BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF051A12

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010654246.1|  PREDICTED: uncharacterized protein LOC100253004  82.8    9e-17   Vitis vinifera
ref|XP_004231729.1|  PREDICTED: uncharacterized protein LOC101246579  82.4    9e-17   Solanum lycopersicum
ref|XP_007045592.1|  Uncharacterized protein isoform 2                82.0    2e-16   
ref|XP_006345315.1|  PREDICTED: uncharacterized protein LOC102605612  80.9    4e-16   Solanum tuberosum [potatoes]
ref|XP_009615604.1|  PREDICTED: uncharacterized protein LOC104108...  79.7    1e-15   Nicotiana tomentosiformis
ref|XP_009615603.1|  PREDICTED: uncharacterized protein LOC104108...  79.7    1e-15   Nicotiana tomentosiformis
ref|XP_009779605.1|  PREDICTED: uncharacterized protein LOC104228768  79.3    1e-15   Nicotiana sylvestris
emb|CDP05411.1|  unnamed protein product                              76.6    1e-14   Coffea canephora [robusta coffee]
ref|XP_004151757.1|  PREDICTED: uncharacterized protein LOC101221885  75.1    2e-14   
ref|XP_009346422.1|  PREDICTED: uncharacterized protein LOC103938...  75.5    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_010541849.1|  PREDICTED: uncharacterized protein LOC104815229  75.5    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_004148577.1|  PREDICTED: uncharacterized protein LOC101202864  74.7    4e-14   
ref|XP_004170882.1|  PREDICTED: uncharacterized LOC101221885          75.1    4e-14   
ref|XP_004170330.1|  PREDICTED: uncharacterized protein LOC101223452  75.1    5e-14   
ref|NP_001118666.1|  uncharacterized protein                          75.1    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566648.1|  uncharacterized protein                             74.7    6e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01294.1|  unnamed protein product                              74.3    7e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KGN58523.1|  hypothetical protein Csa_3G656510                     74.7    7e-14   Cucumis sativus [cucumbers]
ref|XP_002531131.1|  conserved hypothetical protein                   73.6    2e-13   
gb|KHG07963.1|  SPAC1F5.02: Putative protein disulfide-isomerase ...  73.2    2e-13   Gossypium arboreum [tree cotton]
ref|XP_008461874.1|  PREDICTED: uncharacterized protein LOC103500...  72.8    3e-13   
ref|XP_011462365.1|  PREDICTED: uncharacterized protein LOC101290944  72.8    3e-13   Fragaria vesca subsp. vesca
ref|XP_008461873.1|  PREDICTED: uncharacterized protein LOC103500...  72.8    4e-13   Cucumis melo [Oriental melon]
ref|XP_010508086.1|  PREDICTED: uncharacterized protein LOC104784722  72.8    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010487926.1|  PREDICTED: uncharacterized protein LOC104765...  72.4    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010487925.1|  PREDICTED: uncharacterized protein LOC104765...  72.4    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006406457.1|  hypothetical protein EUTSA_v10021444mg           72.0    5e-13   Eutrema salsugineum [saltwater cress]
ref|XP_002883204.1|  hypothetical protein ARALYDRAFT_479497           72.0    5e-13   Arabidopsis lyrata subsp. lyrata
emb|CDY33417.1|  BnaC01g33080D                                        72.0    6e-13   Brassica napus [oilseed rape]
ref|XP_009111536.1|  PREDICTED: uncharacterized protein LOC103836959  72.0    6e-13   Brassica rapa
ref|XP_008223898.1|  PREDICTED: uncharacterized protein LOC103323668  71.6    7e-13   Prunus mume [ume]
gb|KFK39306.1|  hypothetical protein AALP_AA3G227200                  71.6    9e-13   Arabis alpina [alpine rockcress]
ref|XP_010031880.1|  PREDICTED: uncharacterized protein LOC104421586  71.2    1e-12   Eucalyptus grandis [rose gum]
gb|KDO53001.1|  hypothetical protein CISIN_1g025385mg                 70.9    2e-12   Citrus sinensis [apfelsine]
ref|XP_006437516.1|  hypothetical protein CICLE_v10032529mg           70.9    2e-12   Citrus clementina [clementine]
ref|XP_006484659.1|  PREDICTED: uncharacterized protein LOC102620...  70.9    2e-12   Citrus sinensis [apfelsine]
ref|XP_006298467.1|  hypothetical protein CARUB_v10014536mg           70.5    2e-12   Capsella rubella
ref|XP_006484661.1|  PREDICTED: uncharacterized protein LOC102620...  70.5    2e-12   
ref|XP_006484660.1|  PREDICTED: uncharacterized protein LOC102620...  70.5    2e-12   
ref|XP_010466141.1|  PREDICTED: uncharacterized protein LOC104746377  69.7    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_011070435.1|  PREDICTED: uncharacterized protein LOC105156092  68.2    1e-11   Sesamum indicum [beniseed]
ref|XP_009346424.1|  PREDICTED: uncharacterized protein LOC103938...  67.4    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_010277278.1|  PREDICTED: uncharacterized protein LOC104611776  67.4    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010688733.1|  PREDICTED: uncharacterized protein LOC104902...  65.1    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007045591.1|  Uncharacterized protein isoform 1                65.1    2e-10   
gb|KHG07962.1|  putative E3 ubiquitin-protein ligase                  63.9    4e-10   Gossypium arboreum [tree cotton]
gb|EYU35589.1|  hypothetical protein MIMGU_mgv1a022689mg              61.6    5e-10   Erythranthe guttata [common monkey flower]
emb|CAN71835.1|  hypothetical protein VITISV_002916                   62.4    1e-09   Vitis vinifera
ref|NP_001239977.1|  uncharacterized protein LOC100788798             62.0    2e-09   Glycine max [soybeans]
ref|XP_010943909.1|  PREDICTED: uncharacterized protein LOC105061527  60.8    5e-09   Elaeis guineensis
ref|XP_007131659.1|  hypothetical protein PHAVU_011G031300g           59.7    2e-08   Phaseolus vulgaris [French bean]
ref|XP_010943915.1|  PREDICTED: uncharacterized protein LOC105061534  58.5    4e-08   
ref|XP_009384584.1|  PREDICTED: uncharacterized protein LOC103972...  55.8    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384585.1|  PREDICTED: uncharacterized protein LOC103972...  55.8    5e-07   
ref|XP_009384583.1|  PREDICTED: uncharacterized protein LOC103972...  55.8    5e-07   
ref|XP_009384581.1|  PREDICTED: uncharacterized protein LOC103972...  55.5    5e-07   
ref|XP_007131660.1|  hypothetical protein PHAVU_011G031300g           54.7    8e-07   Phaseolus vulgaris [French bean]
ref|XP_004505731.1|  PREDICTED: uncharacterized protein LOC101505578  55.1    9e-07   Cicer arietinum [garbanzo]
ref|XP_003607213.1|  hypothetical protein MTR_4g074590                53.9    3e-06   Medicago truncatula
ref|XP_006590298.1|  PREDICTED: uncharacterized protein LOC100788...  53.5    3e-06   Glycine max [soybeans]
ref|NP_001145018.1|  hypothetical protein                             52.0    1e-05   Zea mays [maize]
ref|XP_002448205.1|  hypothetical protein SORBIDRAFT_06g023050        51.6    2e-05   Sorghum bicolor [broomcorn]
ref|XP_004976285.1|  PREDICTED: uncharacterized protein LOC101773181  49.7    8e-05   Setaria italica
ref|XP_010688734.1|  PREDICTED: uncharacterized protein LOC104902...  46.6    7e-04   
gb|KDO53002.1|  hypothetical protein CISIN_1g025385mg                 46.6    7e-04   Citrus sinensis [apfelsine]
ref|XP_006437517.1|  hypothetical protein CICLE_v10032529mg           46.6    7e-04   
ref|XP_006653610.1|  PREDICTED: uncharacterized protein LOC102712991  46.2    9e-04   



