BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050P09

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004169575.1|  PREDICTED: protein ECERIFERUM 3-like               249   3e-79   
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               260   1e-78   Nicotiana sylvestris
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    259   2e-78   Nicotiana tomentosiformis
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    259   2e-78   Nicotiana tomentosiformis
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like               255   1e-76   Solanum tuberosum [potatoes]
gb|KJB23542.1|  hypothetical protein B456_004G104100                    247   2e-76   Gossypium raimondii
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3         251   1e-75   
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               252   1e-75   Sesamum indicum [beniseed]
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         251   2e-75   Solanum lycopersicum
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         251   2e-75   Solanum lycopersicum
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                250   6e-75   Erythranthe guttata [common monkey flower]
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like               249   8e-75   Cucumis sativus [cucumbers]
emb|CDO98263.1|  unnamed protein product                                250   1e-74   Coffea canephora [robusta coffee]
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    248   2e-74   Cucumis melo [Oriental melon]
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    249   2e-74   Sesamum indicum [beniseed]
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    249   2e-74   Sesamum indicum [beniseed]
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               248   3e-74   Sesamum indicum [beniseed]
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 248   5e-74   
gb|KJB23543.1|  hypothetical protein B456_004G104100                    247   6e-74   Gossypium raimondii
gb|KJB23541.1|  hypothetical protein B456_004G104100                    247   1e-73   Gossypium raimondii
gb|KJB23544.1|  hypothetical protein B456_004G104100                    246   1e-73   Gossypium raimondii
gb|KDP38762.1|  hypothetical protein JCGZ_04115                         246   3e-73   Jatropha curcas
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                   244   4e-73   Citrus sinensis [apfelsine]
gb|KHG27245.1|  Protein WAX2                                            245   5e-73   Gossypium arboreum [tree cotton]
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    243   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             243   2e-72   Citrus clementina [clementine]
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   243   2e-72   Citrus sinensis [apfelsine]
gb|KJB83325.1|  hypothetical protein B456_013G242200                    241   3e-72   Gossypium raimondii
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               243   4e-72   Vitis vinifera
emb|CBI25242.3|  unnamed protein product                                243   4e-72   Vitis vinifera
gb|AEW67744.1|  WAX2 protein                                            228   8e-72   Eutrema halophilum
gb|ACN25216.1|  unknown                                                 234   9e-72   Zea mays [maize]
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         242   1e-71   Prunus mume [ume]
ref|XP_011016520.1|  PREDICTED: protein ECERIFERUM 3-like               229   2e-71   Populus euphratica
gb|KHG30512.1|  Protein WAX2 -like protein                              240   3e-71   Gossypium arboreum [tree cotton]
gb|KJB83324.1|  hypothetical protein B456_013G242200                    239   3e-71   Gossypium raimondii
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             240   4e-71   Prunus persica
gb|AFW87579.1|  hypothetical protein ZEAMMB73_499314                    235   4e-71   
gb|KJB83318.1|  hypothetical protein B456_013G242200                    239   7e-71   Gossypium raimondii
gb|KJB83323.1|  hypothetical protein B456_013G242200                    239   8e-71   Gossypium raimondii
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               239   9e-71   Nicotiana tomentosiformis
ref|NP_001131238.1|  gl1 protein                                        232   9e-71   
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    238   1e-70   Eucalyptus grandis [rose gum]
gb|KHG27244.1|  Protein WAX2                                            239   1e-70   Gossypium arboreum [tree cotton]
ref|NP_001146749.1|  uncharacterized protein LOC100280351               234   2e-70   Zea mays [maize]
emb|CDP02895.1|  unnamed protein product                                238   2e-70   Coffea canephora [robusta coffee]
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               238   2e-70   Vitis vinifera
emb|CBI25244.3|  unnamed protein product                                238   2e-70   Vitis vinifera
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             238   4e-70   
emb|CAN69291.1|  hypothetical protein VITISV_043141                     223   5e-70   Vitis vinifera
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               237   6e-70   Nicotiana sylvestris
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    237   6e-70   Populus euphratica
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    237   7e-70   Fragaria vesca subsp. vesca
gb|AFK49575.1|  unknown                                                 223   9e-70   Lotus japonicus
gb|AAB87722.1|  glossy1 homolog                                         234   1e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280          234   1e-69   
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               236   1e-69   Setaria italica
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    236   1e-69   Nelumbo nucifera [Indian lotus]
gb|ACF79426.1|  unknown                                                 230   2e-69   Zea mays [maize]
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          236   2e-69   Sorghum bicolor [broomcorn]
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    235   2e-69   Vitis vinifera
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920          235   2e-69   Sorghum bicolor [broomcorn]
ref|NP_001266321.1|  gl1 protein                                        234   4e-69   
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like               234   4e-69   Brachypodium distachyon [annual false brome]
ref|NP_001058237.1|  Os06g0653000                                       234   4e-69   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    234   4e-69   
gb|ACF79563.1|  unknown                                                 221   4e-69   Zea mays [maize]
gb|EAZ01917.1|  hypothetical protein OsI_23945                          234   4e-69   Oryza sativa Indica Group [Indian rice]
gb|ACN25689.1|  unknown                                                 234   7e-69   Zea mays [maize]
gb|AAK68765.1|  Unknown protein                                         220   8e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85039.1|  predicted protein                                      234   9e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    233   1e-68   Phoenix dactylifera
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog                232   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    233   2e-68   Solanum lycopersicum
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             233   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like               233   2e-68   
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               233   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             233   2e-68   
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              233   2e-68   Medicago truncatula
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    232   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN25333.1|  unknown                                                 232   3e-68   Zea mays [maize]
dbj|BAK04216.1|  predicted protein                                      230   3e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like               232   4e-68   
dbj|BAJ87617.1|  predicted protein                                      232   4e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    232   5e-68   
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               231   6e-68   Nicotiana sylvestris
ref|XP_002460243.1|  hypothetical protein SORBIDRAFT_02g025230          218   6e-68   
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             231   6e-68   Capsella rubella
ref|NP_200588.2|  protein ECERIFERUM 3                                  231   6e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    231   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    231   9e-68   Setaria italica
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               231   1e-67   Brassica rapa
gb|EMS67420.1|  Protein WAX2                                            232   1e-67   Triticum urartu
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             231   1e-67   
gb|EEC72610.1|  hypothetical protein OsI_06088                          230   2e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001046080.1|  Os02g0178800                                       230   2e-67   
gb|AAR90847.1|  glossy1 protein                                         230   2e-67   Zea mays [maize]
ref|XP_007154832.1|  hypothetical protein PHAVU_003G1516001g            216   2e-67   Phaseolus vulgaris [French bean]
emb|CDX88639.1|  BnaA03g10100D                                          230   2e-67   
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               230   2e-67   Phoenix dactylifera
tpg|DAA61563.1|  TPA: glossy1                                           230   2e-67   
ref|NP_001105247.1|  glossy1                                            230   2e-67   Zea mays [maize]
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    232   3e-67   
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               229   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like               229   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               229   3e-67   Camelina sativa [gold-of-pleasure]
emb|CDY11848.1|  BnaC03g12740D                                          229   4e-67   Brassica napus [oilseed rape]
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               229   5e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               229   5e-67   Solanum tuberosum [potatoes]
dbj|BAJ85064.1|  predicted protein                                      229   6e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                229   6e-67   Erythranthe guttata [common monkey flower]
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         228   7e-67   Elaeis guineensis
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               228   9e-67   Brachypodium distachyon [annual false brome]
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         228   9e-67   Elaeis guineensis
gb|AGT16346.1|  glossy1 protein                                         228   1e-66   Saccharum hybrid cultivar R570
