|  hypothetical protein B456_001G061300                  83.6    4e-16   Gossypium raimondii
ref|XP_006440037.1|  hypothetical protein CICLE_v10022507mg           80.9    2e-15   Citrus clementina [clementine]
ref|XP_009413349.1|  PREDICTED: uncharacterized protein LOC103994667  80.9    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS70276.1|  hypothetical protein M569_04486                       79.3    4e-15   Genlisea aurea
ref|XP_007210632.1|  hypothetical protein PRUPE_ppa019736mg           80.5    4e-15   
ref|XP_006440038.1|  hypothetical protein CICLE_v10022507mg           80.5    5e-15   Citrus clementina [clementine]
ref|XP_008239415.1|  PREDICTED: uncharacterized protein LOC103338015  80.1    6e-15   Prunus mume [ume]
gb|KHG26110.1|  Telomere length regulation TEL2                       84.7    6e-15   Gossypium arboreum [tree cotton]
ref|XP_010907771.1|  PREDICTED: uncharacterized protein LOC105034343  80.1    7e-15   Elaeis guineensis
ref|XP_010943224.1|  PREDICTED: uncharacterized protein LOC105061012  80.1    7e-15   Elaeis guineensis
ref|XP_008806074.1|  PREDICTED: uncharacterized protein LOC103718855  79.7    9e-15   Phoenix dactylifera
ref|XP_009383907.1|  PREDICTED: forkhead box protein L2-like          80.5    1e-14   
ref|XP_008799941.1|  PREDICTED: uncharacterized protein LOC103714466  79.0    2e-14   Phoenix dactylifera
ref|XP_006579590.1|  PREDICTED: uncharacterized protein LOC102661132  78.6    2e-14   Glycine max [soybeans]
ref|XP_008797286.1|  PREDICTED: uncharacterized protein LOC103712519  77.8    4e-14   Phoenix dactylifera
ref|XP_009596110.1|  PREDICTED: uncharacterized protein LOC104092264  76.6    4e-14   
ref|XP_006858094.1|  hypothetical protein AMTR_s00062p00090380        74.3    9e-14   
ref|XP_006476971.1|  PREDICTED: uncharacterized protein LOC102620...  76.3    1e-13   Citrus sinensis [apfelsine]
ref|XP_006476970.1|  PREDICTED: uncharacterized protein LOC102620...  76.3    2e-13   
gb|ACJ86125.1|  unknown                                               75.9    2e-13   Medicago truncatula
ref|XP_011471081.1|  PREDICTED: uncharacterized protein LOC105353526  75.5    3e-13   Fragaria vesca subsp. vesca
gb|AFK48060.1|  unknown                                               73.6    5e-13   Lotus japonicus
ref|XP_009803010.1|  PREDICTED: uncharacterized protein LOC104248454  74.3    7e-13   Nicotiana sylvestris
ref|XP_009605265.1|  PREDICTED: uncharacterized protein LOC104099845  74.3    8e-13   Nicotiana tomentosiformis
ref|XP_004513195.1|  PREDICTED: uncharacterized protein LOC101488262  74.3    8e-13   Cicer arietinum [garbanzo]
ref|XP_003550088.1|  PREDICTED: uncharacterized protein LOC100812464  73.6    1e-12   Glycine max [soybeans]
ref|XP_006351501.1|  PREDICTED: uncharacterized protein LOC102594896  73.2    1e-12   Solanum tuberosum [potatoes]
ref|XP_001758442.1|  predicted protein                                71.2    6e-12   
gb|KHN10804.1|  26S protease regulatory subunit 7 like                72.0    1e-11   Glycine soja [wild soybean]
ref|XP_004236356.1|  PREDICTED: uncharacterized protein LOC101245...  70.5    1e-11   Solanum lycopersicum
ref|XP_010102885.1|  30S ribosomal protein S21                        69.7    2e-11   Morus notabilis
ref|XP_010696185.1|  PREDICTED: uncharacterized protein LOC104908732  69.3    3e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001778545.1|  predicted protein                                69.3    3e-11   
gb|KHM99282.1|  hypothetical protein glysoja_033980                   68.9    3e-11   Glycine soja [wild soybean]
ref|XP_002318697.2|  GLUCOSE HYPERSENSITIVE 1 family protein          68.9    5e-11   
ref|XP_004515839.1|  PREDICTED: uncharacterized protein LOC101494150  68.2    6e-11   Cicer arietinum [garbanzo]
ref|XP_011040428.1|  PREDICTED: uncharacterized protein LOC105136689  69.3    6e-11   Populus euphratica
gb|EYU43075.1|  hypothetical protein MIMGU_mgv1a019050mg              67.8    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_003571002.1|  PREDICTED: uncharacterized protein LOC100828601  65.9    3e-10   Brachypodium distachyon [annual false brome]
ref|XP_006394291.1|  hypothetical protein EUTSA_v10005605mg           65.1    1e-09   
ref|XP_004951625.1|  PREDICTED: pre-mRNA-splicing factor CWC25-like   63.5    2e-09   Setaria italica
ref|XP_009130247.1|  PREDICTED: uncharacterized protein LOC103855037  63.5    4e-09   
emb|CDY45737.1|  BnaC02g42450D                                        63.5    4e-09   Brassica napus [oilseed rape]
gb|AGE45653.1|  ribosomal protein S21                                 62.0    1e-08   Picea wilsonii
ref|XP_002864845.1|  hypothetical protein ARALYDRAFT_496513           62.4    1e-08   
gb|ABK24643.1|  unknown                                               62.0    1e-08   Picea sitchensis
ref|XP_001783859.1|  predicted protein                                62.0    1e-08   
ref|XP_006281636.1|  hypothetical protein CARUB_v10027766mg           62.4    2e-08   
ref|XP_010484055.1|  PREDICTED: uncharacterized protein LOC104762471  61.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010460099.1|  PREDICTED: uncharacterized protein LOC104741032  61.2    2e-08   
ref|NP_201135.2|  ribosomal protein S21 family protein                61.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD42889.1|  unknown protein                                      61.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444212.1|  PREDICTED: uncharacterized protein LOC104726937  61.6    3e-08   Camelina sativa [gold-of-pleasure]
gb|EMT05649.1|  30S ribosomal protein S21                             60.5    3e-08   
ref|NP_001119483.1|  ribosomal protein S21 family protein             61.6    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28045.1|  hypothetical protein AALP_AA8G464400                  60.5    4e-08   Arabis alpina [alpine rockcress]
gb|EMS67516.1|  30S ribosomal protein S21                             60.5    4e-08   Triticum urartu
ref|NP_001281222.1|  LOC100284221 precursor                           59.7    5e-08   Zea mays [maize]
gb|KHN35930.1|  hypothetical protein glysoja_048563                   59.7    6e-08   Glycine soja [wild soybean]
gb|ACG39658.1|  ribosome-like protein                                 59.7    7e-08   Zea mays [maize]
ref|NP_001151834.1|  ribosome-like protein                            59.3    8e-08   Zea mays [maize]
gb|KHN01268.1|  hypothetical protein glysoja_045178                   58.9    1e-07   Glycine soja [wild soybean]
ref|XP_004157766.1|  PREDICTED: uncharacterized protein LOC101226284  58.9    2e-07   
ref|XP_004152510.1|  PREDICTED: uncharacterized protein LOC101211863  58.9    2e-07   
ref|NP_001046138.1|  Os02g0189000                                     58.2    2e-07   
ref|XP_003608899.1|  30S ribosomal protein S21                        58.2    2e-07   Medicago truncatula
ref|XP_010695951.1|  PREDICTED: uncharacterized protein LOC104908...  57.4    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003556829.1|  PREDICTED: katanin p60 ATPase-containing sub...  60.1    3e-07   
ref|XP_008439325.1|  PREDICTED: uncharacterized protein LOC103484145  57.4    6e-07   Cucumis melo [Oriental melon]
ref|XP_006647009.1|  PREDICTED: pre-mRNA-splicing factor CWC25-like   56.6    8e-07   Oryza brachyantha
sp|P82024.1|RR21_SPIOL  RecName: Full=30S ribosomal protein S21, ...  54.3    1e-06   
ref|XP_004236357.1|  PREDICTED: uncharacterized protein LOC101245...  55.1    2e-06   Solanum lycopersicum
ref|XP_001755640.1|  predicted protein                                55.1    4e-06   
ref|XP_002986350.1|  hypothetical protein SELMODRAFT_446607           54.7    5e-06   Selaginella moellendorffii
ref|XP_002979101.1|  hypothetical protein SELMODRAFT_444102           54.3    1e-05   Selaginella moellendorffii
ref|XP_005849533.1|  hypothetical protein CHLNCDRAFT_142894           52.8    2e-05   Chlorella variabilis
ref|XP_011402006.1|  hypothetical protein F751_6476                   51.6    4e-05   Auxenochlorella protothecoides
gb|ABK26425.1|  unknown                                               49.7    2e-04   Picea sitchensis
ref|XP_003057077.1|  predicted protein                                48.9    3e-04   Micromonas pusilla CCMP1545
ref|XP_002502355.1|  predicted protein                                48.5    3e-04   Micromonas commoda



>ref|XP_010556278.1| PREDICTED: uncharacterized protein LOC104825617 [Tarenaya hassleriana]
Length=182

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = -1

Query  589  SPLSGNSELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            SP S +SEL SV+CPSLA+ANTLFFSS YNV+++VD +EPEERLLNRFRREVM+ G++QE
Sbjct  59   SPASLSSELASVICPSLAYANTLFFSSGYNVQVLVDENEPEERLLNRFRREVMRAGVVQE  118

Query  412  CKRRRYFEN  386
            CKRRRYFEN
Sbjct  119  CKRRRYFEN  127



>emb|CDP16686.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 71/92 (77%), Gaps = 8/92 (9%)
 Frame = -1

Query  640  DGWAPLVKTADNQQQYPSPLSG------NSELMSVVCPSLAHANTLFF-SSYNVELIVDG  482
            DG A    T    QQY  PLS       N+ELMSVVCPSLA+ANTLFF S+YNV+++VD 
Sbjct  42   DGLALAAATRLENQQY-LPLSSSTDNDLNNELMSVVCPSLAYANTLFFRSAYNVQVLVDE  100

Query  481  DEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            +EPEE+LLNRFRREVM+ G+IQECKRRR+FEN
Sbjct  101  NEPEEKLLNRFRREVMRAGVIQECKRRRFFEN  132



>ref|XP_004145671.1| PREDICTED: uncharacterized protein LOC101216973 [Cucumis sativus]
 ref|XP_004168695.1| PREDICTED: uncharacterized protein LOC101228071 [Cucumis sativus]
 gb|KGN58186.1| hypothetical protein Csa_3G588450 [Cucumis sativus]
Length=183

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 6/78 (8%)
 Frame = -1

Query  607  NQQQYPS---PLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRRE  440
            N QQ P+   PLS   EL SV+CPSLA+ANT+FF S+YNV+++VD +EPEERLLNRFRRE
Sbjct  53   NPQQGPNHSEPLSA--ELASVICPSLAYANTMFFRSAYNVQVVVDDNEPEERLLNRFRRE  110

Query  439  VMKTGLIQECKRRRYFEN  386
            VM+ G+IQECKRRR+FEN
Sbjct  111  VMRAGVIQECKRRRFFEN  128



>pdb|3BBN|U Chain U, Homology Model For The Spinach Chloroplast 30s Subunit 
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome.
 gb|AAL35983.1|AF104396_1 ribosome-like protein [Cucumis sativus]
Length=190