>ref|XP_010654246.1| PREDICTED: uncharacterized protein LOC100253004 [Vitis vinifera]
Length=235

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EANLDSL+QDT+RL TSVK+TCSE+CEKSEP LQ+   +NAA +D 
Sbjct  163  GGDDPSVIYVKPGCEANLDSLIQDTIRLTTSVKDTCSETCEKSEPTLQYIGAKNAASIDM  222

Query  161  RWSRLXELKNAGL  123
            RWSRL EL+NA L
Sbjct  223  RWSRLLELRNANL  235



>ref|XP_004231729.1| PREDICTED: uncharacterized protein LOC101246579 [Solanum lycopersicum]
Length=219

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G++DPSV YVKPG EA+LDSL+QDTVRLATSVKETCSESCEKS PKLQ   KQNAA +D 
Sbjct  148  GWDDPSVIYVKPGFEADLDSLIQDTVRLATSVKETCSESCEKSVPKLQPLGKQNAASIDR  207

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  208  RWSRLLELK  216



>ref|XP_007045592.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY01424.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=262

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EANLDSL+QDT+RL T+ K+TCSESC+KSEP L++  K+NAA +D 
Sbjct  185  GGDDPSVIYVKPGYEANLDSLIQDTIRLTTTTKDTCSESCQKSEPTLRYIGKKNAASIDK  244

Query  161  RWSRLXELKNAGLXNMYI  108
            RW RL EL+ A L +  I
Sbjct  245  RWCRLLELRKANLHDANI  262



>ref|XP_006345315.1| PREDICTED: uncharacterized protein LOC102605612 [Solanum tuberosum]
Length=218

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G++DPSV YVKPG EA+LDSL+QDT+RLATSVKETCSESCEKSEPKLQ   KQNAA +D 
Sbjct  147  GWDDPSVIYVKPGLEADLDSLIQDTLRLATSVKETCSESCEKSEPKLQPLGKQNAASIDR  206

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  207  RWSRLLELK  215



>ref|XP_009615604.1| PREDICTED: uncharacterized protein LOC104108307 isoform X2 [Nicotiana 
tomentosiformis]
Length=208