emb|CDX88640.1|  BnaA03g10090D                                          228   1e-66   
gb|KJB27033.1|  hypothetical protein B456_004G273200                    228   1e-66   Gossypium raimondii
emb|CDY02769.1|  BnaC02g11200D                                          228   1e-66   
emb|CDY32747.1|  BnaA02g08090D                                          228   1e-66   Brassica napus [oilseed rape]
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               228   1e-66   Setaria italica
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    228   1e-66   Brassica rapa
emb|CDY50795.1|  BnaCnng19590D                                          228   1e-66   Brassica napus [oilseed rape]
gb|KJB27032.1|  hypothetical protein B456_004G273200                    228   1e-66   Gossypium raimondii
emb|CDY11847.1|  BnaC03g12730D                                          228   2e-66   Brassica napus [oilseed rape]
gb|KHG04939.1|  Protein WAX2                                            228   2e-66   Gossypium arboreum [tree cotton]
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    226   5e-66   Brassica rapa
emb|CDY51280.1|  BnaA10g11680D                                          226   5e-66   Brassica napus [oilseed rape]
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               226   9e-66   Glycine max [soybeans]
ref|NP_001063227.1|  Os09g0426800                                       225   1e-65   
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               225   2e-65   Sesamum indicum [beniseed]
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          225   2e-65   Oryza sativa Japonica Group [Japonica rice]
gb|KHN17538.1|  Protein WAX2                                            224   2e-65   Glycine soja [wild soybean]
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    224   2e-65   
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               224   4e-65   Cicer arietinum [garbanzo]
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               223   8e-65   Glycine max [soybeans]
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         222   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    222   2e-64   Elaeis guineensis
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               221   3e-64   Elaeis guineensis
ref|XP_008775261.1|  PREDICTED: protein ECERIFERUM 3-like               216   1e-63   Phoenix dactylifera
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                218   5e-63   Erythranthe guttata [common monkey flower]
dbj|BAK04110.1|  predicted protein                                      217   7e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               218   1e-62   Brachypodium distachyon [annual false brome]
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               216   3e-62   Setaria italica
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    216   5e-62   Brassica rapa
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               216   6e-62   Solanum tuberosum [potatoes]
emb|CAN62442.1|  hypothetical protein VITISV_009194                     211   1e-61   Vitis vinifera
dbj|BAK02959.1|  predicted protein                                      214   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE77418.1|  unknown                                                 204   5e-61   Picea sitchensis
emb|CDX88642.1|  BnaA03g10070D                                          213   7e-61   
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680             210   6e-60   Selaginella moellendorffii
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167             210   8e-60   Selaginella moellendorffii
ref|XP_004252089.1|  PREDICTED: protein ECERIFERUM 3-like               200   1e-59   Solanum lycopersicum
ref|XP_006836672.1|  hypothetical protein AMTR_s00088p00066300          201   9e-59   
gb|ADE75704.1|  unknown                                                 206   3e-58   Picea sitchensis
gb|EMT23422.1|  Protein WAX2                                            191   1e-52   
ref|XP_001781794.1|  predicted protein                                  190   1e-52   
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448             187   2e-51   Selaginella moellendorffii
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343             187   3e-51   Selaginella moellendorffii
ref|XP_001783415.1|  predicted protein                                  183   6e-50   
ref|XP_002993505.1|  hypothetical protein SELMODRAFT_137211             168   1e-48   
ref|XP_009132284.1|  PREDICTED: protein ECERIFERUM 3-like               178   2e-48   
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982             177   5e-48   Selaginella moellendorffii
ref|XP_010103144.1|  Protein WAX2                                       176   2e-47   
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    176   2e-47   
ref|XP_001782380.1|  predicted protein                                  176   3e-47   
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    176   3e-47   
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like               170   1e-45   Populus euphratica
gb|KHG04940.1|  Protein WAX2                                            164   4e-43   Gossypium arboreum [tree cotton]
ref|XP_005822223.1|  hypothetical protein GUITHDRAFT_158756             146   5e-37   Guillardia theta CCMP2712
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                138   4e-34   Ostreococcus tauri
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            139   6e-34   
ref|XP_001420263.1|  predicted protein                                  136   2e-33   Ostreococcus lucimarinus CCE9901
ref|XP_003061467.1|  predicted protein                                  136   3e-33   Micromonas pusilla CCMP1545
ref|XP_002509294.1|  predicted protein                                  132   5e-32   Micromonas commoda
gb|AAA33934.1|  lipid transfer protein                                  130   2e-31   Senecio odorus
gb|AFW70401.1|  hypothetical protein ZEAMMB73_833522                    117   2e-29   
gb|ADE77466.1|  unknown                                                 113   1e-26   Picea sitchensis
gb|EPS58637.1|  hypothetical protein M569_16175                         112   1e-25   Genlisea aurea
ref|XP_001756318.1|  predicted protein                                  114   2e-25   
ref|XP_007509665.1|  predicted protein                                  112   2e-24   Bathycoccus prasinos
gb|KFK27319.1|  hypothetical protein AALP_AA8G367000                  95.5    2e-21   Arabis alpina [alpine rockcress]
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             100   2e-20   
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942           92.4    8e-18   
dbj|BAF01865.1|  CER1 protein                                         87.4    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                  89.0    1e-16   Brassica rapa
gb|AHD24918.1|  CER1                                                  88.2    2e-16   Brassica napus [oilseed rape]
ref|NP_850932.2|  protein ECERIFERUM 1                                87.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38059.1|  BnaCnng09200D                                        88.6    3e-16   Brassica napus [oilseed rape]
ref|NP_171723.2|  protein ECERIFERUM 1                                86.7    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg           86.3    1e-15   
gb|KFK27321.1|  hypothetical protein AALP_AA8G367700                  79.3    1e-15   Arabis alpina [alpine rockcress]
gb|EMT05122.1|  Protein WAX2                                          84.7    2e-15   
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg           85.1    2e-15   
ref|XP_010512796.1|  PREDICTED: protein ECERIFERUM 1-like             82.4    4e-15   
gb|EMS58990.1|  Protein WAX2                                          84.0    5e-15   Triticum urartu
gb|AAB87721.1|  maize gl1 homolog                                     84.0    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496698.1|  PREDICTED: protein ECERIFERUM 1-like             82.8    6e-15   
ref|NP_001184890.1|  protein ECERIFERUM 1                             83.6    8e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDO85390.1|  hypothetical protein CISIN_1g006590mg                 82.0    8e-15   Citrus sinensis [apfelsine]
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                  83.2    9e-15   Arabis alpina [alpine rockcress]
gb|ACN35049.1|  unknown                                               82.0    2e-14   Zea mays [maize]
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  82.0    2e-14   Sesamum indicum [beniseed]
gb|ACN34356.1|  unknown                                               82.0    2e-14   Zea mays [maize]
gb|AIE57503.1|  CER1                                                  82.0    2e-14   Camelina sativa [gold-of-pleasure]
gb|KDO85389.1|  hypothetical protein CISIN_1g006590mg                 81.3    3e-14   Citrus sinensis [apfelsine]
gb|KDO85388.1|  hypothetical protein CISIN_1g006590mg                 81.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  81.3    4e-14   
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                 81.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  81.3    5e-14   Citrus sinensis [apfelsine]
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg           81.3    5e-14   Citrus clementina [clementine]
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  80.9    6e-14   Tarenaya hassleriana [spider flower]
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  80.5    7e-14   
emb|CDP09364.1|  unnamed protein product                              80.1    1e-13   Coffea canephora [robusta coffee]
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  79.7    2e-13   Citrus sinensis [apfelsine]
gb|KJB67450.1|  hypothetical protein B456_010G191300                  79.0    2e-13   Gossypium raimondii
ref|XP_007015845.1|  CER1 protein                                     79.0    2e-13   
ref|XP_007015842.1|  CER1 protein isoform 1                           79.0    3e-13   
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  62.8    3e-13   
gb|KDO42773.1|  hypothetical protein CISIN_1g041887mg                 75.5    3e-13   Citrus sinensis [apfelsine]
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1       78.2    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2       78.2    4e-13   
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like             78.2    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like             78.2    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  77.4    7e-13   Fragaria vesca subsp. vesca
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like             77.4    8e-13   Elaeis guineensis
ref|XP_007219469.1|  hypothetical protein PRUPE_ppa021389mg           74.3    8e-13   Prunus persica
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  77.0    9e-13   Glycine max [soybeans]
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  77.0    1e-12   
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2        77.0    1e-12   
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                   77.0    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg           77.0    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1        76.6    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like             76.6    1e-12   Tarenaya hassleriana [spider flower]