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 6/78 (8%)
 Frame = -1

Query  607  NQQQYPS---PLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRRE  440
            N QQ P+   PLS   EL SV+CPSLA+ANT+FF S+YNV+++VD +EPEERLLNRFRRE
Sbjct  60   NPQQGPNHSEPLSA--ELASVICPSLAYANTMFFRSAYNVQVVVDDNEPEERLLNRFRRE  117

Query  439  VMKTGLIQECKRRRYFEN  386
            VM+ G+IQECKRRR+FEN
Sbjct  118  VMRAGVIQECKRRRFFEN  135



>ref|XP_009111557.1| PREDICTED: uncharacterized protein LOC103836981 [Brassica rapa]
Length=180

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -1

Query  592  PSPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            PS  S +SEL SV+CPSLA+ANTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+I
Sbjct  51   PSNASISSELASVICPSLAYANTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVI  110

Query  418  QECKRRRYFEN  386
            QECKRRRYFEN
Sbjct  111  QECKRRRYFEN  121



>ref|XP_007031852.1| Ribosomal protein S21 family protein isoform 1 [Theobroma cacao]
 ref|XP_007031853.1| Ribosomal protein S21 family protein isoform 1 [Theobroma cacao]
 gb|EOY02778.1| Ribosomal protein S21 family protein isoform 1 [Theobroma cacao]
 gb|EOY02779.1| Ribosomal protein S21 family protein isoform 1 [Theobroma cacao]
Length=175

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 3/74 (4%)
 Frame = -1

Query  604  QQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKT  428
            Q+   S LS  +EL +V+CPSLA+ANTLFF S+YNV++IVD +EPEERLLNRFRREVM+ 
Sbjct  49   QEDQSSSLS--TELSAVICPSLAYANTLFFKSAYNVQVIVDDNEPEERLLNRFRREVMRA  106

Query  427  GLIQECKRRRYFEN  386
            G+IQECKRRR+FEN
Sbjct  107  GVIQECKRRRFFEN  120



>ref|XP_007215062.1| hypothetical protein PRUPE_ppa012283mg [Prunus persica]
 gb|EMJ16261.1| hypothetical protein PRUPE_ppa012283mg [Prunus persica]
Length=176

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 5/86 (6%)
 Frame = -1

Query  640  DGWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEER  464
            DG APL+         PS    +S + SV+CPSLA+ANTLFF S+YNV++IVD +EPEER
Sbjct  40   DGVAPLMAQGGPSAYGPS----SSSVESVICPSLAYANTLFFKSAYNVQVIVDDNEPEER  95

Query  463  LLNRFRREVMKTGLIQECKRRRYFEN  386
            LLNRFRREVM+ G+IQE KRRRYFEN
Sbjct  96   LLNRFRREVMRAGVIQETKRRRYFEN  121



>ref|XP_011098868.1| PREDICTED: uncharacterized protein LOC105177419 [Sesamum indicum]
Length=183

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 5/85 (6%)
 Frame = -1

Query  637  GWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERL  461
            G APLV  ++  Q  PS    ++++MSVVCPSLA+ANT+FF S+YNV++IVD +EPEE+L
Sbjct  48   GLAPLV-LSNEAQSLPS---CSADVMSVVCPSLAYANTMFFRSAYNVQVIVDDNEPEEKL  103

Query  460  LNRFRREVMKTGLIQECKRRRYFEN  386
            L RFRREVM+ G+IQECKRRR+FEN
Sbjct  104  LGRFRREVMRAGVIQECKRRRFFEN  128



>ref|XP_008450090.1| PREDICTED: uncharacterized protein LOC103491780 [Cucumis melo]
Length=183

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 6/76 (8%)
 Frame = -1

Query  601  QQYPS---PLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVM  434
            QQ P+   PLS   EL SV+CPSLA ANT+FF S+YNV++IVD +EPEERLLNRFRREVM
Sbjct  55   QQGPNHSEPLSA--ELASVICPSLAFANTMFFRSAYNVQVIVDDNEPEERLLNRFRREVM  112

Query  433  KTGLIQECKRRRYFEN  386
            + G+IQECKRRR+FEN
Sbjct  113  RAGVIQECKRRRFFEN  128



>emb|CDY20060.1| BnaA09g01910D [Brassica napus]
Length=180

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -1

Query  592  PSPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            PS  S +SEL SV+CPSLA++NTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+I
Sbjct  51   PSKASISSELASVICPSLAYSNTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVI  110

Query  418  QECKRRRYFEN  386
            QECKRRRYFEN
Sbjct  111  QECKRRRYFEN  121



>ref|XP_010029006.1| PREDICTED: WAS protein family homolog 1-like [Eucalyptus grandis]
 gb|KCW55839.1| hypothetical protein EUGRSUZ_I01653 [Eucalyptus grandis]
Length=179

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 1/63 (2%)
 Frame = -1

Query  571  SELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            SEL SV+CPSLA+ANTLFF S+YNV+LIV  +EPEERLLNRFRREVMK G+IQECKRRR+
Sbjct  62   SELSSVMCPSLAYANTLFFRSAYNVQLIVADNEPEERLLNRFRREVMKAGVIQECKRRRF  121

Query  394  FEN  386
            FEN
Sbjct  122  FEN  124



>emb|CDY00166.1| BnaC09g01350D [Brassica napus]
Length=181

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -1

Query  592  PSPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            PS  S +SEL SV+CPSLA++NTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+I
Sbjct  51   PSNASLSSELASVICPSLAYSNTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVI  110

Query  418  QECKRRRYFEN  386
            QECKRRRYFEN
Sbjct  111  QECKRRRYFEN  121



>ref|XP_004233297.1| PREDICTED: uncharacterized protein LOC101248838 [Solanum lycopersicum]
Length=185

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSG-NSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEP  473
            +ND  + +V + DN +    P+S  +S++M+V CPSLA+ANTL+F S+YNV++IV  +EP
Sbjct  42   NNDSSSMVVSSNDNHKYPILPVSSSDSDVMAVTCPSLAYANTLYFRSAYNVQVIVGDNEP  101

Query  472  EERLLNRFRREVMKTGLIQECKRRRYFEN  386
            EE+LL RFRREVM+ G+IQECKRRRYFEN
Sbjct  102  EEKLLGRFRREVMRAGVIQECKRRRYFEN  130



>ref|XP_006357191.1| PREDICTED: uncharacterized protein LOC102602305 [Solanum tuberosum]
Length=185

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSG-NSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEP  473
            +ND  + +V + DN +    P+S  +S++M+V CPSLA+ANTL+F S+YNV++IV  +EP
Sbjct  42   NNDSSSMVVSSNDNHKYPILPVSSSDSDVMAVTCPSLAYANTLYFRSAYNVQVIVGDNEP  101

Query  472  EERLLNRFRREVMKTGLIQECKRRRYFEN  386
            EE+LL RFRREVM+ G+IQECKRRRYFEN
Sbjct  102  EEKLLGRFRREVMRAGVIQECKRRRYFEN  130



>ref|XP_009596045.1| PREDICTED: uncharacterized protein LOC104092213 [Nicotiana tomentosiformis]
Length=173

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = -1

Query  616  TADNQQQYPSPLS-GNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRR  443
            T  N  +YP PLS  NS++ +VVCPSLA+ANTL+F S YNV++IVD +E EE+L+ RFRR
Sbjct  40   TPINNHKYPLPLSCSNSDVTTVVCPSLANANTLYFRSGYNVQVIVDDNEHEEKLVGRFRR  99

Query  442  EVMKTGLIQECKRRRYFEN  386
            EVM+ G+IQECKRRRYFEN
Sbjct  100  EVMRAGVIQECKRRRYFEN  118



>emb|CAN82190.1| hypothetical protein VITISV_031115 [Vitis vinifera]
Length=188

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 62/66 (94%), Gaps = 1/66 (2%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            S +S+LM+VVCPSLA++NTLFF S+YNV++IV+ +EPEE+LLNRFRREVM+ G+IQECKR
Sbjct  67   SSSSDLMAVVCPSLAYSNTLFFKSAYNVQVIVEDNEPEEKLLNRFRREVMRAGVIQECKR  126

Query  403  RRYFEN  386
            RR+FEN
Sbjct  127  RRFFEN  132



>ref|XP_009129445.1| PREDICTED: uncharacterized protein LOC103854264 [Brassica rapa]
Length=184

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = -1

Query  589  SPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQ  416
            S  S +SEL SV+CPSLA+ANTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+IQ
Sbjct  56   STASLSSELASVICPSLAYANTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQ  115

Query  415  ECKRRRYFEN  386
            ECKRRRYFEN
Sbjct  116  ECKRRRYFEN  125



>ref|XP_002268728.2| PREDICTED: uncharacterized protein LOC100241260 [Vitis vinifera]
Length=217

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 62/66 (94%), Gaps = 1/66 (2%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            S +S+LM+VVCPSLA++NTLFF S+YNV++IV+ +EPEE+LLNRFRREVM+ G+IQECKR
Sbjct  96   SSSSDLMAVVCPSLAYSNTLFFKSAYNVQVIVEDNEPEEKLLNRFRREVMRAGVIQECKR  155

Query  403  RRYFEN  386
            RR+FEN
Sbjct  156  RRFFEN  161



>ref|XP_010034667.1| PREDICTED: uncharacterized protein LOC104423937 [Eucalyptus grandis]
Length=148

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 5/74 (7%)
 Frame = -1

Query  592  PSPLSGN-----SELMSVVCPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKT  428
            P+PL+       SEL +VV P+LAHAN LFFS YNV++ VD +EPEERLLNRFRREVM+ 
Sbjct  47   PAPLAAAPGRLPSELTAVVNPALAHANALFFSGYNVQVTVDDNEPEERLLNRFRREVMRA  106

Query  427  GLIQECKRRRYFEN  386
            G+IQECKRRR+ EN
Sbjct  107  GVIQECKRRRFHEN  120



>gb|EYU45400.1| hypothetical protein MIMGU_mgv1a014829mg [Erythranthe guttata]
Length=177

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 10/85 (12%)
 Frame = -1

Query  637  GWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERL  461
            GW PL  +++         +   ++M VVCPSLA+ANT++F S+YNV++IVD +EP+ERL
Sbjct  48   GWGPLAVSSE---------AARDDVMQVVCPSLANANTMYFRSAYNVQVIVDDNEPDERL  98

Query  460  LNRFRREVMKTGLIQECKRRRYFEN  386
            L RFRREVM+ G+IQECKRR+YFEN
Sbjct  99   LGRFRREVMRAGIIQECKRRKYFEN  123



>emb|CDY34174.1| BnaA02g28660D [Brassica napus]
Length=183

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = -1

Query  589  SPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQ  416
            S  S +SEL SV+CPSLA+ANTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+IQ
Sbjct  55   STASLSSELASVICPSLAYANTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQ  114

Query  415  ECKRRRYFEN  386
            ECKRRRYFEN
Sbjct  115  ECKRRRYFEN  124



>ref|XP_006447081.1| hypothetical protein CICLE_v10016867mg [Citrus clementina]
 ref|XP_006470046.1| PREDICTED: uncharacterized protein LOC102628693 [Citrus sinensis]
 gb|ESR60321.1| hypothetical protein CICLE_v10016867mg [Citrus clementina]
Length=183