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G++DPSV YVKPG EA+LDSL+QDT+ LA +VKETCSESCEKS+PKLQ   K+NAA +D 
Sbjct  132  GWDDPSVIYVKPGFEADLDSLIQDTISLAAAVKETCSESCEKSQPKLQPLGKENAASIDR  191

Query  161  RWSRLXELKNAGL  123
            RWSRL ELK   L
Sbjct  192  RWSRLLELKKVTL  204



>ref|XP_009615603.1| PREDICTED: uncharacterized protein LOC104108307 isoform X1 [Nicotiana 
tomentosiformis]
Length=238

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G++DPSV YVKPG EA+LDSL+QDT+ LA +VKETCSESCEKS+PKLQ   K+NAA +D 
Sbjct  162  GWDDPSVIYVKPGFEADLDSLIQDTISLAAAVKETCSESCEKSQPKLQPLGKENAASIDR  221

Query  161  RWSRLXELKNAGL  123
            RWSRL ELK   L
Sbjct  222  RWSRLLELKKVTL  234



>ref|XP_009779605.1| PREDICTED: uncharacterized protein LOC104228768 [Nicotiana sylvestris]
Length=235

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G++DPSV YVKPG EA+LDSL+QDT+ LA +VKETCS+SCEKSEPKLQ   KQNAA +D 
Sbjct  159  GWDDPSVIYVKPGFEADLDSLIQDTISLAAAVKETCSKSCEKSEPKLQPLGKQNAASIDR  218

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  219  RWSRLLELK  227



>emb|CDP05411.1| unnamed protein product [Coffea canephora]
Length=225

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLVQD++RLA SVKETCSE+CE SEPKL     QNAA VD 
Sbjct  152  GGDDPSVIYVKPGCEADLDSLVQDSIRLAASVKETCSEACENSEPKLHHMGVQNAASVDR  211

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  212  RWSRLLELK  220



>ref|XP_004151757.1| PREDICTED: uncharacterized protein LOC101221885, partial [Cucumis 
sativus]
Length=127

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSE CEKS+P +Q+   QNAA +D 
Sbjct  55   GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSEMCEKSQPTVQYIGAQNAASIDK  114

Query  161  RWSRLXELKNA  129
            RWSRL EL+ +
Sbjct  115  RWSRLLELRKS  125



>ref|XP_009346422.1| PREDICTED: uncharacterized protein LOC103938151 isoform X1 [Pyrus 
x bretschneideri]
Length=235

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EA LDSL+QDT+RLATS+K+TCSE CEKS P +Q+   ++ A VD 
Sbjct  164  GGDDPSVIYVKPGNEAELDSLIQDTIRLATSIKDTCSELCEKSYPTVQYIGGKSTASVDK  223

Query  161  RWSRLXELKN  132
            RWSRL ELKN
Sbjct  224  RWSRLLELKN  233



>ref|XP_010541849.1| PREDICTED: uncharacterized protein LOC104815229 [Tarenaya hassleriana]
Length=239

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSL+QDT+RL T   + CS++CE+SEP +Q+  + N A VD 
Sbjct  164  GGDDPSVIYVRPGYEANLDSLIQDTIRLTTYANDACSDACEQSEPTMQYIGETNTASVDK  223

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  224  RWSRLLELK  232



>ref|XP_004148577.1| PREDICTED: uncharacterized protein LOC101202864 [Cucumis sativus]
Length=186

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSE CEKS+P +Q+   QNAA +D 
Sbjct  114  GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSEMCEKSQPTVQYIGAQNAASIDK  173

Query  161  RWSRLXELKNA  129
            RWSRL EL+ +
Sbjct  174  RWSRLLELRKS  184



>ref|XP_004170882.1| PREDICTED: uncharacterized LOC101221885 [Cucumis sativus]
Length=231

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSE CEKS+P +Q+   QNAA +D 
Sbjct  159  GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSEMCEKSQPTVQYIGAQNAASIDK  218

Query  161  RWSRLXELK  135
            RWSRL EL+
Sbjct  219  RWSRLLELR  227



>ref|XP_004170330.1| PREDICTED: uncharacterized protein LOC101223452 [Cucumis sativus]
Length=230

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSE CEKS+P +Q+   QNAA +D 
Sbjct  158  GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSEMCEKSQPTVQYIGAQNAASIDK  217

Query  161  RWSRLXELKNA  129
            RWSRL EL+ +
Sbjct  218  RWSRLLELRKS  228



>ref|NP_001118666.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76291.1| uncharacterized protein AT3G19800 [Arabidopsis thaliana]
Length=226

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A VD 
Sbjct  156  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGQTNTASVDK  215

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  216  RWSRLLELK  224



>ref|NP_566648.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK25860.1|AF360150_1 unknown protein [Arabidopsis thaliana]
 gb|AAL07155.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65634.1| unknown [Arabidopsis thaliana]
 gb|AEE76290.1| uncharacterized protein AT3G19800 [Arabidopsis thaliana]
Length=229

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A VD 
Sbjct  159  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGQTNTASVDK  218

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  219  RWSRLLELK  227



>dbj|BAB01294.1| unnamed protein product [Arabidopsis thaliana]
Length=196

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A VD 
Sbjct  126  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGQTNTASVDK  185