gb|KJB23545.1|  hypothetical protein B456_004G104100                  76.3    1e-12   Gossypium raimondii
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                   76.6    2e-12   Brassica rapa
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                   76.6    2e-12   Camelina sativa [gold-of-pleasure]
emb|CDX74937.1|  BnaA05g06830D                                        76.3    2e-12   
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  76.3    2e-12   Fragaria vesca subsp. vesca
emb|CDX93352.1|  BnaC04g45440D                                        76.3    2e-12   
ref|XP_004253517.1|  PREDICTED: protein CER1-like 1                   73.2    2e-12   Solanum lycopersicum
emb|CDX91381.1|  BnaC04g07690D                                        76.3    2e-12   
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  76.3    2e-12   
ref|XP_002528208.1|  sterol desaturase, putative                      75.9    2e-12   
dbj|BAA11025.1|  CER1-like                                            71.6    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       75.1    4e-12   
ref|XP_010097746.1|  Protein WAX2                                     75.1    4e-12   
gb|KJB67446.1|  hypothetical protein B456_010G191100                  75.1    4e-12   Gossypium raimondii
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like             75.1    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                   75.1    5e-12   Brassica rapa
emb|CDY55893.1|  BnaA04g29140D                                        75.1    5e-12   Brassica napus [oilseed rape]
gb|KJB67445.1|  hypothetical protein B456_010G191100                  74.7    5e-12   Gossypium raimondii
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like             74.7    5e-12   Prunus mume [ume]
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like             74.7    6e-12   Malus domestica [apple tree]
emb|CDX93353.1|  BnaC04g45430D                                        74.7    6e-12   
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  74.7    6e-12   
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like             74.7    7e-12   Fragaria vesca subsp. vesca
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2        74.7    7e-12   Brassica rapa
emb|CDY55894.1|  BnaA04g29150D                                        74.3    7e-12   Brassica napus [oilseed rape]
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1        74.3    8e-12   Brassica rapa
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg           74.3    8e-12   Citrus clementina [clementine]
gb|KHG03871.1|  Protein WAX2 -like protein                            74.3    9e-12   Gossypium arboreum [tree cotton]
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                   74.3    9e-12   
gb|EMS58603.1|  hypothetical protein TRIUR3_05201                     73.6    1e-11   Triticum urartu
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g           73.9    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like             73.9    1e-11   
gb|AAC23640.1|  CER1-like protein                                     73.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB83321.1|  hypothetical protein B456_013G242200                  73.6    1e-11   Gossypium raimondii
gb|EMT06855.1|  Protein WAX2                                          73.9    1e-11   
gb|KJB83322.1|  hypothetical protein B456_013G242200                  73.6    1e-11   Gossypium raimondii
gb|KJB67449.1|  hypothetical protein B456_010G191200                  73.6    1e-11   Gossypium raimondii
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    2e-11   
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    2e-11   
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    2e-11   
ref|XP_008438264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  72.8    2e-11   Cucumis melo [Oriental melon]
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg           72.8    2e-11   
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg           72.8    2e-11   
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  72.8    2e-11   Cucumis melo [Oriental melon]
gb|KJB76256.1|  hypothetical protein B456_012G081600                  72.8    3e-11   Gossypium raimondii
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   Cucumis sativus [cucumbers]
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg           72.8    3e-11   
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like             72.4    3e-11   
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3        72.4    4e-11   
gb|KJB76251.1|  hypothetical protein B456_012G081600                  72.0    4e-11   
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    4e-11   
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478           72.0    4e-11   
emb|CBI16758.3|  unnamed protein product                              70.1    5e-11   
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                  72.0    5e-11   
gb|KJB76257.1|  hypothetical protein B456_012G081600                  72.0    5e-11   
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    5e-11   
ref|XP_010496479.1|  PREDICTED: protein CER1-like 1                   71.2    5e-11   
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    5e-11   
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    5e-11   
gb|AFK43395.1|  unknown                                               68.2    5e-11   
gb|KCW76791.1|  hypothetical protein EUGRSUZ_D011442                  70.9    6e-11   
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like             71.6    6e-11   
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  71.6    6e-11   
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  71.6    7e-11   
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like             71.6    7e-11   
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like             71.6    7e-11   
gb|EEC81004.1|  hypothetical protein OsI_23762                        67.0    8e-11   
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg           71.2    8e-11   
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       70.9    9e-11   
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  70.9    1e-10   
gb|KHG12604.1|  Protein WAX2 -like protein                            70.9    1e-10   
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   
gb|KHG15491.1|  Protein WAX2 -like protein                            70.9    1e-10   
ref|NP_171721.3|  protein CER1-like 1                                 70.9    1e-10   
gb|EPS60467.1|  hypothetical protein M569_14337                       70.9    1e-10   
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  70.5    1e-10   
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   
ref|NP_973742.1|  protein CER1-like 1                                 70.9    1e-10   
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   
emb|CAA65200.1|  CER1-like                                            70.9    1e-10   
gb|KJB09060.1|  hypothetical protein B456_001G122000                  70.9    1e-10   
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg           70.9    1e-10   
ref|NP_181306.3|  protein CER1-like 2                                 70.5    1e-10   
gb|AAC24373.1|  CER1-like protein                                     70.5    1e-10   
emb|CAN63491.1|  hypothetical protein VITISV_032726                   70.1    1e-10   
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  70.5    1e-10   
gb|ACG47659.1|  CER1                                                  70.5    1e-10   
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like             70.5    1e-10   
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  70.5    1e-10   
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like             70.5    1e-10   
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  70.5    1e-10   
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                   70.5    1e-10   
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg           70.5    2e-10   
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650        70.1    2e-10   
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1     70.1    2e-10   
gb|KHN30013.1|  Protein WAX2                                          70.1    2e-10   
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                   70.1    2e-10   
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like             70.1    2e-10   
gb|AFW64032.1|  hypothetical protein ZEAMMB73_844277                  69.7    2e-10   
gb|EPS71900.1|  hypothetical protein M569_02856                       70.1    2e-10   
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like             70.1    2e-10   
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like             70.1    2e-10   
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like             70.1    2e-10   
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like             70.1    2e-10   
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  70.1    2e-10   
ref|XP_004164810.1|  PREDICTED: LOW QUALITY PROTEIN: protein CER1...  65.5    2e-10   
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like             69.7    2e-10   
ref|XP_009612940.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  69.3    2e-10   
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  69.7    2e-10   
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...  69.7    2e-10   
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...  69.7    2e-10   
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                  69.7    2e-10   
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                  69.7    2e-10   
ref|NP_001141595.1|  uncharacterized protein LOC100273712             69.7    2e-10   
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  69.7    3e-10   
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  69.7    3e-10   
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like             69.7    3e-10   
ref|XP_007041192.1|  CER1 protein                                     69.7    3e-10   
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  69.7    3e-10   
gb|EMS51791.1|  hypothetical protein TRIUR3_23680                     67.0    3e-10   
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600        69.3    3e-10   
ref|XP_007041194.1|  CER1 protein                                     69.3    3e-10   
ref|XP_007041196.1|  CER1 protein                                     69.3    3e-10   
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  69.3    3e-10   
gb|KCW76795.1|  hypothetical protein EUGRSUZ_D01146                   67.0    3e-10   
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                  69.3    3e-10   
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g           69.3    4e-10   
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  69.3    4e-10   
ref|XP_002443045.1|  hypothetical protein SORBIDRAFT_08g006850        68.9    4e-10   
ref|XP_002320584.1|  ECERIFERUM 1 family protein                      69.3    4e-10   