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = -1

Query  571  SELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            +EL SV+CPSLA+ANTLFF S+YNV+++VD +EPEERLLNRFRREVM+ G+IQECKRRR+
Sbjct  66   TELASVICPSLAYANTLFFKSAYNVQVVVDENEPEERLLNRFRREVMRAGVIQECKRRRF  125

Query  394  FE  389
            FE
Sbjct  126  FE  127



>gb|KDO63954.1| hypothetical protein CISIN_1g030105mg [Citrus sinensis]
 gb|KDO63955.1| hypothetical protein CISIN_1g030105mg [Citrus sinensis]
 gb|KDO63956.1| hypothetical protein CISIN_1g030105mg [Citrus sinensis]
 gb|KDO63957.1| hypothetical protein CISIN_1g030105mg [Citrus sinensis]
 gb|KDO63958.1| hypothetical protein CISIN_1g030105mg [Citrus sinensis]
Length=183

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = -1

Query  571  SELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            +EL SV+CPSLA+ANTLFF S+YNV+++VD +EPEERLLNRFRREVM+ G+IQECKRRR+
Sbjct  66   TELASVICPSLAYANTLFFKSAYNVQVVVDENEPEERLLNRFRREVMRAGVIQECKRRRF  125

Query  394  FE  389
            FE
Sbjct  126  FE  127



>ref|XP_006395478.1| hypothetical protein EUTSA_v10004988mg [Eutrema salsugineum]
 gb|ESQ32764.1| hypothetical protein EUTSA_v10004988mg [Eutrema salsugineum]
Length=182

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -1

Query  589  SPLSGNSELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            S  S +SE+ SV+CPSLA++NTLFFSS YNV++ V+ +E EERL+NRFRREVM+TG+IQE
Sbjct  56   STASLSSEISSVICPSLAYSNTLFFSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQE  115

Query  412  CKRRRYFEN  386
            CKRRRYFEN
Sbjct  116  CKRRRYFEN  124



>gb|KCW53039.1| hypothetical protein EUGRSUZ_J02332 [Eucalyptus grandis]
Length=174

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 5/74 (7%)
 Frame = -1

Query  592  PSPLSGN-----SELMSVVCPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKT  428
            P+PL+       SEL +VV P+LAHAN LFFS YNV++ VD +EPEERLLNRFRREVM+ 
Sbjct  47   PAPLAAAPGRLPSELTAVVNPALAHANALFFSGYNVQVTVDDNEPEERLLNRFRREVMRA  106

Query  427  GLIQECKRRRYFEN  386
            G+IQECKRRR+ EN
Sbjct  107  GVIQECKRRRFHEN  120



>ref|XP_008231132.1| PREDICTED: uncharacterized protein LOC103330346 [Prunus mume]
Length=179

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = -1

Query  640  DGWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEER  464
            DG APL+        Y    S +S + SV+CPSLA+ANTLFF S+YNV++IVD +EPEER
Sbjct  40   DGVAPLMAQG-GPSAYGPSSSSSSSVESVICPSLAYANTLFFKSAYNVQVIVDDNEPEER  98

Query  463  LLNRFRREVMKTGLIQECKRRRYFEN  386
            LLNRFRREVM+ G+IQE KRRRYFEN
Sbjct  99   LLNRFRREVMRAGVIQETKRRRYFEN  124



>gb|KHG24194.1| 30S ribosomal S21, chloroplastic [Gossypium arboreum]
Length=174

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA+ANTLFF S+YN+++IVD +EPEERLLNRFRREVMK G+IQECKRRR+FEN
Sbjct  62   VICPSLANANTLFFKSAYNIQVIVDDNEPEERLLNRFRREVMKAGVIQECKRRRFFEN  119



>ref|XP_009776818.1| PREDICTED: uncharacterized protein LOC104226503 [Nicotiana sylvestris]
Length=173

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -1

Query  616  TADNQQQYPSPLSG-NSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRR  443
            T  N  +YP  LS  NS++ +VVCPSLA+ANTL+F S YNV++IVD +E EE+L+ RFRR
Sbjct  40   TPINNHKYPLSLSSSNSDVTAVVCPSLANANTLYFRSGYNVQVIVDDNEHEEKLVGRFRR  99

Query  442  EVMKTGLIQECKRRRYFEN  386
            EVM+ G+IQECKRRRYFEN
Sbjct  100  EVMRAGVIQECKRRRYFEN  118



>ref|XP_010111583.1| 30S ribosomal protein S21 [Morus notabilis]
 gb|EXC31328.1| 30S ribosomal protein S21 [Morus notabilis]
Length=182

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = -1

Query  571  SELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            S L SV+CPSLA+ANTLFF S+YNV+++VD +EPEERLLNRFRREVM+ G+IQECKRRR+
Sbjct  63   SSLSSVICPSLAYANTLFFKSAYNVQVVVDDNEPEERLLNRFRREVMRAGVIQECKRRRF  122

Query  394  FEN  386
             EN
Sbjct  123  HEN  125



>ref|XP_010554107.1| PREDICTED: uncharacterized protein LOC104823979 [Tarenaya hassleriana]
Length=180

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYF  392
            EL SV+ PSLA+ANTLFFSS YNV+++VD +EPEERLLNRFRREVM+ G+IQECKRRR+F
Sbjct  66   ELASVIYPSLAYANTLFFSSGYNVQVLVDENEPEERLLNRFRREVMRAGVIQECKRRRFF  125

Query  391  EN  386
            EN
Sbjct  126  EN  127



>ref|XP_002875359.1| hypothetical protein ARALYDRAFT_484499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51618.1| hypothetical protein ARALYDRAFT_484499 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYF  392
            EL SV+CPSLA++NTLFFSS YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYF
Sbjct  64   ELASVICPSLAYSNTLFFSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYF  123

Query  391  EN  386
            EN
Sbjct  124  EN  125



>emb|CDY28492.1| BnaC02g36680D [Brassica napus]
Length=181

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = -1

Query  589  SPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQ  416
            S  S +SEL  V+CPSLA++NTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+IQ
Sbjct  53   STASLSSELAPVICPSLAYSNTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQ  112

Query  415  ECKRRRYFEN  386
            ECKRRRYFEN
Sbjct  113  ECKRRRYFEN  122



>ref|XP_006290382.1| hypothetical protein CARUB_v10018089mg [Capsella rubella]
 gb|EOA23280.1| hypothetical protein CARUB_v10018089mg [Capsella rubella]
Length=183

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYF  392
            EL SV+CPSLA++NTLFFSS YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYF
Sbjct  64   ELASVICPSLAYSNTLFFSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYF  123

Query  391  EN  386
            EN
Sbjct  124  EN  125



>ref|XP_010680113.1| PREDICTED: uncharacterized protein LOC104895343 [Beta vulgaris 
subsp. vulgaris]
Length=184

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYF  392
            +LM+VVCPSLA++NTLFF S+YNV+++VD +E EERLLNRFRREVM+ G+IQECKRRR+F
Sbjct  65   DLMAVVCPSLAYSNTLFFRSAYNVQVLVDENENEERLLNRFRREVMRAGVIQECKRRRFF  124

Query  391  EN  386
            EN
Sbjct  125  EN  126



>ref|XP_011003928.1| PREDICTED: uncharacterized protein LOC105110550 [Populus euphratica]
Length=176

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            S ++EL SVVCPSLA++NTLFF S+YNV++IV+ +EPEERLLNRFRREVM+ G+IQECKR
Sbjct  56   SLSTELSSVVCPSLAYSNTLFFKSAYNVQVIVEDNEPEERLLNRFRREVMRAGVIQECKR  115

Query  403  RRYFEN  386
            RR+ EN
Sbjct  116  RRFHEN  121



>ref|XP_006604143.1| PREDICTED: uncharacterized protein LOC100780245 [Glycine max]
Length=167

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 57/65 (88%), Gaps = 1/65 (2%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRR  401
             ++EL +V  PS AHANTLFF S+YNV+++VD +EPEERLLNRFRREVM+ G+IQECKRR
Sbjct  44   SSAELSAVANPSHAHANTLFFRSAYNVQVVVDENEPEERLLNRFRREVMRAGVIQECKRR  103

Query  400  RYFEN  386
            R+FEN
Sbjct  104  RFFEN  108



>ref|XP_002300102.1| GLUCOSE HYPERSENSITIVE 1 family protein [Populus trichocarpa]
 gb|ABK95607.1| unknown [Populus trichocarpa]
 gb|EEE84907.1| GLUCOSE HYPERSENSITIVE 1 family protein [Populus trichocarpa]
Length=176

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            S ++EL SVVCPSLA++NTLFF S+YNV+++V+ +EPEERLLNRFRREVM+ G+IQECKR
Sbjct  56   SLSTELSSVVCPSLAYSNTLFFKSAYNVQVVVEDNEPEERLLNRFRREVMRAGVIQECKR  115

Query  403  RRYFEN  386
            RR+ EN
Sbjct  116  RRFHEN  121



>gb|KJB76406.1| hypothetical protein B456_012G087400 [Gossypium raimondii]
Length=174

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+ PSLA+ANTLFF S+YN+++IVD +EPEERLLNRFRREVMK G+IQECKRRR+FEN
Sbjct  62   VISPSLANANTLFFKSAYNIQVIVDDNEPEERLLNRFRREVMKAGVIQECKRRRFFEN  119



>ref|XP_002509528.1| structural constituent of ribosome, putative [Ricinus communis]
 gb|EEF50915.1| structural constituent of ribosome, putative [Ricinus communis]
Length=175

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 1/66 (2%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            S ++EL S + PSLA+AN LFF S+YNV++IVD +EPEERLLNRFRREVM+ G+IQECKR
Sbjct  55   SLSTELSSAINPSLANANILFFRSAYNVQVIVDDNEPEERLLNRFRREVMRAGVIQECKR  114

Query  403  RRYFEN  386
            RR+FEN
Sbjct  115  RRFFEN  120



>ref|XP_008341307.1| PREDICTED: uncharacterized protein LOC103404196 [Malus domestica]
Length=173

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLAHAN LFF S+YNV++IVD +EPEERLL RFRREVMK G+IQE KRRRYFEN
Sbjct  61   VICPSLAHANVLFFKSAYNVQVIVDDNEPEERLLGRFRREVMKAGVIQEVKRRRYFEN  118



>gb|KJB33968.1| hypothetical protein B456_006G041200 [Gossypium raimondii]
Length=177

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFF S+YNV++IVD +EPEE+LLNRFRREVMK G+IQECKRRR+ EN
Sbjct  66   VICPSLAYSNTLFFKSAYNVQVIVDDNEPEEKLLNRFRREVMKAGVIQECKRRRFHEN  123



>gb|KHG22618.1| 30S ribosomal S21, chloroplastic [Gossypium arboreum]
Length=178

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFF S+YNV++IVD +EPEE+LLNRFRREVMK G+IQECKRRR+ EN
Sbjct  66   VICPSLAYSNTLFFKSAYNVQVIVDDNEPEEKLLNRFRREVMKAGVIQECKRRRFHEN  123



>gb|KDP46290.1| hypothetical protein JCGZ_10130 [Jatropha curcas]
Length=177

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = -1

Query  640  DGWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEER  464
            D + PLV     Q+    PLS   EL SV+ PS+A+ANTLFF S+YNV++IV+ D+ EER
Sbjct  43   DKFTPLVV----QEGQSGPLSP--ELSSVIWPSVAYANTLFFKSAYNVQVIVERDDSEER  96