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  186  RWSRLLELK  194



>gb|KGN58523.1| hypothetical protein Csa_3G656510 [Cucumis sativus]
Length=269

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSE CEKS+P +Q+   QNAA +D 
Sbjct  197  GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSEMCEKSQPTVQYIGAQNAASIDK  256

Query  161  RWSRLXELKNAG  126
            RWSRL EL+ + 
Sbjct  257  RWSRLLELRKSN  268



>ref|XP_002531131.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31251.1| conserved hypothetical protein [Ricinus communis]
Length=248

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 3/76 (4%)
 Frame = -1

Query  341  GYEDPS---VXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAP  171
            G+  P+   V YVKPG+EANLDSL+QDT+RL TSVK+ CSESCEKSE  LQ+   QNAA 
Sbjct  173  GFCHPTKTMVIYVKPGYEANLDSLIQDTIRLTTSVKDICSESCEKSEFTLQYIGGQNAAS  232

Query  170  VDXRWSRLXELKNAGL  123
            +D RWSRL ELK A L
Sbjct  233  IDKRWSRLLELKKAAL  248



>gb|KHG07963.1| SPAC1F5.02: Putative protein disulfide-isomerase C1F5.02 [Gossypium 
arboreum]
 gb|KHG14051.1| SPAC1F5.02: Putative protein disulfide-isomerase C1F5.02 [Gossypium 
arboreum]
Length=214

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  323  VXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWSRLX  144
            V YVKPG+EANLDSL+QDT+RL TS K+ CSESC KSEP L++  K+NAA +D RW RL 
Sbjct  148  VIYVKPGYEANLDSLIQDTIRLTTSTKDICSESCRKSEPTLRYIGKRNAASIDKRWYRLL  207

Query  143  ELKNAGL  123
            EL+NA  
Sbjct  208  ELRNASF  214



>ref|XP_008461874.1| PREDICTED: uncharacterized protein LOC103500366 isoform X2 [Cucumis 
melo]
Length=230

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSESCEKS+P +Q+   QNAA +D 
Sbjct  158  GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSESCEKSQPTVQYIGAQNAASIDK  217

Query  161  RWSRLXELKNA  129
            RW RL EL+ +
Sbjct  218  RWFRLLELRKS  228



>ref|XP_011462365.1| PREDICTED: uncharacterized protein LOC101290944 [Fragaria vesca 
subsp. vesca]
Length=234

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EA LDSLVQD++RLATS+K+TCSE CEKS P +Q+   +  A +D 
Sbjct  163  GGDDPSVIYVKPGNEAELDSLVQDSIRLATSIKDTCSELCEKSYPTVQYIGGERKASIDK  222

Query  161  RWSRLXELKN  132
            RWSRL ELKN
Sbjct  223  RWSRLLELKN  232



>ref|XP_008461873.1| PREDICTED: uncharacterized protein LOC103500366 isoform X1 [Cucumis 
melo]
Length=231

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSLV+DT+RL TS K+TCSESCEKS+P +Q+   QNAA +D 
Sbjct  159  GGDDPSVIYVKPGLEADLDSLVRDTIRLTTSTKDTCSESCEKSQPTVQYIGAQNAASIDK  218

Query  161  RWSRLXELKNA  129
            RW RL EL+ +
Sbjct  219  RWFRLLELRKS  229



>ref|XP_010508086.1| PREDICTED: uncharacterized protein LOC104784722 [Camelina sativa]
Length=250

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  ++N A V  
Sbjct  180  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGEKNTASVHK  239

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  240  RWSRLLELK  248



>ref|XP_010487926.1| PREDICTED: uncharacterized protein LOC104765848 isoform X2 [Camelina 
sativa]
Length=192

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+ CEKSEP L +  + N A V  
Sbjct  122  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDLCEKSEPTLHYVGETNTASVQK  181

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  182  RWSRLLELK  190



>ref|XP_010487925.1| PREDICTED: uncharacterized protein LOC104765848 isoform X1 [Camelina 
sativa]
Length=228

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+ CEKSEP L +  + N A V  
Sbjct  158  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDLCEKSEPTLHYVGETNTASVQK  217

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  218  RWSRLLELK  226



>ref|XP_006406457.1| hypothetical protein EUTSA_v10021444mg [Eutrema salsugineum]
 gb|ESQ47910.1| hypothetical protein EUTSA_v10021444mg [Eutrema salsugineum]
Length=232

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A V  
Sbjct  161  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETNTASVHK  220

Query  161  RWSRLXELKN  132
            RWSRL ELK 
Sbjct  221  RWSRLLELKT  230



>ref|XP_002883204.1| hypothetical protein ARALYDRAFT_479497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59463.1| hypothetical protein ARALYDRAFT_479497 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A V  
Sbjct  156  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETNTASVHK  215

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  216  RWSRLLELK  224



>emb|CDY33417.1| BnaC01g33080D [Brassica napus]
Length=235

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A V  
Sbjct  164  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETNTASVHK  223

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  224  RWSRLLELK  232



>ref|XP_009111536.1| PREDICTED: uncharacterized protein LOC103836959 [Brassica rapa]
 emb|CDY42206.1| BnaA01g25890D [Brassica napus]
Length=235