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like             68.9    4e-10   
gb|KGN56666.1|  hypothetical protein Csa_3G127770                     68.9    4e-10   
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                  68.9    4e-10   
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like             68.9    4e-10   
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like             68.9    4e-10   
ref|XP_004171948.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    4e-10   
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320        68.9    4e-10   
emb|CDY07774.1|  BnaA03g17370D                                        68.9    4e-10   
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like             68.9    5e-10   
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg           68.9    5e-10   
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like             68.9    5e-10   
emb|CAA65199.1|  CER1-like                                            68.9    5e-10   
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                  68.9    5e-10   
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g           68.6    5e-10   
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg              68.9    5e-10   
emb|CAN83072.1|  hypothetical protein VITISV_026148                   67.8    5e-10   
emb|CDX79754.1|  BnaC03g20900D                                        68.6    5e-10   
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g           68.6    5e-10   
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                   68.6    6e-10   
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  68.6    6e-10   
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  68.6    6e-10   
ref|XP_003626834.1|  gl1-like protein                                 68.6    6e-10   
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                   68.6    7e-10   
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    7e-10   
gb|KGN56664.1|  hypothetical protein Csa_3G127750                     68.2    7e-10   
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                  68.2    7e-10   
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                   68.2    8e-10   
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg              68.2    8e-10   
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg              68.2    9e-10   
ref|XP_010054530.1|  PREDICTED: protein ECERIFERUM 1-like             67.0    1e-09   
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048           67.8    1e-09   
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                 67.8    1e-09   
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590        67.4    1e-09   
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                  67.4    1e-09   
emb|CDP09363.1|  unnamed protein product                              67.4    1e-09   
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like             67.4    1e-09   
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein            67.0    2e-09   
emb|CBI16761.3|  unnamed protein product                              67.0    2e-09   
gb|EEC73617.1|  hypothetical protein OsI_08114                        67.0    2e-09   
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like             67.0    2e-09   
ref|NP_001047459.1|  Os02g0621300                                     67.0    2e-09   
gb|EEE57393.1|  hypothetical protein OsJ_07566                        66.6    2e-09   
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like             66.6    2e-09   
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like             66.6    3e-09   
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  66.6    3e-09   
gb|ACG35856.1|  CER1                                                  66.6    3e-09   
gb|ACA14353.1|  TCER1                                                 66.2    3e-09   
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  66.2    3e-09   
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940        66.2    3e-09   
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    4e-09   
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1     65.9    4e-09   
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like             65.9    4e-09   
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like             65.9    4e-09   
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2     65.9    5e-09   
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like             65.9    5e-09   
gb|EEE56435.1|  hypothetical protein OsJ_05611                        65.9    5e-09   
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like             65.5    5e-09   
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  65.5    6e-09   
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like             65.5    6e-09   
ref|NP_001146661.1|  uncharacterized protein LOC100280261             65.5    6e-09   
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like             65.5    6e-09   
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like             65.5    6e-09   
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  65.1    7e-09   
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  65.1    7e-09   
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                   65.1    8e-09   
ref|XP_002526511.1|  sterol desaturase, putative                      65.1    8e-09   
ref|XP_008779294.1|  PREDICTED: protein ECERIFERUM 1-like             63.5    9e-09   
gb|KJB76286.1|  hypothetical protein B456_012G081500                  65.1    9e-09   
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like             65.1    9e-09   
gb|KJB76287.1|  hypothetical protein B456_012G081500                  65.1    9e-09   
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1        64.7    1e-08   
gb|KHN13741.1|  Protein WAX2                                          64.3    1e-08   
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  64.7    1e-08   
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2        64.7    1e-08   
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  64.7    1e-08   
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like             64.7    1e-08   
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg           64.3    1e-08   
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily               64.3    2e-08   
emb|CBI16760.3|  unnamed protein product                              64.3    2e-08   
ref|XP_009788099.1|  PREDICTED: protein CER1-like 1                   60.5    2e-08   
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like             63.9    2e-08   
gb|EMS68717.1|  Protein WAX2                                          63.9    2e-08   
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg              63.5    2e-08   
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg              63.5    2e-08   
ref|NP_001048490.1|  Os02g0814200                                     63.5    2e-08   
gb|ABG47420.1|  putative CER1                                         63.5    3e-08   
dbj|BAJ85488.1|  predicted protein                                    63.5    3e-08   
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g           63.5    3e-08   
gb|EAY87991.1|  hypothetical protein OsI_09413                        63.5    3e-08   
gb|EMT07276.1|  Protein WAX2                                          63.2    4e-08   
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like             62.8    4e-08   
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like             62.8    5e-08   
gb|ABD28318.1|  Sterol desaturase, putative                           59.3    5e-08   
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2        62.8    5e-08   
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1        62.8    5e-08   
gb|EMT33049.1|  Protein WAX2                                          62.8    5e-08   
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898  62.8    5e-08   
gb|EMS48099.1|  Protein WAX2                                          62.4    6e-08   
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like             62.4    6e-08   
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like             62.4    6e-08   
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  62.4    7e-08   
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  62.0    7e-08   
tpg|DAA60918.1|  TPA: putative ribosomal protein S4 (RPS4A) famil...  61.6    8e-08   
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  62.0    8e-08   
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                   62.0    9e-08   
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  62.0    9e-08   
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like             61.6    1e-07   
gb|EMS58604.1|  Protein WAX2                                          61.6    1e-07   
gb|ACN31737.1|  unknown                                               61.6    1e-07   
gb|ACR38546.1|  unknown                                               61.6    1e-07   
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg           61.2    1e-07   
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like             61.2    2e-07   
dbj|BAK00236.1|  predicted protein                                    60.5    2e-07   
gb|AAC24374.1|  CER1 protein                                          60.5    2e-07   
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1         60.5    3e-07   
gb|EMT15822.1|  Protein WAX2                                          60.1    3e-07   
gb|AFV29806.1|  sterol desaturase-like protein                        58.2    3e-07   
gb|EMS58051.1|  Protein WAX2                                          60.1    3e-07   
ref|XP_006828768.1|  hypothetical protein AMTR_s00001p00090180        56.2    4e-07   
emb|CBI16765.3|  unnamed protein product                              56.2    4e-07   
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320        59.7    4e-07   
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like             59.7    5e-07   
gb|EEC67150.1|  hypothetical protein OsI_33995                        59.3    6e-07   
gb|EEE61327.1|  hypothetical protein OsJ_15439                        59.3    6e-07   
ref|XP_008369652.1|  PREDICTED: protein ECERIFERUM 1-like             59.3    6e-07   
gb|ABG66132.1|  CER1 protein, putative, expressed                     59.3    6e-07   
gb|EEC77626.1|  hypothetical protein OsI_16615                        59.3    6e-07   
ref|NP_001064826.1|  Os10g0471100                                     59.3    7e-07   
gb|KDP28917.1|  hypothetical protein JCGZ_14688                       59.3    7e-07   
ref|XP_007015843.1|  CER1 protein isoform 2                           58.9    8e-07   
ref|XP_003625020.1|  Protein WAX2                                     58.9    9e-07   
gb|EMT04955.1|  Protein WAX2                                          58.9    9e-07   
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like             58.9    9e-07   
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like             58.9    9e-07   
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                 58.9    9e-07   