Query  463  LLNRFRREVMKTGLIQECKRRRYFEN  386
            LLN+FRREVM+ G+IQEC+RRRYFEN
Sbjct  97   LLNKFRREVMRAGIIQECRRRRYFEN  122



>ref|XP_010026761.1| PREDICTED: PERQ amino acid-rich with GYF domain-containing protein 
2-like [Eucalyptus grandis]
 gb|KCW83204.1| hypothetical protein EUGRSUZ_B00147 [Eucalyptus grandis]
Length=181

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 60/88 (68%), Gaps = 9/88 (10%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPE  470
            H   W PLV         PSP +     MS  CP+LA+ANTLFF S+YNV++ VD +EPE
Sbjct  46   HRRKWEPLVADVGPS---PSPAA-----MSTACPALAYANTLFFKSTYNVQITVDDNEPE  97

Query  469  ERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ERL+NRFRREV K G+I EC+RRR+FE 
Sbjct  98   ERLVNRFRREVAKAGIIPECRRRRFFET  125



>gb|AAK64005.1| AT3g27160/MYF5_3 [Arabidopsis thaliana]
 gb|AAL76155.1| AT3g27160/MYF5_3 [Arabidopsis thaliana]
Length=183

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFFSS YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYFEN
Sbjct  68   VICPSLAYSNTLFFSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFEN  125



>ref|NP_566809.1| plastid ribosomal protein S21 [Arabidopsis thaliana]
 dbj|BAB01933.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77274.1| plastid ribosomal protein S21 [Arabidopsis thaliana]
Length=183

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFFSS YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYFEN
Sbjct  68   VICPSLAYSNTLFFSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFEN  125



>ref|XP_010514403.1| PREDICTED: uncharacterized protein LOC104790365 isoform X1 [Camelina 
sativa]
 ref|XP_010514404.1| PREDICTED: uncharacterized protein LOC104790365 isoform X2 [Camelina 
sativa]
Length=184

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 54/59 (92%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYFEN
Sbjct  68   VICPSLAYSNTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFEN  126



>ref|XP_008341156.1| PREDICTED: uncharacterized protein LOC103404079 [Malus domestica]
Length=155

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = -1

Query  559  SVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            SV+CPSLAHAN LFF S+YNV++IVD +EPEERLL RF+REVMK G+IQE KR RYFEN
Sbjct  96   SVICPSLAHANVLFFKSAYNVQVIVDDNEPEERLLGRFQREVMKVGVIQEVKRMRYFEN  154



>ref|XP_008379756.1| PREDICTED: uncharacterized protein LOC103442719 [Malus domestica]
Length=206

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  565  LMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFE  389
            + SV+CPSLAHA+ LFF S+YNV++IVD +EPEERLL RFRREVM+ G+IQE KRRRYFE
Sbjct  91   IESVICPSLAHASVLFFKSAYNVQVIVDDNEPEERLLGRFRREVMRAGVIQEVKRRRYFE  150

Query  388  N  386
            N
Sbjct  151  N  151



>ref|XP_009371656.1| PREDICTED: uncharacterized protein LOC103960893 [Pyrus x bretschneideri]
Length=172

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA+AN LFF S+YNV++IVD +EPEERLL RFRREVMK G+IQE KRRRYFEN
Sbjct  60   VICPSLAYANVLFFKSAYNVQVIVDDNEPEERLLGRFRREVMKAGVIQEVKRRRYFEN  117



>ref|XP_007151530.1| hypothetical protein PHAVU_004G054500g [Phaseolus vulgaris]
 gb|ESW23524.1| hypothetical protein PHAVU_004G054500g [Phaseolus vulgaris]
Length=171

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPS+A++NTLFF S YNV+++V  DEPEERLLNRFRREV++ G+IQEC+RRRYFEN
Sbjct  60   VICPSMAYSNTLFFQSPYNVQVVVAEDEPEERLLNRFRREVLRAGVIQECRRRRYFEN  117



>gb|KFK33636.1| hypothetical protein AALP_AA5G039500 [Arabis alpina]
Length=179

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFFSS YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYFEN
Sbjct  64   VICPSLAYSNTLFFSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFEN  121



>ref|XP_010502676.1| PREDICTED: uncharacterized protein LOC104779942 [Camelina sativa]
Length=184

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 54/59 (92%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYFEN
Sbjct  68   VICPSLAYSNTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFEN  126



>ref|XP_010425453.1| PREDICTED: uncharacterized protein LOC104710534 [Camelina sativa]
Length=184

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 54/59 (92%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPSLA++NTLFFSS  YNV++ V+ +E EERL+NRFRREVM+TG+IQECKRRRYFEN
Sbjct  68   VICPSLAYSNTLFFSSSGYNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFEN  126



>gb|KCW45061.1| hypothetical protein EUGRSUZ_L013361, partial [Eucalyptus grandis]
Length=144

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPE  470
            H   W PLV             S +   MS  CP+LA+ANTLFF S+YNV++ VD +EPE
Sbjct  47   HRRKWVPLVADVGP--------SLSPAAMSTACPALAYANTLFFKSTYNVQITVDDNEPE  98

Query  469  ERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ERL+NRFRREV K G+I EC+RRR+FE 
Sbjct  99   ERLVNRFRREVAKAGIIPECRRRRFFET  126



>ref|XP_010040601.1| PREDICTED: PERQ amino acid-rich with GYF domain-containing protein 
2-like [Eucalyptus grandis]
Length=182

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPE  470
            H   W PLV             S +   MS  CP+LA+ANTLFF S+YNV++ VD +EPE
Sbjct  47   HRRKWVPLVADVGP--------SLSPAAMSTACPALAYANTLFFKSTYNVQITVDDNEPE  98

Query  469  ERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ERL+NRFRREV K G+I EC+RRR+FE 
Sbjct  99   ERLVNRFRREVAKAGIIPECRRRRFFET  126



>ref|XP_007161737.1| hypothetical protein PHAVU_001G094500g [Phaseolus vulgaris]
 gb|ESW33731.1| hypothetical protein PHAVU_001G094500g [Phaseolus vulgaris]
Length=170

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ++ PS A ANTLFF S+YNV+++VD +EPEERLLNRFRREVMK G+IQECKRRR+FEN
Sbjct  54   IMNPSHAQANTLFFRSAYNVQVVVDENEPEERLLNRFRREVMKAGVIQECKRRRFFEN  111



>ref|XP_009803782.1| PREDICTED: uncharacterized protein LOC104249101, partial [Nicotiana 
sylvestris]
Length=168

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYF  392
            ++ SVVCPSLA+ANTLFF S+YN+++IVD +E EE+L+ RFRREVM+ G+IQEC RRR+F
Sbjct  50   DITSVVCPSLAYANTLFFRSAYNIQVIVDDNEHEEKLIGRFRREVMRAGVIQECTRRRFF  109

Query  391  EN  386
            +N
Sbjct  110  DN  111



>ref|XP_010248820.1| PREDICTED: uncharacterized protein LOC104591611 [Nelumbo nucifera]
Length=190

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIV-DGDEPEERLLNRFRREVMKTGLIQECK  407
            S +++++SV CPS A+ANT FF S+YNV+++V D +EPEE LL RFRREVMK G+IQECK
Sbjct  69   SYSNDILSVTCPSFAYANTFFFKSAYNVQVVVTDDNEPEESLLRRFRREVMKAGVIQECK  128

Query  406  RRRYFEN  386
            RRR+FEN
Sbjct  129  RRRFFEN  135



>ref|XP_004303982.1| PREDICTED: uncharacterized protein LOC101292725 [Fragaria vesca 
subsp. vesca]
Length=179

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+ PSLA+ANTLFF S+YNV++IVD  E EERLLNRFRREVM+ G+IQE KRRRYFEN
Sbjct  64   VINPSLAYANTLFFKSAYNVQVIVDEGESEERLLNRFRREVMRAGVIQEVKRRRYFEN  121



>gb|KHN47278.1| 30S ribosomal protein S21, chloroplastic [Glycine soja]
Length=177

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPS+A++NTLFF S YNV+++V  DE EE+LL RFRREV+K G++QEC+RRRYFEN
Sbjct  66   VICPSMAYSNTLFFQSPYNVQVVVAEDESEEKLLGRFRREVIKAGIVQECRRRRYFEN  123



>ref|XP_003524616.1| PREDICTED: uncharacterized protein LOC100777605 isoform X1 [Glycine 
max]
 gb|KHN01524.1| 30S ribosomal protein S21, chloroplastic [Glycine soja]
Length=176

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPS+A++NTLFF S YNV+++V  DE EE+LL RFRREV+K G++QEC+RRRYFEN
Sbjct  65   VICPSMAYSNTLFFRSPYNVQVVVAEDESEEKLLGRFRREVIKAGIVQECRRRRYFEN  122



>ref|XP_006579865.1| PREDICTED: uncharacterized protein LOC100777605 isoform X2 [Glycine 
max]
Length=183

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPS+A++NTLFF S YNV+++V  DE EE+LL RFRREV+K G++QEC+RRRYFEN
Sbjct  65   VICPSMAYSNTLFFRSPYNVQVVVAEDESEEKLLGRFRREVIKAGIVQECRRRRYFEN  122



>ref|XP_003553848.1| PREDICTED: uncharacterized protein LOC100790222 [Glycine max]
Length=185

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+CPS+A++NTLFF S YNV+++V  DE EE+LL RFRREV K G++QEC+RRRYFEN
Sbjct  74   VICPSMAYSNTLFFQSPYNVQVVVAEDETEEKLLGRFRREVTKAGVVQECRRRRYFEN  131



>gb|AFK33554.1| unknown [Lotus japonicus]
Length=182

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYF  392
            EL SVVCPSLA++NTLFF S+YNV+++V  +E EERLLNRFRREVMK G+IQECKRRR+F
Sbjct  64   ELSSVVCPSLAYSNTLFFRSAYNVQVVVGEEEGEERLLNRFRREVMKAGVIQECKRRRFF  123

Query  391  EN  386
            EN
Sbjct  124  EN  125



>ref|XP_011084004.1| PREDICTED: uncharacterized protein LOC105166362 [Sesamum indicum]
Length=198

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = -1

Query  574  NSELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRR  398
            +S+ +SV  PSLA +NTLFFSS YNV+LI   +EPEE+L+ RFRREV K G+IQECKRRR
Sbjct  77   DSDFLSVAFPSLAFSNTLFFSSAYNVQLIAGDNEPEEQLIRRFRREVWKAGVIQECKRRR  136

Query  397  YFEN  386
            +FE+
Sbjct  137  FFES  140



>ref|XP_007037881.1| Ribosomal protein S21 family protein, putative [Theobroma cacao]
 gb|EOY22382.1| Ribosomal protein S21 family protein, putative [Theobroma cacao]
Length=210

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            ++ ++ CPSLA+AN LFF S  YNV+++V  +EPEE+LL RFRR V K G+IQECKRRR+
Sbjct  94   DITAITCPSLAYANALFFKSGCYNVQVVVAENEPEEKLLGRFRRAVFKAGVIQECKRRRF  153

Query  394  FEN  386
            FE+
Sbjct  154  FES  156



>ref|XP_010252601.1| PREDICTED: uncharacterized protein LOC104594134 [Nelumbo nucifera]
Length=190