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  + N A V  
Sbjct  164  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETNTASVHK  223

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  224  RWSRLLELK  232



>ref|XP_008223898.1| PREDICTED: uncharacterized protein LOC103323668 [Prunus mume]
 ref|XP_008223899.1| PREDICTED: uncharacterized protein LOC103323668 [Prunus mume]
Length=230

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EA LDSL+QDT+RLATS+K+TCSE CEKS P +++   Q+ A +D 
Sbjct  159  GGDDPSVIYVKPGNEAELDSLIQDTIRLATSIKDTCSELCEKSYPTVEYIGGQSTASIDK  218

Query  161  RWSRLXELKN  132
            RWSRL EL++
Sbjct  219  RWSRLLELRD  228



>gb|KFK39306.1| hypothetical protein AALP_AA3G227200 [Arabis alpina]
Length=235

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L    + N A V  
Sbjct  165  GGDDPSVIYVKPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHHIGETNTASVHK  224

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  225  RWSRLLELK  233



>ref|XP_010031880.1| PREDICTED: uncharacterized protein LOC104421586 [Eucalyptus grandis]
 gb|KCW51282.1| hypothetical protein EUGRSUZ_J00853 [Eucalyptus grandis]
Length=226

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EA+LD L+QDT+RL TSVK+TCSE CEKSEP LQ+     AA VD 
Sbjct  154  GGDDPSVIYVKPGYEAHLDQLIQDTLRLTTSVKDTCSELCEKSEPTLQYIGGPKAASVDK  213

Query  161  RWSRLXELKN  132
            RW RL ELKN
Sbjct  214  RWCRLLELKN  223



>gb|KDO53001.1| hypothetical protein CISIN_1g025385mg [Citrus sinensis]
Length=253

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DPSV YVKPG++A+LDSLVQDT+RL T+VK+TCSE+CE SEP +Q+   +N A +  RW 
Sbjct  180  DPSVIYVKPGYQADLDSLVQDTIRLTTAVKDTCSETCENSEPTVQYIGAKNTASMAKRWG  239

Query  152  RLXELKNAGLXNMY  111
            RL EL+N  L  M+
Sbjct  240  RLLELRNTQLYGMH  253



>ref|XP_006437516.1| hypothetical protein CICLE_v10032529mg [Citrus clementina]
 gb|ESR50756.1| hypothetical protein CICLE_v10032529mg [Citrus clementina]
Length=253

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DPSV YVKPG++A+LDSLVQDT+RL T+VK+TCSE+CE SEP +Q+   +N A +  RW 
Sbjct  180  DPSVIYVKPGYQADLDSLVQDTIRLTTAVKDTCSETCENSEPTVQYIGAKNTASMAKRWG  239

Query  152  RLXELKNAGLXNMY  111
            RL EL+N  L  M+
Sbjct  240  RLLELRNTQLYGMH  253



>ref|XP_006484659.1| PREDICTED: uncharacterized protein LOC102620378 isoform X1 [Citrus 
sinensis]
Length=253

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DPSV YVKPG++A+LDSLVQDT+RL T+VK+TCSE+CE SEP +Q+   +N A +  RW 
Sbjct  180  DPSVIYVKPGYQADLDSLVQDTIRLTTAVKDTCSETCENSEPTVQYIGAKNTASMAKRWG  239

Query  152  RLXELKNAGLXNMY  111
            RL EL+N  L  M+
Sbjct  240  RLLELRNTQLYGMH  253



>ref|XP_006298467.1| hypothetical protein CARUB_v10014536mg [Capsella rubella]
 gb|EOA31365.1| hypothetical protein CARUB_v10014536mg [Capsella rubella]
Length=232

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  +   A  D 
Sbjct  162  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETKTASFDK  221

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  222  RWSRLLELK  230



>ref|XP_006484661.1| PREDICTED: uncharacterized protein LOC102620378 isoform X3 [Citrus 
sinensis]
Length=232

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DPSV YVKPG++A+LDSLVQDT+RL T+VK+TCSE+CE SEP +Q+   +N A +  RW 
Sbjct  159  DPSVIYVKPGYQADLDSLVQDTIRLTTAVKDTCSETCENSEPTVQYIGAKNTASMAKRWG  218

Query  152  RLXELKNAGLXNMY  111
            RL EL+N  L  M+
Sbjct  219  RLLELRNTQLYGMH  232



>ref|XP_006484660.1| PREDICTED: uncharacterized protein LOC102620378 isoform X2 [Citrus 
sinensis]
Length=233

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DPSV YVKPG++A+LDSLVQDT+RL T+VK+TCSE+CE SEP +Q+   +N A +  RW 
Sbjct  160  DPSVIYVKPGYQADLDSLVQDTIRLTTAVKDTCSETCENSEPTVQYIGAKNTASMAKRWG  219

Query  152  RLXELKNAGLXNMY  111
            RL EL+N  L  M+
Sbjct  220  RLLELRNTQLYGMH  233



>ref|XP_010466141.1| PREDICTED: uncharacterized protein LOC104746377 [Camelina sativa]
Length=228