>ref|XP_004169575.1| PREDICTED: protein ECERIFERUM 3-like, partial [Cucumis sativus]
Length=218

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAPVDCQ +LVQVTKYQAA++CKTWI+GKW TPREQSWA
Sbjct  63   RRKVRVLMLTLSTERFEKIQKEAPVDCQNYLVQVTKYQAARNCKTWIVGKWITPREQSWA  122

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  123  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPEDVQGLGNCEYTMSRGVVHACHAGGVVH  182

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+ID+VWEAALK+GLKP
Sbjct  183  HLEGWTHHEVGALDVDRIDLVWEAALKHGLKP  214



>ref|XP_009788358.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=638

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLTQSTERF+KI+ EAP DCQKFLVQV KYQ AK CKTWI+GKWATPREQSW
Sbjct  481  ARRRVRVLMLTQSTERFMKIRREAPADCQKFLVQVPKYQGAKQCKTWILGKWATPREQSW  540

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPP+I FRRDCTYGKLAAM+LPKDV GLGSCEYTMGRGVVHACHAGG++
Sbjct  541  APSGTHFYQFVVPPVIPFRRDCTYGKLAAMRLPKDVTGLGSCEYTMGRGVVHACHAGGLL  600

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+G KP 
Sbjct  601  HLLEGWTHHEVGAIDVDQIDVVWEAALKHGFKPL  634



>ref|XP_009609207.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Nicotiana tomentosiformis]
Length=640

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLTQSTERF+KIQ EAP DCQKFLVQV+KYQ AK CKTWI+GKWATPREQSW
Sbjct  483  ARRRVRVLMLTQSTERFMKIQREAPADCQKFLVQVSKYQGAKQCKTWILGKWATPREQSW  542

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPP+I FRRD TYGKLAAM+LPKDV GLG+CEYTMGRGVVHACHAGG+V
Sbjct  543  APSGTHFYQFVVPPVIPFRRDSTYGKLAAMRLPKDVTGLGTCEYTMGRGVVHACHAGGLV  602

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+GLKP 
Sbjct  603  HHLEGWTHHEVGAIDVDQIDVVWEAALKHGLKPL  636



>ref|XP_009609208.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Nicotiana tomentosiformis]
Length=638

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLTQSTERF+KIQ EAP DCQKFLVQV+KYQ AK CKTWI+GKWATPREQSW
Sbjct  481  ARRRVRVLMLTQSTERFMKIQREAPADCQKFLVQVSKYQGAKQCKTWILGKWATPREQSW  540

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPP+I FRRD TYGKLAAM+LPKDV GLG+CEYTMGRGVVHACHAGG+V
Sbjct  541  APSGTHFYQFVVPPVIPFRRDSTYGKLAAMRLPKDVTGLGTCEYTMGRGVVHACHAGGLV  600

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+GLKP 
Sbjct  601  HHLEGWTHHEVGAIDVDQIDVVWEAALKHGLKPL  634



>ref|XP_006341693.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=646

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLT+STERF+KIQ EAPV+CQK+LVQVT  + AK CKTWIIGKW+TPREQSW
Sbjct  489  ARRRVRVLMLTKSTERFMKIQREAPVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSW  548

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEYTMGR +VHACHAGG+V
Sbjct  549  APSGTHFYQFVVPPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRDIVHACHAGGLV  608

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+GLKP 
Sbjct  609  HLLEGWTHHEVGAIDVDQIDVVWEAALKHGLKPL  642



>gb|KJB23542.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=384

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPR+QSWA
Sbjct  229  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWA  288

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  289  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVH  348

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW+AALK+GL+P
Sbjct  349  QLEGWTHHEVGAIDVDRIDIVWKAALKHGLRP  380



>ref|XP_010318689.1| PREDICTED: protein ECERIFERUM 3 isoform X3 [Solanum lycopersicum]
Length=607

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLT+STERF+KIQ EA V+CQK+LVQVT  + AK CKTWIIGKW+TPREQSW
Sbjct  450  ARRRVRVLMLTKSTERFMKIQREATVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSW  509

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEYTMGRG+VHACHAGG+V
Sbjct  510  APSGTHFYQFVVPPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRGIVHACHAGGLV  569

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+GLKP 
Sbjct  570  HLLEGWTHHEVGAIDVDQIDVVWEAALKHGLKPL  603



>ref|XP_011082697.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=635

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            AR++V+VLMLT STERF KIQ EAP DCQK+LVQVTKYQAA+HCKTWIIGKW  PREQ W
Sbjct  482  ARQKVKVLMLTLSTERFAKIQKEAPADCQKYLVQVTKYQAAQHCKTWIIGKWLMPREQYW  541

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPPII FRRDCTYGKLAAM+LP DVEGLG+CEYTM RGVVHACHAGG+V
Sbjct  542  APSGTHFHQFVVPPIIPFRRDCTYGKLAAMRLPDDVEGLGTCEYTMERGVVHACHAGGLV  601

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGW HHE GAINVDQIDVVWEAAL++GLKP 
Sbjct  602  HFLEGWKHHEVGAINVDQIDVVWEAALRHGLKPL  635



>ref|XP_010318688.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Solanum lycopersicum]
Length=641