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRR  401
            GNS + S++ P+L HAN +FF S+YNV+++VD  EPEE LL RFRREV K G+IQECKRR
Sbjct  70   GNS-IDSIINPALHHANVMFFRSAYNVQVMVDEGEPEEALLRRFRREVSKAGVIQECKRR  128

Query  400  RYFEN  386
            R+FEN
Sbjct  129  RFFEN  133



>gb|EPS57315.1| hypothetical protein M569_17505 [Genlisea aurea]
Length=166

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  550  CPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            CPSLA+AN LFF S+YNV+++VD +EPEE+L+ RF+REVM+ G+IQE KRRR+ EN
Sbjct  49   CPSLAYANALFFKSAYNVQVMVDDNEPEEKLVGRFKREVMRAGIIQEVKRRRFHEN  104



>ref|XP_010932294.1| PREDICTED: uncharacterized protein LOC105052998 [Elaeis guineensis]
Length=185

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 5/74 (7%)
 Frame = -1

Query  592  PSPLSGNSELMSVV--C-PSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKT  428
            PSP+    E   V+  C PSLA AN +F+ +  YNV+++V  DEPEE LL RFRREVMK 
Sbjct  58   PSPMEAAPEAGGVLRSCFPSLAWANVMFYKAGYYNVQVVVGDDEPEEVLLRRFRREVMKA  117

Query  427  GLIQECKRRRYFEN  386
            G++QECKRRR+FEN
Sbjct  118  GVVQECKRRRWFEN  131



>ref|XP_010928402.1| PREDICTED: uncharacterized protein LOC105050179 [Elaeis guineensis]
Length=179

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = -1

Query  592  PSPLSGN--SELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGL  422
            PS  +G       + V P+L HAN LFF S YNV+++VD  EPEE LL RFRREV K G+
Sbjct  45   PSATAGGPIDSAAAAVEPALRHANLLFFKSGYNVQIVVDEGEPEEGLLRRFRREVAKAGV  104

Query  421  IQECKRRRYFEN  386
            IQECKRRR+FEN
Sbjct  105  IQECKRRRFFEN  116



>gb|KJB08063.1| hypothetical protein B456_001G061300 [Gossypium raimondii]
Length=146

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            E  ++ CPS A+ANTLFF S  YNV+++V  +EPE++LL RFRR V K G+IQECKRR +
Sbjct  58   ETNAITCPSFAYANTLFFKSGHYNVQVVVADNEPEDKLLGRFRRAVFKAGVIQECKRRMF  117

Query  394  FEN  386
            FE+
Sbjct  118  FES  120



>gb|KJB08062.1| hypothetical protein B456_001G061300 [Gossypium raimondii]
Length=175

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 2/63 (3%)
 Frame = -1

Query  568  ELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            E  ++ CPS A+ANTLFF S  YNV+++V  +EPE++LL RFRR V K G+IQECKRR +
Sbjct  58   ETNAITCPSFAYANTLFFKSGHYNVQVVVADNEPEDKLLGRFRRAVFKAGVIQECKRRMF  117

Query  394  FEN  386
            FE+
Sbjct  118  FES  120



>ref|XP_006440037.1| hypothetical protein CICLE_v10022507mg [Citrus clementina]
 gb|ESR53277.1| hypothetical protein CICLE_v10022507mg [Citrus clementina]
Length=143

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSEL--MSVVCPSLAHANTLFFSSYNVELIVDGDEP  473
             ++GW PLV      +  P+ +S + +L   SV  PSLA+AN L+F  +NV++ V  DEP
Sbjct  41   KSNGWTPLVAC----RFPPTKISSDDDLSLTSVAWPSLANANVLYF--FNVQIEVADDEP  94

Query  472  EERLLNRFRREVMKTGLIQECKRRRYFEN  386
            EE++  RFR  V++ G+IQECKRRR+FE+
Sbjct  95   EEKIARRFRSAVLRAGIIQECKRRRFFES  123



>ref|XP_009413349.1| PREDICTED: uncharacterized protein LOC103994667 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -1

Query  565  LMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFE  389
            + +VV P+L +AN LFF S YNV+++VD  E EE LL RFRREV K G+IQECKRRR+FE
Sbjct  64   VAAVVDPALHNANVLFFGSGYNVQIVVDEGESEEALLRRFRREVSKAGVIQECKRRRFFE  123

Query  388  N  386
            N
Sbjct  124  N  124



>gb|EPS70276.1| hypothetical protein M569_04486, partial [Genlisea aurea]
Length=122

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRR  401
             +S ++SV  PS+A++NTLFF ++YN +++V  DEPEE L+ RFRREV K  +IQ+C+RR
Sbjct  2    DSSNVLSVAFPSIAYSNTLFFNAAYNCQVVVRDDEPEESLIGRFRREVFKARVIQDCRRR  61

Query  400  RYFE  389
            R+FE
Sbjct  62   RFFE  65



>ref|XP_007210632.1| hypothetical protein PRUPE_ppa019736mg, partial [Prunus persica]
 gb|EMJ11831.1| hypothetical protein PRUPE_ppa019736mg, partial [Prunus persica]
Length=158

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -1

Query  565  LMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFE  389
            L S++ PSLA++NTLFF S+YNV+++V  ++ EE+L+ RFR+EV++ G++QECK RR+FE
Sbjct  45   LASILWPSLAYSNTLFFKSAYNVQIVVQDNDSEEKLVGRFRKEVLRAGVLQECKTRRFFE  104

Query  388  N  386
            N
Sbjct  105  N  105



>ref|XP_006440038.1| hypothetical protein CICLE_v10022507mg [Citrus clementina]
 gb|ESR53278.1| hypothetical protein CICLE_v10022507mg [Citrus clementina]
Length=177

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSEL--MSVVCPSLAHANTLFFSSYNVELIVDGDEP  473
             ++GW PLV      +  P+ +S + +L   SV  PSLA+AN L+F  +NV++ V  DEP
Sbjct  41   KSNGWTPLVAC----RFPPTKISSDDDLSLTSVAWPSLANANVLYF--FNVQIEVADDEP  94

Query  472  EERLLNRFRREVMKTGLIQECKRRRYFEN  386
            EE++  RFR  V++ G+IQECKRRR+FE+
Sbjct  95   EEKIARRFRSAVLRAGIIQECKRRRFFES  123



>ref|XP_008239415.1| PREDICTED: uncharacterized protein LOC103338015 [Prunus mume]
Length=174

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -1

Query  565  LMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFE  389
            L S++ PSLA++NTLFF S+YNV+++V  ++ EE+L+ RFR+EV++ G++QECK RR+FE
Sbjct  61   LASILWPSLAYSNTLFFKSAYNVQIVVQDNDSEEKLVGRFRKEVLRAGVLQECKTRRFFE  120

Query  388  N  386
            N
Sbjct  121  N  121



>gb|KHG26110.1| Telomere length regulation TEL2 [Gossypium arboreum]
Length=1141

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = -1

Query  568   ELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
             E  ++ CPSLA+ANTLFF S  YNV+++V  +EPE++LL RFRR V K G+IQECKRR +
Sbjct  1026  ETNAITCPSLAYANTLFFKSGHYNVQVVVADNEPEDKLLGRFRRAVFKAGVIQECKRRMF  1085

Query  394   FEN  386
             FE+
Sbjct  1086  FES  1088



>ref|XP_010907771.1| PREDICTED: uncharacterized protein LOC105034343 [Elaeis guineensis]
Length=185

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = -1

Query  592  PSPLSGNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            P+  +  S ++    PSLA AN +F +   YNV+++V  DEPEE LL RFRREVMK G+I
Sbjct  61   PTEAAPGSGVLRSCFPSLAWANVMFANGGYYNVQVVVGEDEPEEVLLRRFRREVMKAGVI  120

Query  418  QECKRRRYFEN  386
            QECKRRR+FEN
Sbjct  121  QECKRRRWFEN  131



>ref|XP_010943224.1| PREDICTED: uncharacterized protein LOC105061012 [Elaeis guineensis]
Length=181

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -1

Query  562  MSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ++ V P+L HAN  FF S YNV+++VD +E EE LL RFRREV + G+IQECKRRR+FEN
Sbjct  58   VAAVSPALRHANVFFFRSGYNVQIMVDENESEEALLRRFRREVSRAGVIQECKRRRFFEN  117



>ref|XP_008806074.1| PREDICTED: uncharacterized protein LOC103718855 [Phoenix dactylifera]
Length=178

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  562  MSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ++ V P+L HAN LFF S YNV+++VD +E EE L+ RFRREV + G+IQECKRRR+FEN
Sbjct  58   VAAVNPALRHANVLFFKSGYNVQVLVDDNESEEALMRRFRREVSRAGVIQECKRRRFFEN  117



>ref|XP_009383907.1| PREDICTED: forkhead box protein L2-like [Musa acuminata subsp. 
malaccensis]
Length=229

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = -1

Query  643  NDGWAPLVKTADNQQQYPSPLSGNSELMSVVC---PSLAHANTLFFSS---YNVELIVDG  482
             DG+ P    +    + PS ++  +E   +VC   PSLA AN LF++    YN +++V  
Sbjct  80   TDGFPPASIRSSAPVRPPSEVTMPAEKEGLVCSCYPSLALAN-LFYARGGYYNAQVVVGE  138

Query  481  DEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            DEPEE LL RF+REVMK G+IQECKRRR+FEN
Sbjct  139  DEPEEVLLRRFKREVMKAGVIQECKRRRWFEN  170



>ref|XP_008799941.1| PREDICTED: uncharacterized protein LOC103714466 [Phoenix dactylifera]
Length=185

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = -1

Query  547  PSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            PSLA AN +F+    YN++++V  DEPEE LL RFRREVMK G+IQECKRRR+FEN
Sbjct  75   PSLAWANVMFYKGGYYNLQVVVGEDEPEEVLLRRFRREVMKAGVIQECKRRRWFEN  130



>ref|XP_006579590.1| PREDICTED: uncharacterized protein LOC102661132 [Glycine max]
 gb|KHN34386.1| 30S ribosomal protein S21 [Glycine soja]
Length=173

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  583  LSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECK  407
            +  +  + S++ P+L+ +N L F S+YNV+++V  DEPE+R++NRF++EV+K G++QEC+
Sbjct  49   IDNDVSVKSILYPALSLSNILHFKSTYNVQIVVGEDEPEDRIVNRFKKEVLKAGVLQECR  108

Query  406  RRRYFEN  386
            RRR+FEN
Sbjct  109  RRRFFEN  115



>ref|XP_008797286.1| PREDICTED: uncharacterized protein LOC103712519 [Phoenix dactylifera]
Length=174

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            G   ++    PSLA AN +F     YNV+L+V  DEPEE LL RFRREV+K G++QECKR
Sbjct  59   GCGGVLRSCFPSLAWANVMFAKGGYYNVQLVVGEDEPEEVLLQRFRREVIKAGVVQECKR  118

Query  403  RRYFEN  386
            RR+FEN
Sbjct  119  RRWFEN  124



>ref|XP_009596110.1| PREDICTED: uncharacterized protein LOC104092264, partial [Nicotiana 
tomentosiformis]
Length=132

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = -1

Query  628  PLVKTADNQQQYPSPLSGNS---ELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERL  461
            PL+ T D+    P PLS +S   ++ SVVCPSLA+ANTLFF S+YNV++IVD +  EE+L
Sbjct  54   PLISTNDHNNHTPLPLSSSSSNSDITSVVCPSLAYANTLFFRSAYNVQVIVDDNAHEEKL  113