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YV+PG+EANLDSLVQDT+RL T  K+ CS+SCEKSEP L +  +   A V  
Sbjct  158  GGDDPSVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETKTASVHK  217

Query  161  RWSRLXELK  135
            RWSRL ELK
Sbjct  218  RWSRLLELK  226



>ref|XP_011070435.1| PREDICTED: uncharacterized protein LOC105156092 [Sesamum indicum]
Length=234

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG+EANLD L+QD +RLATSV+ETCSESC  S+PKL     +N A ++ 
Sbjct  162  GADDPSVIYVKPGYEANLDPLIQDNIRLATSVEETCSESCNNSQPKLHHLGARNRASIER  221

Query  161  RWSRLXELKNAGL  123
            RW +L ELK   +
Sbjct  222  RWHKLLELKKTSI  234



>ref|XP_009346424.1| PREDICTED: uncharacterized protein LOC103938151 isoform X2 [Pyrus 
x bretschneideri]
Length=205

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  323  VXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWSRLX  144
            V YVKPG+EA LDSL+QDT+RLATS+K+TCSE CEKS P +Q+   ++ A VD RWSRL 
Sbjct  140  VIYVKPGNEAELDSLIQDTIRLATSIKDTCSELCEKSYPTVQYIGGKSTASVDKRWSRLL  199

Query  143  ELKN  132
            ELKN
Sbjct  200  ELKN  203



>ref|XP_010277278.1| PREDICTED: uncharacterized protein LOC104611776 [Nelumbo nucifera]
Length=232

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA+LDSL++DT+RL TSVK+TCSESCEKSEPK ++   +  AP+D 
Sbjct  162  GGDDPSVIYVKPGCEADLDSLIRDTIRLTTSVKDTCSESCEKSEPKWRYTGARE-APIDG  220

Query  161  RWSRLXELKNA  129
            RWSRL EL+ A
Sbjct  221  RWSRLLELRKA  231



>ref|XP_010688733.1| PREDICTED: uncharacterized protein LOC104902603 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=232

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPSV YVKPG EA LDSL++DT+RL TSVKETCSESCEKSEPKL +   Q  A +D 
Sbjct  160  GSDDPSVIYVKPGCEAELDSLIKDTIRLQTSVKETCSESCEKSEPKLHYIGDQRTASLDR  219

Query  161  RWSRLXELK  135
            RWS L +L+
Sbjct  220  RWSGLLQLR  228



>ref|XP_007045591.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY01423.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=257

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPS+ Y     EANLDSL+QDT+RL T+ K+TCSESC+KSEP L++  K+NAA +D 
Sbjct  185  GGDDPSLRY-----EANLDSLIQDTIRLTTTTKDTCSESCQKSEPTLRYIGKKNAASIDK  239

Query  161  RWSRLXELKNAGLXNMYI  108
            RW RL EL+ A L +  I
Sbjct  240  RWCRLLELRKANLHDANI  257



>gb|KHG07962.1| putative E3 ubiquitin-protein ligase [Gossypium arboreum]
 gb|KHG14050.1| putative E3 ubiquitin-protein ligase [Gossypium arboreum]
Length=240

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 5/73 (7%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G +DPS+ Y     EANLDSL+QDT+RL TS K+ CSESC KSEP L++  K+NAA +D 
Sbjct  173  GGDDPSLRY-----EANLDSLIQDTIRLTTSTKDICSESCRKSEPTLRYIGKRNAASIDK  227

Query  161  RWSRLXELKNAGL  123
            RW RL EL+NA  
Sbjct  228  RWYRLLELRNASF  240



>gb|EYU35589.1| hypothetical protein MIMGU_mgv1a022689mg, partial [Erythranthe 
guttata]
Length=71

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  323  VXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWSRLX  144
            V YVKPG +A+LDSL+QDT+RLATSV ETCSESCEKSEPK+     +N A ++ RWS+L 
Sbjct  1    VIYVKPGFDADLDSLIQDTIRLATSVIETCSESCEKSEPKMHHLGARNTASIEKRWSKLL  60

Query  143  ELK  135
            ELK
Sbjct  61   ELK  63



>emb|CAN71835.1| hypothetical protein VITISV_002916 [Vitis vinifera]
Length=173

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 44/69 (64%), Gaps = 8/69 (12%)
 Frame = -1

Query  323  VXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXD--KQNAAPVDXRWSR  150
            V YVKPG EANLDSL+QDT+RL TSVK            +  F D   +NAA +D RWSR
Sbjct  111  VIYVKPGCEANLDSLIQDTIRLTTSVKAVKLTE------EFDFADIGAKNAASIDMRWSR  164

Query  149  LXELKNAGL  123
            L EL+NA L
Sbjct  165  LLELRNANL  173



>ref|NP_001239977.1| uncharacterized protein LOC100788798 [Glycine max]
 gb|ACU23978.1| unknown [Glycine max]
 gb|KHN32271.1| hypothetical protein glysoja_039134 [Glycine soja]
Length=247