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLT+STERF+KIQ EA V+CQK+LVQVT  + AK CKTWIIGKW+TPREQSW
Sbjct  484  ARRRVRVLMLTKSTERFMKIQREATVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSW  543

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEYTMGRG+VHACHAGG+V
Sbjct  544  APSGTHFYQFVVPPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRGIVHACHAGGLV  603

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+GLKP 
Sbjct  604  HLLEGWTHHEVGAIDVDQIDVVWEAALKHGLKPL  637



>ref|XP_004235875.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Solanum lycopersicum]
Length=643

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLT+STERF+KIQ EA V+CQK+LVQVT  + AK CKTWIIGKW+TPREQSW
Sbjct  486  ARRRVRVLMLTKSTERFMKIQREATVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSW  545

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHF+QFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEYTMGRG+VHACHAGG+V
Sbjct  546  APSGTHFYQFVVPPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRGIVHACHAGGLV  605

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGWTHHE GAI+VDQIDVVWEAALK+GLKP 
Sbjct  606  HLLEGWTHHEVGAIDVDQIDVVWEAALKHGLKPL  639



>gb|EYU24562.1| hypothetical protein MIMGU_mgv1a002930mg [Erythranthe guttata]
Length=624

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARR V+VLMLT STERF KIQ EAP++CQK+LVQVTKYQAA+HCK WIIGKW TPREQ W
Sbjct  471  ARRNVKVLMLTLSTERFTKIQKEAPIECQKYLVQVTKYQAAQHCKNWIIGKWTTPREQYW  530

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP GTHFHQFVVPPII FRRDCTYGKLAAMKLP D++GLGSCEYTM RGVVHACHAGGV+
Sbjct  531  APKGTHFHQFVVPPIIPFRRDCTYGKLAAMKLPNDIQGLGSCEYTMERGVVHACHAGGVI  590

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            H LEGW H+E GAINVDQIDVVW+AALK+GLKP
Sbjct  591  HFLEGWKHNEVGAINVDQIDVVWKAALKHGLKP  623



>ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumis sativus]
 gb|KGN65271.1| hypothetical protein Csa_1G294020 [Cucumis sativus]
Length=625

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAPVDCQ +LVQVTKYQAA++CKTWI+GKW TPREQSWA
Sbjct  470  RRKVRVLMLTLSTERFEKIQKEAPVDCQNYLVQVTKYQAARNCKTWIVGKWITPREQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  530  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPEDVQGLGNCEYTMSRGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+ID+VWEAALK+GLKP
Sbjct  590  HLEGWTHHEVGALDVDRIDLVWEAALKHGLKP  621



>emb|CDO98263.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARRRVRVLMLTQSTERF+KIQ EAP + QKFLVQVTKYQAAK CKTWIIGKW TP EQSW
Sbjct  514  ARRRVRVLMLTQSTERFLKIQKEAPEELQKFLVQVTKYQAAKQCKTWIIGKWTTPGEQSW  573

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPP+I FRRDCT+GKLAAM+LP+DVEGLGSCEYTM RGVVHACHAGGVV
Sbjct  574  APSGTHFHQFVVPPVIPFRRDCTFGKLAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVV  633

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            H LEGW HHE GAI+VDQIDVVW+AAL++GLKP
Sbjct  634  HFLEGWKHHEVGAIDVDQIDVVWKAALRHGLKP  666



>ref|XP_008443806.1| PREDICTED: protein ECERIFERUM 3 [Cucumis melo]
Length=611

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPREQSWA
Sbjct  456  RRKVRVLMLTLSTERFEKIQKEAPADCQNYLVQVTKYQAARNCKTWIVGKWITPREQSWA  515

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  516  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPEDVQGLGNCEYTMSRGVVHACHAGGVVH  575

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+ID+VWEAALK+GLKP
Sbjct  576  HLEGWTHHEVGALDVDRIDLVWEAALKHGLKP  607



>ref|XP_011073242.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Sesamum indicum]
Length=641

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARR+V+VLMLT S ERF+KIQ EAPVDCQK+LVQVTKYQAAKHCKTWIIGKW TPR+Q  
Sbjct  488  ARRKVKVLMLTLSKERFLKIQEEAPVDCQKYLVQVTKYQAAKHCKTWIIGKWTTPRQQYH  547

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPPII FRRDC YGKLAAM+LP+DVEGLGSCEYTM RGVVHACHAGGVV
Sbjct  548  APSGTHFHQFVVPPIIPFRRDCKYGKLAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVV  607

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGW HHE GAI+VDQIDVVWEAAL++GLKP 
Sbjct  608  HLLEGWKHHEVGAIDVDQIDVVWEAALRHGLKPL  641



>ref|XP_011073241.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Sesamum indicum]
Length=643

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARR+V+VLMLT S ERF+KIQ EAPVDCQK+LVQVTKYQAAKHCKTWIIGKW TPR+Q  
Sbjct  490  ARRKVKVLMLTLSKERFLKIQEEAPVDCQKYLVQVTKYQAAKHCKTWIIGKWTTPRQQYH  549

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPPII FRRDC YGKLAAM+LP+DVEGLGSCEYTM RGVVHACHAGGVV
Sbjct  550  APSGTHFHQFVVPPIIPFRRDCKYGKLAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVV  609

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGW HHE GAI+VDQIDVVWEAAL++GLKP 
Sbjct  610  HLLEGWKHHEVGAIDVDQIDVVWEAALRHGLKPL  643



>ref|XP_011079338.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=625

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KIQ+EAP DCQK+LVQVTKYQAA++CKTWI+GKW TPREQ++A
Sbjct  469  RKRVRVLMLTLSTERFRKIQTEAPADCQKYLVQVTKYQAAQNCKTWIVGKWITPREQNFA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+QFRRDCTYG LAAMKLP+DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  529  PAGTHFHQFVVPPILQFRRDCTYGDLAAMKLPEDVEGLGCCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            ALEGW+HHE GAI+VD+ID+VW+AALKNGLKP
Sbjct  589  ALEGWSHHEVGAIDVDRIDLVWKAALKNGLKP  620



>ref|XP_007013964.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOY31583.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=632

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPREQSWA
Sbjct  469  RRRVRVLMLTLSTERFQKIQKEAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPREQSWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSG HFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PSGAHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VWEAALK+GL+P
Sbjct  589  KLEGWTHHEVGAIDVDRIDLVWEAALKHGLRP  620



>gb|KJB23543.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=611

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPR+QSWA
Sbjct  456  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWA  515

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  516  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVH  575

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW+AALK+GL+P
Sbjct  576  QLEGWTHHEVGAIDVDRIDIVWKAALKHGLRP  607



>gb|KJB23541.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=624

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPR+QSWA
Sbjct  469  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW+AALK+GL+P
Sbjct  589  QLEGWTHHEVGAIDVDRIDIVWKAALKHGLRP  620



>gb|KJB23544.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=625

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPR+QSWA
Sbjct  470  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  530  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW+AALK+GL+P
Sbjct  590  QLEGWTHHEVGAIDVDRIDIVWKAALKHGLRP  621