Query  460  LNRFRREVMKTGLIQ  416
            + RFRREVM+  L Q
Sbjct  114  IGRFRREVMRAVLFQ  128



>ref|XP_006858094.1| hypothetical protein AMTR_s00062p00090380 [Amborella trichopoda]
 gb|ERN19561.1| hypothetical protein AMTR_s00062p00090380 [Amborella trichopoda]
Length=73

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -1

Query  523  LFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            +F S YNV+++VD DEPEE LL RFRREVM+ G+IQECKRRR+FEN
Sbjct  1    MFNSGYNVQIVVDDDEPEEVLLRRFRREVMRAGVIQECKRRRFFEN  46



>ref|XP_006476971.1| PREDICTED: uncharacterized protein LOC102620819 isoform X2 [Citrus 
sinensis]
Length=177

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSEL--MSVVCPSLAHANTLFFSSYNVELIVDGDEP  473
             ++G  PLV +    +  P+ +S + +L   SV  PSLA+AN L+F  +NV++ V  DEP
Sbjct  41   KSNGCTPLVAS----RFPPTKISSDDDLSLTSVAWPSLANANVLYF--FNVQIEVADDEP  94

Query  472  EERLLNRFRREVMKTGLIQECKRRRYFEN  386
            EE++  RFR  V++ G+IQECKRRR+FE+
Sbjct  95   EEKIARRFRSAVLRAGIIQECKRRRFFES  123



>ref|XP_006476970.1| PREDICTED: uncharacterized protein LOC102620819 isoform X1 [Citrus 
sinensis]
Length=195

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = -1

Query  646  HNDGWAPLVKTADNQQQYPSPLSGNSEL--MSVVCPSLAHANTLFFSSYNVELIVDGDEP  473
             ++G  PLV +    +  P+ +S + +L   SV  PSLA+AN L+F  +NV++ V  DEP
Sbjct  41   KSNGCTPLVAS----RFPPTKISSDDDLSLTSVAWPSLANANVLYF--FNVQIEVADDEP  94

Query  472  EERLLNRFRREVMKTGLIQECKRRRYFEN  386
            EE++  RFR  V++ G+IQECKRRR+FE+
Sbjct  95   EEKIARRFRSAVLRAGIIQECKRRRFFES  123



>gb|ACJ86125.1| unknown [Medicago truncatula]
 gb|AFK34424.1| unknown [Medicago truncatula]
 gb|AFK47587.1| unknown [Medicago truncatula]
 gb|KEH22043.1| ribosomal protein S21 [Medicago truncatula]
Length=198

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -1

Query  544  SLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            S + +NT+F +S YNV++IV+ DEPEER LNRFRREV   G+IQECKRR+ FEN
Sbjct  79   SFSTSNTVFSASPYNVQIIVEDDEPEERFLNRFRREVFSAGIIQECKRRKRFEN  132



>ref|XP_011471081.1| PREDICTED: uncharacterized protein LOC105353526 [Fragaria vesca 
subsp. vesca]
Length=199

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = -1

Query  580  SGNSELMSVVC--PSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            SG   L  + C  PSLA++N LFFSS  +N ++ V  +EPEE L+NRFRREV++ G+ +E
Sbjct  52   SGGQLLGPIKCSLPSLANSNLLFFSSAGFNAQVTVQENEPEEWLINRFRREVIRAGVFRE  111

Query  412  CKRRRYFEN  386
            CK+RR+FEN
Sbjct  112  CKKRRFFEN  120



>gb|AFK48060.1| unknown [Lotus japonicus]
Length=131

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 2/67 (3%)
 Frame = -1

Query  583  LSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECK  407
            L+ N  ++ V C +L ++ TL+F S+YNV++ V  DEPE++L+NRFRREV K G+IQE +
Sbjct  10   LNRNRSIL-VKCIALTYSTTLYFKSTYNVKITVHDDEPEDKLINRFRREVRKAGVIQEYR  68

Query  406  RRRYFEN  386
            RR YFEN
Sbjct  69   RRMYFEN  75



>ref|XP_009803010.1| PREDICTED: uncharacterized protein LOC104248454 [Nicotiana sylvestris]
Length=185

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  553  VCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            + PSL+ +N LFF S+YNV++I   +EPEE+L+ RFRREV++ G+IQE KRRR+FE+
Sbjct  73   LFPSLSFSNILFFKSAYNVQVIAGENEPEEKLIGRFRREVLRAGVIQESKRRRFFES  129



>ref|XP_009605265.1| PREDICTED: uncharacterized protein LOC104099845 [Nicotiana tomentosiformis]
Length=187

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  589  SPLSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            SP S +  L     PSL+ +N LFF S+YNV++I   +EPEE+L+ RFRREV++ G+IQE
Sbjct  67   SPHSSSDHLF----PSLSFSNILFFKSAYNVQVIAGENEPEEKLIGRFRREVLRAGVIQE  122

Query  412  CKRRRYFEN  386
             KRRR+FE+
Sbjct  123  SKRRRFFES  131



>ref|XP_004513195.1| PREDICTED: uncharacterized protein LOC101488262 [Cicer arietinum]
Length=189

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  514  SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            S YNV++IV+ DEPEERLLNRFRREVM+ G+IQECKRR++ EN
Sbjct  84   SPYNVQVIVEDDEPEERLLNRFRREVMRAGIIQECKRRKFHEN  126



>ref|XP_003550088.1| PREDICTED: uncharacterized protein LOC100812464 [Glycine max]
Length=169

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  571  SELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRY  395
            +E+ +V  PS AHA TLFF S+YNV+++V+ +EPEERLLNRFRREVM+ G+IQECKRRR+
Sbjct  48   AEVSAVANPSHAHAKTLFFRSAYNVQVVVEENEPEERLLNRFRREVMRAGVIQECKRRRF  107

Query  394  FEN  386
            FEN
Sbjct  108  FEN  110



>ref|XP_006351501.1| PREDICTED: uncharacterized protein LOC102594896 [Solanum tuberosum]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -1

Query  583  LSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECK  407
            L  +S   S + PSL+ +N LFF S+YNV++I    EPEE+L+ RFRREV + G+IQE K
Sbjct  58   LDQHSSDYSHLFPSLSFSNILFFKSAYNVQVIAGEHEPEEKLIGRFRREVFRAGVIQESK  117

Query  406  RRRYFEN  386
            RRR+FE+
Sbjct  118  RRRFFES  124



>ref|XP_001758442.1| predicted protein [Physcomitrella patens]
 gb|EDQ76844.1| predicted protein [Physcomitrella patens]
Length=179

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 4/70 (6%)
 Frame = -1

Query  586  PLS---GNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            PLS   G++  MSV+ P L H N ++F  +YN ++ V  DEP + ++ RFR+ VM TG+I
Sbjct  50   PLSINNGDASAMSVLHPGLEHVNVMYFKGTYNTQVFVGEDEPADSVVRRFRKAVMATGVI  109

Query  418  QECKRRRYFE  389
             EC+RRRY E
Sbjct  110  PECRRRRYHE  119



>gb|KHN10804.1| 26S protease regulatory subunit 7 like [Glycine soja]
Length=263

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 59/116 (51%), Gaps = 10/116 (9%)
 Frame = -3

Query  659  YLEKPQRWLGPASENRR*PTAVSIAAIRQFRAHVRRLPVSGARQHPLLLFLQRRAH----  492
            + +K   W  P ++ R   T   + AIR  R  V       A    +  + +  A     
Sbjct  148  FFDKDTFWFSPGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKVIKGYQKFSATPNYS  207

Query  491  ------CGWGRAGGAVAQPLPQRGDENRTDSRVQAQAILREQAGGEEAQVP*SRQA  342
                  CG  RAGG  AQPLP+RG E+R+ S VQ + +LREQAGGEEAQVP S QA
Sbjct  208  STSQKLCGRERAGGEAAQPLPERGHESRSHSGVQEETVLREQAGGEEAQVPRSCQA  263



>ref|XP_004236356.1| PREDICTED: uncharacterized protein LOC101245346 isoform X1 [Solanum 
lycopersicum]
Length=177

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  547  PSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            PSL  +N LFF S+YNV+++    EPEE+L+ RFRREV + G+IQE KRRR+FE+
Sbjct  67   PSLPFSNILFFKSAYNVQVVAGEHEPEEKLIGRFRREVFRAGVIQESKRRRFFES  121



>ref|XP_010102885.1| 30S ribosomal protein S21 [Morus notabilis]
 gb|EXB94322.1| 30S ribosomal protein S21 [Morus notabilis]
Length=167

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = -1

Query  565  LMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            + +V  PSLAH+NTLFF S+YNV++I + +EPEERLLNRFR+EV K G++
Sbjct  53   IAAVAFPSLAHSNTLFFKSAYNVQVIAEENEPEERLLNRFRKEVFKAGVL  102



>ref|XP_010696185.1| PREDICTED: uncharacterized protein LOC104908732 [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 3/51 (6%)
 Frame = -1

Query  529  NTLFFSS---YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            N LF +S   YNV++IV+ +EPEERLLNRFRREV++  +IQE KRRR+FEN
Sbjct  55   NGLFITSMGTYNVQVIVEENEPEERLLNRFRREVLRANIIQESKRRRWFEN  105



>ref|XP_001778545.1| predicted protein [Physcomitrella patens]
 gb|EDQ56575.1| predicted protein [Physcomitrella patens]
Length=177

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = -1

Query  586  PLS---GNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLI  419
            PLS   G + +MSV+ P L H N ++F  +YN ++ V  DEP + ++ RFR+ VM  G+I
Sbjct  49   PLSVNHGEASVMSVLHPGLEHVNVMYFKGTYNTQVFVGEDEPADSVVRRFRKAVMAAGVI  108

Query  418  QECKRRRYFEN  386
             EC+RRRY E 
Sbjct  109  PECRRRRYHET  119



>gb|KHM99282.1| hypothetical protein glysoja_033980, partial [Glycine soja]
Length=147

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = -1

Query  631  APLVKTADNQQQYPSPLSGNSELMSVVCPSLAHANTLFFSSYNVELIVDGDEPEERLLNR  452
            A  V T+ +   +   +  +S + S++ P+L+ +N L F   NV+++V  DEPE++++NR
Sbjct  11   AVAVTTSASASAHAIGIDNDSLVKSILYPALSLSNILHF---NVQIMVGKDEPEDKIINR  67

Query  451  FRREVMKTGLIQECKRRRYFEN  386
            F++EV+K  ++QECK  R+FEN
Sbjct  68   FKKEVLKASVLQECKHTRFFEN  89



>ref|XP_002318697.2| GLUCOSE HYPERSENSITIVE 1 family protein [Populus trichocarpa]
 gb|EEE96917.2| GLUCOSE HYPERSENSITIVE 1 family protein [Populus trichocarpa]
Length=195

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  562  MSVVCPSLAHANTLFFS-SYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            +++V PSLA+ANTL+F   +NV++ V  +EPEE +L RF++ V++  ++QEC+RRR+FE+
Sbjct  89   LAMVSPSLAYANTLYFKFGFNVQINVKENEPEESILFRFKKAVIRARVLQECRRRRFFES  148



>ref|XP_004515839.1| PREDICTED: uncharacterized protein LOC101494150 [Cicer arietinum]
Length=156