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DP+V YV+PG+E +LDSLVQD +RL + VK+TCSE CEKSE  +Q+   Q  A VD RWS
Sbjct  178  DPNVIYVRPGYEVDLDSLVQDAIRLNSVVKDTCSELCEKSEGTIQYITGQGQASVDKRWS  237

Query  152  RLXELKNAGL  123
            RL ELK   L
Sbjct  238  RLLELKKENL  247



>ref|XP_010943909.1| PREDICTED: uncharacterized protein LOC105061527 [Elaeis guineensis]
Length=240

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YV PG EAN+DSL+QDT+RL          S    +P L +   +     D 
Sbjct  171  GGSDPSVIYVTPGSEANIDSLIQDTIRLT--ASAKDICSESCEKPALIWQYSEGKRGYDQ  228

Query  161  RWSRLXELKNA  129
            RWSRL E+KNA
Sbjct  229  RWSRLLEIKNA  239



>ref|XP_007131659.1| hypothetical protein PHAVU_011G031300g [Phaseolus vulgaris]
 gb|ESW03653.1| hypothetical protein PHAVU_011G031300g [Phaseolus vulgaris]
Length=250

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -1

Query  335  EDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRW  156
            +DP+V YV+PGHE +L SLVQD +RL ++VK++CSE CEK+E  +Q+   +  A VD RW
Sbjct  180  DDPNVIYVRPGHEVDLGSLVQDAIRLTSAVKDSCSELCEKTEGTIQYITGETQASVDKRW  239

Query  155  SRLXELKNAGL  123
            SRL  LK   L
Sbjct  240  SRLLALKKRNL  250



>ref|XP_010943915.1| PREDICTED: uncharacterized protein LOC105061534 [Elaeis guineensis]
Length=244

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DPSV YV PG EAN+DSL+QDT+RL          S    +P L +   +     D RWS
Sbjct  178  DPSVIYVTPGSEANIDSLIQDTIRLT--ASAKDICSESCEKPALIWQYSEGKRGYDQRWS  235

Query  152  RLXELKNA  129
            RL E+KNA
Sbjct  236  RLLEIKNA  243



>ref|XP_009384584.1| PREDICTED: uncharacterized protein LOC103972105 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YVKPG EA+LDS++QDT+RL  S K+TCSESC K+    Q  D++     D 
Sbjct  176  GGNDPSVIYVKPGSEADLDSIIQDTIRLTASAKDTCSESCAKTTIIWQSTDEKK--EYDR  233

Query  161  RWSRLXELKNA  129
            RW RL E+++A
Sbjct  234  RWHRLLEIRDA  244



>ref|XP_009384585.1| PREDICTED: uncharacterized protein LOC103972105 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=244

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YVKPG EA+LDS++QDT+RL  S K+TCSESC K+    Q  D++     D 
Sbjct  175  GGNDPSVIYVKPGSEADLDSIIQDTIRLTASAKDTCSESCAKTTIIWQSTDEKK--EYDR  232

Query  161  RWSRLXELKNA  129
            RW RL E+++A
Sbjct  233  RWHRLLEIRDA  243



>ref|XP_009384583.1| PREDICTED: uncharacterized protein LOC103972105 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YVKPG EA+LDS++QDT+RL  S K+TCSESC K+    Q  D++     D 
Sbjct  175  GGNDPSVIYVKPGSEADLDSIIQDTIRLTASAKDTCSESCAKTTIIWQSTDEKK--EYDR  232

Query  161  RWSRLXELKNA  129
            RW RL E+++A
Sbjct  233  RWHRLLEIRDA  243



>ref|XP_009384581.1| PREDICTED: uncharacterized protein LOC103972105 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=247

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YVKPG EA+LDS++QDT+RL  S K+TCSESC K+    Q  D++     D 
Sbjct  176  GGNDPSVIYVKPGSEADLDSIIQDTIRLTASAKDTCSESCAKTTIIWQSTDEKK--EYDR  233

Query  161  RWSRLXELKNA  129
            RW RL E+++A
Sbjct  234  RWHRLLEIRDA  244



>ref|XP_007131660.1| hypothetical protein PHAVU_011G031300g [Phaseolus vulgaris]
 gb|ESW03654.1| hypothetical protein PHAVU_011G031300g [Phaseolus vulgaris]
Length=221

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -1

Query  323  VXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWSRLX  144
            V YV+PGHE +L SLVQD +RL ++VK++CSE CEK+E  +Q+   +  A VD RWSRL 
Sbjct  155  VIYVRPGHEVDLGSLVQDAIRLTSAVKDSCSELCEKTEGTIQYITGETQASVDKRWSRLL  214

Query  143  ELKNAGL  123
             LK   L
Sbjct  215  ALKKRNL  221



>ref|XP_004505731.1| PREDICTED: uncharacterized protein LOC101505578 [Cicer arietinum]
Length=250

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRWS  153
            DP V YV+PG+E +LDS+V+D +RL +SVK+TCSE CEKSE  + +   Q+ A  D RWS
Sbjct  181  DPYVIYVRPGYEIDLDSIVKDAIRLNSSVKDTCSELCEKSEDTILYTTGQSQASFDKRWS  240