>gb|KDP38762.1| hypothetical protein JCGZ_04115 [Jatropha curcas]
Length=628

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +RRVRVLMLT STERF KIQ EAP+DCQ +LVQVTKYQAA++CKTWI+GKW TPREQSWA
Sbjct  472  QRRVRVLMLTLSTERFHKIQKEAPLDCQSYLVQVTKYQAAQNCKTWIVGKWITPREQSWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G HFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  532  PKGAHFHQFVVPPILSFRRDCTYGDLAAMRLPEDVQGLGSCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW AALKNGLKP
Sbjct  592  LLEGWTHHEVGAIDVDRIDLVWNAALKNGLKP  623



>gb|KDO62363.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62364.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62365.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=567

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KIQ EAP+DCQ +LVQVTKYQAA+H KTWI+GKW TPREQ+WA
Sbjct  405  RKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWA  464

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  465  PPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVH  524

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VWEAALK+G KP
Sbjct  525  LLEGWTHHEVGAIDVDKIDLVWEAALKHGFKP  556



>gb|KHG27245.1| Protein WAX2 [Gossypium arboreum]
Length=624

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPR+QSWA
Sbjct  469  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVKGLGSCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW+AALK+GL+P
Sbjct  589  QLEGWTHHEVGAIDVDRIDIVWKAALKHGLRP  620



>ref|XP_010687696.1| PREDICTED: protein ECERIFERUM 3 [Beta vulgaris subsp. vulgaris]
Length=623

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            +R+ VRVLMLT STERF KIQ EAPVDCQK+LVQVTKYQAAK+CK WI+GKW TPREQSW
Sbjct  470  SRKHVRVLMLTLSTERFQKIQKEAPVDCQKYLVQVTKYQAAKNCKAWIVGKWITPREQSW  529

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP G HFHQFVVPPI+ FRRDCTYG LAAMKLP+DV+GLGSCEYTM RGVVHACHAGGVV
Sbjct  530  APRGAHFHQFVVPPILHFRRDCTYGDLAAMKLPQDVQGLGSCEYTMDRGVVHACHAGGVV  589

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            H+LEGWTHHE GAI+VD+IDVVW+AA+K G KP
Sbjct  590  HSLEGWTHHEVGAIDVDRIDVVWKAAMKYGFKP  622



>ref|XP_006453492.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
 ref|XP_006474093.1| PREDICTED: protein ECERIFERUM 3-like [Citrus sinensis]
 gb|ESR66732.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
Length=632

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KIQ EAP+DCQ +LVQVTKYQAA+H KTWI+GKW TPREQ+WA
Sbjct  470  RKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VWEAALK+G KP
Sbjct  590  LLEGWTHHEVGAIDVDKIDLVWEAALKHGFKP  621



>gb|KDO62360.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62361.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=632

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KIQ EAP+DCQ +LVQVTKYQAA+H KTWI+GKW TPREQ+WA
Sbjct  470  RKRVRVLMLTLSTERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VWEAALK+G KP
Sbjct  590  LLEGWTHHEVGAIDVDKIDLVWEAALKHGFKP  621



>gb|KJB83325.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=527

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KI  E PVDCQ +LVQVTKYQAA++CKTWI+GKW TP EQSWA
Sbjct  370  RKRVRVLMLTSSTERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWA  429

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  430  PSGTHFHQFVVPPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVH  489

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI+VD+ID+VWEAALK+GLKP
Sbjct  490  QLEGWSHHEVGAIDVDRIDLVWEAALKHGLKP  521



>ref|XP_002270033.2| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++ VLMLTQS+ERF  IQ EAP+DCQ+FLVQVTKYQAA+HCKTWIIGKW TPREQSWA
Sbjct  468  RKKIFVLMLTQSSERFESIQREAPIDCQQFLVQVTKYQAAQHCKTWIIGKWCTPREQSWA  527

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG CEYTM RGV+HACHAGGVVH
Sbjct  528  PPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVH  587

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             L+GWTHHE GAI+VDQIDV W AAL +G KP
Sbjct  588  LLQGWTHHEVGAIDVDQIDVAWTAALSHGFKP  619



>emb|CBI25242.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++ VLMLTQS+ERF  IQ EAP+DCQ+FLVQVTKYQAA+HCKTWIIGKW TPREQSWA
Sbjct  470  RKKIFVLMLTQSSERFESIQREAPIDCQQFLVQVTKYQAAQHCKTWIIGKWCTPREQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG CEYTM RGV+HACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             L+GWTHHE GAI+VDQIDV W AAL +G KP
Sbjct  590  LLQGWTHHEVGAIDVDQIDVAWTAALSHGFKP  621



>gb|AEW67744.1| WAX2 protein [Eutrema halophilum]
Length=157

 Score =   228 bits (581),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R VRVLMLT S ERF +IQ EAP + Q +LVQVTKY AA+HCKTWI+GKW TPREQSWAP
Sbjct  1    RGVRVLMLTLSVERFQRIQREAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAP  60

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
            +GTHFHQFVVPPI+ FRR+CTYG LAAM+LPKDV+GLG CEYTM RGVVHACHAGGVVH 
Sbjct  61   AGTHFHQFVVPPILNFRRNCTYGDLAAMRLPKDVQGLGHCEYTMDRGVVHACHAGGVVHM  120

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            LEGW HHE GAI+VD+ID+VWEAA+K GL+P
Sbjct  121  LEGWEHHEVGAIDVDRIDLVWEAAMKYGLRP  151



>gb|ACN25216.1| unknown [Zea mays]
 gb|AFW87580.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=361

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  209  RKRIRVLMLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWA  268

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  269  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVH  328

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA+ VD+IDVVWEAALK+GL P
Sbjct  329  CLEGWEHHEVGALEVDRIDVVWEAALKHGLTP  360



>ref|XP_008223562.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Prunus mume]
Length=638

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CK WI+GKW TPREQ WA
Sbjct  472  RRKVRVLMLTLSTERFQKIQKEAPADCQHYLVQVTKYQAARNCKAWIVGKWITPREQRWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSG HFHQFVVPPI+ FRRDCTYG LAAM+LP DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  532  PSGAHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVQGLGSCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+IDVVW+AALK+GLKP
Sbjct  592  LLEGWTHHEVGALDVDRIDVVWKAALKHGLKP  623



>ref|XP_011016520.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=227

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +RRVRVLMLT S ERF K+Q EAP++ Q +LVQVTKYQAA+ CKTWI+GKW TP EQSWA
Sbjct  65   QRRVRVLMLTSSKERFRKVQKEAPLEYQSYLVQVTKYQAARGCKTWIVGKWITPGEQSWA  124

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+ FRRDCTYG LAAM+LP +V+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  125  PTGTHFHQFVVPPILSFRRDCTYGDLAAMRLPDEVQGLGNCEYTMDRGVVHACHAGGVVH  184

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID+VW AALK+GLKP
Sbjct  185  LLEGWAHHEVGAIDVDRIDLVWNAALKHGLKP  216



>gb|KHG30512.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=627

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KI  EAPVDCQ +LVQVTKYQAA++CKTWI+GKW TP EQSWA
Sbjct  470  RKRVRVLMLTSSTERFQKILKEAPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  530  PSGTHFHQFVVPPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI+VD+ID+VWEAALK+GLKP
Sbjct  590  QLEGWSHHEVGAIDVDRIDLVWEAALKHGLKP  621



>gb|KJB83324.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=595

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KI  E PVDCQ +LVQVTKYQAA++CKTWI+GKW TP EQSWA
Sbjct  438  RKRVRVLMLTSSTERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWA  497