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -1

Query  556  VVCPSLAHANTLFF----SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFE  389
            +  P+L++++T       S+YNV+++V+ DEPE++L++RFR+EV++ G++QEC+RRR+FE
Sbjct  37   IAYPTLSYSSTTLLHVKSSNYNVQVVVEEDEPEDQLVHRFRKEVLRAGILQECRRRRFFE  96

Query  388  N  386
             
Sbjct  97   T  97



>ref|XP_011040428.1| PREDICTED: uncharacterized protein LOC105136689 [Populus euphratica]
Length=230

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  562  MSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ++VV PSLA+ANTL F S +NV++ V  +EPEE +L RF++ V++  ++QEC+RRR+FE+
Sbjct  119  LAVVSPSLAYANTLCFKSGFNVQINVKENEPEESILFRFKKAVIRARVLQECRRRRFFES  178



>gb|EYU43075.1| hypothetical protein MIMGU_mgv1a019050mg [Erythranthe guttata]
Length=198

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -1

Query  547  PSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFE  389
            PSLA +NTLFF ++YNV++IV  DE EE L+ RFRRE+ + G+++EC+RR +FE
Sbjct  88   PSLAFSNTLFFKAAYNVQVIVGEDESEEALVGRFRREISRYGILRECRRRLFFE  141



>ref|XP_003571002.1| PREDICTED: uncharacterized protein LOC100828601 [Brachypodium 
distachyon]
Length=142

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -1

Query  598  QYP-SPLSGNSELMSV--VCPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKT  428
            Q P +P SG S   SV  V P  A    L    YNV+++VD +E E+ +  RFRREVMK 
Sbjct  15   QLPLAPFSGKSSPPSVAHVAPRRAPTAVLATKGYNVQILVDENEGEDSIFRRFRREVMKA  74

Query  427  GLIQECKRRRYFEN  386
            GL+QE KRRR  EN
Sbjct  75   GLLQEIKRRRRHEN  88



>ref|XP_006394291.1| hypothetical protein EUTSA_v10005605mg [Eutrema salsugineum]
 gb|ESQ31577.1| hypothetical protein EUTSA_v10005605mg [Eutrema salsugineum]
Length=187

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN  FF S  YNVE++    E E++LLN F+R V + G++QE +RRR+FEN
Sbjct  69   VAYPSLANANLFFFKSGYYNVEVVPKDGESEDQLLNDFKRSVFRAGVLQETRRRRFFEN  127



>ref|XP_004951625.1| PREDICTED: pre-mRNA-splicing factor CWC25-like [Setaria italica]
Length=138

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -1

Query  589  SPLSGNSELMSVV-CPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            +P SG S   SVV  P  A    +    YNV+++VD +E EE +  RFRREVM+ G++QE
Sbjct  19   APFSGKSSPPSVVHVPRRAPTAVVAAKGYNVQILVDENEGEESIFRRFRREVMRAGVLQE  78

Query  412  CKRRRYFEN  386
             KRRR +E+
Sbjct  79   IKRRRRYES  87



>ref|XP_009130247.1| PREDICTED: uncharacterized protein LOC103855037 [Brassica rapa]
Length=174

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R V + G++QE +RRR+FE+
Sbjct  51   VAYPSLANANLVFFKSGNYNVEVVPKDGETEEQLVNDFKRSVFRAGVLQETRRRRFFES  109



>emb|CDY45737.1| BnaC02g42450D [Brassica napus]
Length=169

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R V + G++QE +RRR+FE+
Sbjct  50   VAYPSLANANLVFFKSGNYNVEVVPKDGETEEQLVNDFKRSVFRAGVLQETRRRRFFES  108



>gb|AGE45653.1| ribosomal protein S21 [Picea wilsonii]
Length=161

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+ PS  +AN ++F    YN ++ V  DEP + ++ RFR+ VM  G+I ECKRRR+FE+
Sbjct  45   VMNPSFEYANVMWFKGKHYNAQVFVGEDEPADAVVRRFRKAVMDAGVISECKRRRFFES  103



>ref|XP_002864845.1| hypothetical protein ARALYDRAFT_496513 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41104.1| hypothetical protein ARALYDRAFT_496513 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN +FF S  YNVE++    E EE+LLN F+R   + G++QE +RRR+FE+
Sbjct  61   VAYPSLANANLVFFKSGYYNVEVVPKDGESEEQLLNDFKRSCFRAGVLQESRRRRFFES  119



>gb|ABK24643.1| unknown [Picea sitchensis]
 gb|ABR16898.1| unknown [Picea sitchensis]
 gb|ACN40545.1| unknown [Picea sitchensis]
Length=161

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+ PS  +AN ++F    YN ++ V  DEP + ++ RFR+ VM  G+I ECKRRR+FE+
Sbjct  45   VMNPSFEYANVMWFKGKHYNAQVFVGEDEPADAVVRRFRKAVMDAGVISECKRRRFFES  103



>ref|XP_001783859.1| predicted protein [Physcomitrella patens]
 gb|EDQ51349.1| predicted protein [Physcomitrella patens]
Length=182

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = -1

Query  583  LSGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECK  407
            L  +S  +SV+ P L   N ++F  SYN ++ V  DEP + ++ RFRR VM  G+I EC+
Sbjct  61   LCSSSPAVSVLHPDLEFVNVMYFKGSYNAQVFVGEDEPADSVVRRFRRAVMAAGVIPECR  120

Query  406  RRRYFEN  386
            RRR+ E 
Sbjct  121  RRRFHET  127



>ref|XP_006281636.1| hypothetical protein CARUB_v10027766mg [Capsella rubella]
 gb|EOA14534.1| hypothetical protein CARUB_v10027766mg [Capsella rubella]
Length=208

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -1

Query  580  SGNSELMS-VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQEC  410
            +GN ++ + V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE 
Sbjct  54   AGNDDVTNRVAYPSLANANLVFFKSGYYNVEVVPKEGESEEQLVNDFKRSCFRAGVLQES  113

Query  409  KRRRYFEN  386
            +RRR+FE+
Sbjct  114  RRRRFFES  121



>ref|XP_010484055.1| PREDICTED: uncharacterized protein LOC104762471 [Camelina sativa]
Length=189

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -1

Query  580  SGNSELMS-VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQEC  410
            +GN ++ + V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE 
Sbjct  58   AGNDDVSNRVAYPSLANANLVFFKSGYYNVEVVPKEGESEEQLVNDFKRSCFRAGVLQES  117

Query  409  KRRRYFEN  386
            +RRR+FE+
Sbjct  118  RRRRFFES  125



>ref|XP_010460099.1| PREDICTED: uncharacterized protein LOC104741032 [Camelina sativa]
Length=188

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -1

Query  580  SGNSELMS-VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQEC  410
            +GN ++ + V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE 
Sbjct  57   AGNDDVSNRVAYPSLANANLVFFKSGYYNVEVVPKEGESEEQLVNDFKRSCFRAGVLQES  116

Query  409  KRRRYFEN  386
            +RRR+FE+
Sbjct  117  RRRRFFES  124



>ref|NP_201135.2| ribosomal protein S21 family protein [Arabidopsis thaliana]
 gb|AAY34167.1| At5g63300 [Arabidopsis thaliana]
 gb|AED97729.1| ribosomal protein S21 family protein [Arabidopsis thaliana]
Length=185

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE +RRR+FE+
Sbjct  62   VAYPSLANANLVFFKSSYYNVEVVPKDGESEEQLVNDFKRSCFRAGVLQESRRRRFFES  120



>dbj|BAD42889.1| unknown protein [Arabidopsis thaliana]
Length=189

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE +RRR+FE+
Sbjct  66   VAYPSLANANLVFFKSSYYNVEVVPKDGESEEQLVNDFKRSCFRAGVLQESRRRRFFES  124



>ref|XP_010444212.1| PREDICTED: uncharacterized protein LOC104726937, partial [Camelina 
sativa]
Length=215

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = -1

Query  580  SGNSELMS-VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQEC  410
            +GN ++ + V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE 
Sbjct  84   AGNDDVSNRVAYPSLANANLVFFKSGYYNVEVVPKEGESEEQLVNDFKRSCFRAGVLQES  143

Query  409  KRRRYFEN  386
            +RRR+FE+
Sbjct  144  RRRRFFES  151



>gb|EMT05649.1| 30S ribosomal protein S21 [Aegilops tauschii]
Length=142

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -1

Query  598  QYP-SPLSGNSELMSVVCPSLAHANT--LFFSSYNVELIVDGDEPEERLLNRFRREVMKT  428
            Q P +P S  S   S V  +   A T  L    YNV+++VD +E E+ +  RFRREVMK 
Sbjct  15   QLPLAPFSRKSSAPSAVHMTARRAPTSVLAAKGYNVQIVVDENEGEDSIFRRFRREVMKA  74

Query  427  GLIQECKRRRYFEN  386
            GL+QE KRRR  EN
Sbjct  75   GLLQEIKRRRRHEN  88



>ref|NP_001119483.1| ribosomal protein S21 family protein [Arabidopsis thaliana]
 dbj|BAB10572.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABN04799.1| At5g63300 [Arabidopsis thaliana]
 gb|AED97730.1| ribosomal protein S21 family protein [Arabidopsis thaliana]
Length=217

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V  PSLA+AN +FF S  YNVE++    E EE+L+N F+R   + G++QE +RRR+FE+
Sbjct  62   VAYPSLANANLVFFKSSYYNVEVVPKDGESEEQLVNDFKRSCFRAGVLQESRRRRFFES  120



>gb|KFK28045.1| hypothetical protein AALP_AA8G464400 [Arabis alpina]
Length=171

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  556  VVCPSLAHANTLFFSS--YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+  S A+AN +F+ S  YNVE +    E EE+L+N F+R V + G++QE +RRR+FEN
Sbjct  52   VINTSFANANLMFYKSSFYNVEFVPKEGESEEQLVNDFKRSVFRAGVLQEARRRRFFEN  110



>gb|EMS67516.1| 30S ribosomal protein S21 [Triticum urartu]
Length=179

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -1

Query  598  QYP-SPLSGNSELMSVVCPSLAHANT--LFFSSYNVELIVDGDEPEERLLNRFRREVMKT  428
            Q P +P SG     S V  +   A T  L    YNV+++VD +E E+ +  RFRREVMK 
Sbjct  15   QLPLAPFSGKCSAPSAVHMTARRAPTPVLAAKGYNVQIVVDENEGEDSIFRRFRREVMKA  74

Query  427  GLIQECKRRRYFEN  386
            GL+QE KRRR  EN
Sbjct  75   GLLQEIKRRRRHEN  88



>ref|NP_001281222.1| LOC100284221 precursor [Zea mays]
 gb|ACG40299.1| ribosome-like protein [Zea mays]
 gb|AFW70536.1| ribosome-like protein [Zea mays]
Length=139

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -1

Query  589  SPLSGNSELMSVV-CPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            +PLSG S   SVV          +    YNV+++VD +E EE +  RFRREVM+ G++QE
Sbjct  19   APLSGKSSPPSVVHVARRGPMVVVAAKGYNVQILVDENEGEESIFRRFRREVMRAGVLQE  78

Query  412  CKRRRYFEN  386
             KRRR +E+
Sbjct  79   IKRRRRYES  87



>gb|KHN35930.1| hypothetical protein glysoja_048563 [Glycine soja]
Length=153

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = -1

Query  583  LSGNSELMSVVCPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            +  +S + S++  +L+ +N L F   NV+++V  DE E+R++N F++EV+K G++QECK 
Sbjct  33   IDNDSSVKSILYHALSLSNILHF---NVQIVVGEDELEDRIINHFKKEVLKAGVLQECKH  89