Query  152  RLXELKNAGL  123
            RL ELK   L
Sbjct  241  RLLELKKETL  250



>ref|XP_003607213.1| hypothetical protein MTR_4g074590 [Medicago truncatula]
 gb|ACJ85314.1| unknown [Medicago truncatula]
 gb|AES89410.1| DUF177 domain protein [Medicago truncatula]
 gb|AFK40306.1| unknown [Medicago truncatula]
Length=251

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -1

Query  335  EDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDXRW  156
            +DP V Y +PG+E +LDS+V+D +RL ++V +TCSE C+KSE  +Q    Q+ A  D RW
Sbjct  181  DDPYVIYTRPGYEVDLDSIVKDAIRLNSAVNDTCSELCKKSEGTIQNTSGQSQASFDKRW  240

Query  155  SRLXELK  135
            SRL ELK
Sbjct  241  SRLLELK  247



>ref|XP_006590298.1| PREDICTED: uncharacterized protein LOC100788798 isoform X2 [Glycine 
max]
Length=259

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 12/82 (15%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLAtsvke------------tcsesceksEPKLQFXD  189
            DP+V YV+PG+E +LDSLVQD +RL + VK             TCSE CEKSE  +Q+  
Sbjct  178  DPNVIYVRPGYEVDLDSLVQDAIRLNSVVKVYLAELQIMILQDTCSELCEKSEGTIQYIT  237

Query  188  KQNAAPVDXRWSRLXELKNAGL  123
             Q  A VD RWSRL ELK   L
Sbjct  238  GQGQASVDKRWSRLLELKKENL  259



>ref|NP_001145018.1| hypothetical protein [Zea mays]
 gb|ACG44465.1| hypothetical protein [Zea mays]
 gb|ACR36890.1| unknown [Zea mays]
 tpg|DAA36867.1| TPA: hypothetical protein ZEAMMB73_332388 [Zea mays]
Length=252

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YV+PG E +LDS++Q+TVRL  S K +CSE+CEKS    Q+   Q       
Sbjct  176  GDTDPSVIYVRPGDEVDLDSVIQETVRLTASTKSSCSETCEKSTVVWQYGGSQKKKTSSQ  235

Query  161  RWSRLXELKNA  129
            RWS+L +LK  
Sbjct  236  RWSKLLDLKKT  246



>ref|XP_002448205.1| hypothetical protein SORBIDRAFT_06g023050 [Sorghum bicolor]
 gb|EES12533.1| hypothetical protein SORBIDRAFT_06g023050 [Sorghum bicolor]
Length=251

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YV+PG E +LDS++Q+TVRL  S K +CSE+CEKS    Q+   Q       
Sbjct  175  GDTDPSVIYVRPGDEVDLDSVIQETVRLTASAKSSCSETCEKSTVVWQYGGSQKKKISSQ  234

Query  161  RWSRLXELKNA  129
            RWS+L +LK  
Sbjct  235  RWSKLLDLKKT  245



>ref|XP_004976285.1| PREDICTED: uncharacterized protein LOC101773181 [Setaria italica]
Length=248

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YV+PG E +LDS++Q+TVRL  S K +CSE+CEKS    Q    Q       
Sbjct  172  GDSDPSVIYVRPGEEVDLDSVIQETVRLTASAKSSCSEACEKSTVVWQNGSNQRKKISSQ  231

Query  161  RWSRLXELK  135
            RWS+L +LK
Sbjct  232  RWSKLLDLK  240



>ref|XP_010688734.1| PREDICTED: uncharacterized protein LOC104902603 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=204

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRL  258
            G +DPSV YVKPG EA LDSL++DT+RL
Sbjct  160  GSDDPSVIYVKPGCEAELDSLIKDTIRL  187



>gb|KDO53002.1| hypothetical protein CISIN_1g025385mg [Citrus sinensis]
Length=226

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLA  255
            DPSV YVKPG++A+LDSLVQDT+RL 
Sbjct  180  DPSVIYVKPGYQADLDSLVQDTIRLT  205



>ref|XP_006437517.1| hypothetical protein CICLE_v10032529mg [Citrus clementina]
 gb|ESR50757.1| hypothetical protein CICLE_v10032529mg [Citrus clementina]
Length=226

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  332  DPSVXYVKPGHEANLDSLVQDTVRLA  255
            DPSV YVKPG++A+LDSLVQDT+RL 
Sbjct  180  DPSVIYVKPGYQADLDSLVQDTIRLT  205



>ref|XP_006653610.1| PREDICTED: uncharacterized protein LOC102712991 [Oryza brachyantha]
Length=213

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = -1

Query  341  GYEDPSVXYVKPGHEANLDSLVQDTVRLAtsvketcsesceksEPKLQFXDKQNAAPVDX  162
            G  DPSV YV+PG E +LDS++Q+T+RL  S K +CSE+CEKS    Q+   Q       
Sbjct  138  GDSDPSVIYVRPGAEIDLDSVIQETIRLTASAKSSCSEACEKSTVVWQYGGDQK-KRYSQ  196

Query  161  RWSRLXELK  135
            RWS+L +LK
Sbjct  197  RWSKLLDLK  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558646673120