Query  403  RRYFEN  386
            RR+ EN
Sbjct  90   RRFSEN  95



>gb|ACG39658.1| ribosome-like protein [Zea mays]
Length=155

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -1

Query  589  SPLSGNSELMSVV-CPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            +PLSG S   SVV          +    YNV+++VD +E EE +  RFRREVM+ G++QE
Sbjct  19   APLSGKSSPPSVVHVARRGPMVVVAAKGYNVQILVDENEGEESIFRRFRREVMRAGVLQE  78

Query  412  CKRRRYFEN  386
             KRRR +E+
Sbjct  79   IKRRRRYES  87



>ref|NP_001151834.1| ribosome-like protein [Zea mays]
 gb|ACG44514.1| ribosome-like protein [Zea mays]
 gb|AFW66249.1| ribosome-like protein [Zea mays]
Length=139

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -1

Query  589  SPLSGNSELMSVV-CPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQE  413
            +P SG S   SVV     A    +    +NV+++VD +E EE +  RFRREVM+ G++QE
Sbjct  19   APFSGKSSPPSVVHVARRAPTAVVAAKGFNVQILVDENEGEESIFRRFRREVMRAGVLQE  78

Query  412  CKRRRYFEN  386
             KRRR +E+
Sbjct  79   IKRRRRYES  87



>gb|KHN01268.1| hypothetical protein glysoja_045178 [Glycine soja]
Length=161

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = -1

Query  589  SPLSGNSELMSVV-----CPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTG  425
            +PL G S L++       C    H         + E++V  DEPE+R++N F++EV+K G
Sbjct  2    APLVGTSLLLACDQKRKNCGEERHRCADGLVEGDREIVVGEDEPEDRIINPFKKEVLKAG  61

Query  424  LIQECKRRRYFEN  386
            ++QECKRRR+ EN
Sbjct  62   VLQECKRRRFSEN  74



>ref|XP_004157766.1| PREDICTED: uncharacterized protein LOC101226284 [Cucumis sativus]
 gb|KGN64376.1| hypothetical protein Csa_1G050150 [Cucumis sativus]
Length=168

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  508  YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            YN+ + V  +E E++++NRFRR+V++ G++QECKRRR+FEN
Sbjct  68   YNILITVGENESEDQVVNRFRRQVLRAGILQECKRRRFFEN  108



>ref|XP_004152510.1| PREDICTED: uncharacterized protein LOC101211863 [Cucumis sativus]
Length=168

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  508  YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            YN+ + V  +E E++++NRFRR+V++ G++QECKRRR+FEN
Sbjct  68   YNILITVGENESEDQVVNRFRRQVLRAGILQECKRRRFFEN  108



>ref|NP_001046138.1| Os02g0189000 [Oryza sativa Japonica Group]
 dbj|BAD15528.1| ribosomal protein S21-like protein [Oryza sativa Japonica Group]
 dbj|BAD16466.1| ribosomal protein S21-like protein [Oryza sativa Japonica Group]
 dbj|BAF08052.1| Os02g0189000 [Oryza sativa Japonica Group]
 gb|EAY84798.1| hypothetical protein OsI_06165 [Oryza sativa Indica Group]
 gb|EAZ22029.1| hypothetical protein OsJ_05685 [Oryza sativa Japonica Group]
 dbj|BAH00006.1| unnamed protein product [Oryza sativa Japonica Group]
Length=146

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -1

Query  601  QQYPSPLSGNSELMSVVCPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGL  422
            ++ P P S    ++ V  P    A       YNV+++VD +E EE +  RFRREVM+ G+
Sbjct  25   RRSPPPPS----VVHVAPPRSPTAAVAATKGYNVQIVVDENEGEESIFRRFRREVMRAGV  80

Query  421  IQECKRRRYFEN  386
            +QE KRRR +E+
Sbjct  81   LQEIKRRRRYES  92



>ref|XP_003608899.1| 30S ribosomal protein S21 [Medicago truncatula]
 gb|AES91096.1| ribosomal protein S21 [Medicago truncatula]
Length=150

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 6/64 (9%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFFSSYNVEL-IVDGDEPEERLLNRFRREVMKTGLIQECKRR  401
            G+    ++  P+L+    +     NV++ IVD DEPE+ L+NRFR+EV+  G+ QEC+RR
Sbjct  32   GHVSFSTIAYPTLSVKYYV-----NVQINIVDDDEPEDELINRFRKEVIMAGVFQECRRR  86

Query  400  RYFE  389
            R+FE
Sbjct  87   RFFE  90



>ref|XP_010695951.1| PREDICTED: uncharacterized protein LOC104908533 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=105

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  514  SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
             +YNV++IV+ +EPEERLLN FRRE ++  +IQE KRR +FEN
Sbjct  2    GTYNVQVIVEENEPEERLLNWFRREDLRANIIQESKRRGWFEN  44



>ref|XP_003556829.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Glycine 
max]
Length=378

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = -1

Query  583  LSGNSELMSVVCPSLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            +  +S + S++  +L+ +N L F   NV+++V  DE E+R++N F++EV+K G++QECK 
Sbjct  258  IDNDSSVKSILYHALSLSNILHF---NVQIVVGEDELEDRIINHFKKEVLKAGVLQECKH  314

Query  403  RRYFEN  386
            RR+ EN
Sbjct  315  RRFSEN  320



>ref|XP_008439325.1| PREDICTED: uncharacterized protein LOC103484145 [Cucumis melo]
 gb|ADN33967.1| structural constituent of ribosome [Cucumis melo subsp. melo]
Length=168

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  508  YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            YNV + V  +E E++++NRFR +V++ G++QECKRRR+FEN
Sbjct  68   YNVLITVGENESEDQVVNRFRTQVLRAGILQECKRRRFFEN  108



>ref|XP_006647009.1| PREDICTED: pre-mRNA-splicing factor CWC25-like [Oryza brachyantha]
Length=141

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -1

Query  598  QYP-SPLSGNSELMSVVCPSLAHANTLFFS-SYNVELIVDGDEPEERLLNRFRREVMKTG  425
            Q P +P SG     SVV  +      +  +  YNV+++VD +E EE +  RFRREVM+ G
Sbjct  15   QLPLAPFSGRGSPPSVVHVARRLPTAVVAAKGYNVQILVDENEGEESIFRRFRREVMRAG  74

Query  424  LIQECKRRRYFEN  386
            ++QE KRRR +E+
Sbjct  75   VLQEIKRRRRYES  87



>sp|P82024.1|RR21_SPIOL RecName: Full=30S ribosomal protein S21, chloroplastic, partial 
[Spinacia oleracea]
Length=35

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  520  FFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQ  416
            F S+YNV+++VD +E EERLLNRFRREVM+ G+IQ
Sbjct  1    FRSAYNVQVLVDDNENEERLLNRFRREVMRAGVIQ  35



>ref|XP_004236357.1| PREDICTED: uncharacterized protein LOC101245346 isoform X2 [Solanum 
lycopersicum]
Length=141

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  544  SLAHANTLFFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            S   A  L  SS ++ ++    EPEE+L+ RFRREV + G+IQE KRRR+FE+
Sbjct  33   STVRAVPLCVSSTSLPVVAGEHEPEEKLIGRFRREVFRAGVIQESKRRRFFES  85



>ref|XP_001755640.1| predicted protein [Physcomitrella patens]
 gb|EDQ79700.1| predicted protein [Physcomitrella patens]
Length=179

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -1

Query  580  SGNSELMSVVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKR  404
            S ++ +MS++ P +   N ++F  SYN ++ V  DE  + ++ RFRR V   G+I EC+R
Sbjct  59   SCSAPIMSMLHPGMEFVNVMYFKGSYNAQIFVGEDESADSVVRRFRRAVSAAGVIPECRR  118

Query  403  RRYFEN  386
            RR+ E 
Sbjct  119  RRFHET  124



>ref|XP_002986350.1| hypothetical protein SELMODRAFT_446607 [Selaginella moellendorffii]
 gb|EFJ12559.1| hypothetical protein SELMODRAFT_446607 [Selaginella moellendorffii]
Length=180

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRR  401
            G +       PS A+AN ++     N  +IV+ +E  + ++ RFRREVM  G+I EC+RR
Sbjct  42   GAASSSGAAFPSAANANLMWSGKPANAAIIVNANEGPDSIVRRFRREVMSAGIIAECRRR  101

Query  400  RYFE  389
            RY E
Sbjct  102  RYHE  105



>ref|XP_002979101.1| hypothetical protein SELMODRAFT_444102 [Selaginella moellendorffii]
 gb|EFJ20058.1| hypothetical protein SELMODRAFT_444102 [Selaginella moellendorffii]
Length=180

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = -1

Query  577  GNSELMSVVCPSLAHANTLFFSS-YNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRR  401
            G +       PS A+AN ++     N  +IV+ +E  + ++ RFRREVM  G+I EC+RR
Sbjct  42   GAASSSGAAFPSAANANVMWSGKPANAAIIVNENEGPDSIVRRFRREVMSAGIIAECRRR  101

Query  400  RYFE  389
            RY E
Sbjct  102  RYHE  105



>ref|XP_005849533.1| hypothetical protein CHLNCDRAFT_142894 [Chlorella variabilis]
 gb|EFN57431.1| hypothetical protein CHLNCDRAFT_142894 [Chlorella variabilis]
Length=138

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 9/52 (17%)
 Frame = -1

Query  514  SSYNVELIVDGDEPEERLLNRFRREVMKTG---------LIQECKRRRYFEN  386
            S+Y V+++V  DEP++  L RFRREVM  G         +I E +RRRYFEN
Sbjct  35   STYQVQVVVGDDEPQDNALKRFRREVMSAGKHRTHRSFCVIPEVRRRRYFEN  86



>ref|XP_011402006.1| hypothetical protein F751_6476 [Auxenochlorella protothecoides]
 gb|KFM28957.1| hypothetical protein F751_6476 [Auxenochlorella protothecoides]
Length=145

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  502  VELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            ++++V  +EP++  L RF+REVM TGL+QE +RRR FEN
Sbjct  1    MQIVVGSEEPQDIALKRFKREVMNTGLVQEVRRRRRFEN  39



>gb|ABK26425.1| unknown [Picea sitchensis]
Length=143

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -1

Query  556  VVCPSLAHANTLFF-SSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            V+ P  +    +F    YN ++ V  +E E+ ++ RFRREV K  + +EC+RRR+FE+
Sbjct  36   VLSPPASSVKPIFSRGGYNAQIFVGENESEDSVVRRFRREVFKANVFEECRRRRFFES  93



>ref|XP_003057077.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58722.1| predicted protein [Micromonas pusilla CCMP1545]
Length=103

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  520  FFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            F  SY  E+ V  +E  E  + RFRR VM +G I E +RRRYFEN
Sbjct  4    FKGSYQAEVTVGENEAGESAIRRFRRAVMNSGHINETRRRRYFEN  48



>ref|XP_002502355.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63613.1| predicted protein [Micromonas sp. RCC299]
Length=110

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  520  FFSSYNVELIVDGDEPEERLLNRFRREVMKTGLIQECKRRRYFEN  386
            F  +Y  E+ V  +E  E  + RFRR VM +G I E +RRRYFEN
Sbjct  14   FKGTYQAEVTVGENENGESAIRRFRRAVMSSGHINETRRRRYFEN  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470