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  498  PSGTHFHQFVVPPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVH  557

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI+VD+ID+VWEAALK+GLKP
Sbjct  558  QLEGWSHHEVGAIDVDRIDLVWEAALKHGLKP  589



>ref|XP_007221983.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
 gb|EMJ23182.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
Length=629

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CK WI+GKW TPREQ WA
Sbjct  472  RRKVRVLMLTMSTERFQKIQKEAPADCQHYLVQVTKYQAARNCKAWIVGKWITPREQRWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSG HFHQFVVPPI+ FRRDCTYG LAAM+LP DV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  532  PSGAHFHQFVVPPILHFRRDCTYGDLAAMRLPDDVQGLGCCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+IDVVW+AALK+GLKP
Sbjct  592  LLEGWTHHEVGALDVDRIDVVWKAALKHGLKP  623



>gb|AFW87579.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=436

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  284  RKRIRVLMLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWA  343

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  344  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVH  403

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA+ VD+IDVVWEAALK+GL P
Sbjct  404  CLEGWEHHEVGALEVDRIDVVWEAALKHGLTP  435



>gb|KJB83318.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=627

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KI  E PVDCQ +LVQVTKYQAA++CKTWI+GKW TP EQSWA
Sbjct  470  RKRVRVLMLTSSTERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  530  PSGTHFHQFVVPPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI+VD+ID+VWEAALK+GLKP
Sbjct  590  QLEGWSHHEVGAIDVDRIDLVWEAALKHGLKP  621



>gb|KJB83323.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=624

 Score =   239 bits (610),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KI  E PVDCQ +LVQVTKYQAA++CKTWI+GKW TP EQSWA
Sbjct  467  RKRVRVLMLTSSTERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  527  PSGTHFHQFVVPPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI+VD+ID+VWEAALK+GLKP
Sbjct  587  QLEGWSHHEVGAIDVDRIDLVWEAALKHGLKP  618



>ref|XP_009587593.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=628

 Score =   239 bits (610),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAP + QK+LVQVTKY+AA++CKTWI+GKW TPREQS+A
Sbjct  469  RRQVRVLMLTSSTERFQKIQKEAPAEYQKYLVQVTKYEAARNCKTWIVGKWITPREQSYA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PKGTHFHQFVVPPILSFRRDCTYGDLAAMRLPEDVQGLGSCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+VD+ID+VWEAA+K+GLKP
Sbjct  589  SLEGWTHHEVGAIDVDRIDLVWEAAMKHGLKP  620



>ref|NP_001131238.1| gl1 protein [Zea mays]
Length=361

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  209  RKRIRVLMLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWA  268

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAA +LPKDVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  269  PPGTHFHQFVVPPIIGFRRDCTYGKLAATRLPKDVEGLGSCEYTMERGVVHACHAGGVVH  328

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA+ VD+IDVVWEAALK+GL P
Sbjct  329  CLEGWEHHEVGALEVDRIDVVWEAALKHGLTP  360



>ref|XP_010047031.1| PREDICTED: protein ECERIFERUM 3 [Eucalyptus grandis]
 gb|KCW78780.1| hypothetical protein EUGRSUZ_C00214 [Eucalyptus grandis]
Length=624

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KI+ EAP DCQ +LVQVTKYQAA+ CKTWI+GKW TPREQSWA
Sbjct  469  RRRVRVLMLTLSTERFEKIKKEAPADCQNYLVQVTKYQAARTCKTWIVGKWITPREQSWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G  FHQFVVPPI+ FRRDCTYG LAAM+LP DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PPGARFHQFVVPPILPFRRDCTYGDLAAMRLPDDVQGLGSCEYTMDRGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+VD+ID+VW AALK+GLKP
Sbjct  589  SLEGWTHHEVGAIDVDRIDLVWNAALKHGLKP  620



>gb|KHG27244.1| Protein WAX2 [Gossypium arboreum]
Length=666

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CKTWI+GKW TPR+QSWA
Sbjct  469  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PSGTHFHQFVVPPILAFRRDCTYGDLAAMRLPDDVKGLGSCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNG  255
             LEGWTHHE GAI+VD+ID+VW+AALK+G
Sbjct  589  QLEGWTHHEVGAIDVDRIDIVWKAALKHG  617



>ref|NP_001146749.1| uncharacterized protein LOC100280351 [Zea mays]
 gb|ACL54673.1| unknown [Zea mays]
 gb|AFW70400.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=440

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLM T S+ERFVKIQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  288  RKKIRVLMFTVSSERFVKIQREAPPEYQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  347

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GL SCEYTM RGVVHACHAGGVVH
Sbjct  348  PSGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLSSCEYTMERGVVHACHAGGVVH  407

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  408  FLEGWGHHEVGAIDVDRIDVVWKAALKHGLAP  439



>emb|CDP02895.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KIQ EAP + QK+LVQV+KYQAA++CKTWI+GKW TPREQ +A
Sbjct  470  RKRVRVLMLTLSTERFQKIQKEAPTEYQKYLVQVSKYQAAQNCKTWIVGKWITPREQRFA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI++FRRDCTYG LAAMKLP+DVEGLG CEYTM RGVVHACHAGG+VH
Sbjct  530  PPGTHFHQFVVPPILRFRRDCTYGDLAAMKLPEDVEGLGCCEYTMDRGVVHACHAGGLVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+VD+IDVVWEAALK+GLKP
Sbjct  590  SLEGWTHHEVGAIDVDRIDVVWEAALKHGLKP  621



>ref|XP_002270075.1| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++ VLMLTQS+ERF  IQ EAP+DCQ+FLVQVTKYQAA++CKTWIIGKW TP EQSWA
Sbjct  468  RKKIFVLMLTQSSERFESIQREAPIDCQQFLVQVTKYQAAQYCKTWIIGKWCTPSEQSWA  527

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG CEYTM RGV+HACHAGGVVH
Sbjct  528  PPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVH  587

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             L+GWTHHE GAI+VDQIDV W AAL +G KP
Sbjct  588  LLQGWTHHEVGAIDVDQIDVAWTAALSHGFKP  619



>emb|CBI25244.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++ VLMLTQS+ERF  IQ EAP+DCQ+FLVQVTKYQAA++CKTWIIGKW TP EQSWA
Sbjct  470  RKKIFVLMLTQSSERFESIQREAPIDCQQFLVQVTKYQAAQYCKTWIIGKWCTPSEQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG CEYTM RGV+HACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             L+GWTHHE GAI+VDQIDV W AAL +G KP
Sbjct  590  LLQGWTHHEVGAIDVDQIDVAWTAALSHGFKP  621



>ref|XP_002325096.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
 gb|EEF03661.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
Length=652

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ++RRVRVLMLT STERF KIQ EAP++ Q + VQVTKYQAA+ CKTWI+GKW TPREQSW
Sbjct  490  SQRRVRVLMLTSSTERFEKIQKEAPLEYQSYFVQVTKYQAARSCKTWIVGKWITPREQSW  549

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP+GTHFHQFVVPPI  FRRDCTYG LAAM+LP DV+GLG+CEYTM RGVVHACHAGGVV
Sbjct  550  APTGTHFHQFVVPPIFSFRRDCTYGDLAAMRLPDDVQGLGNCEYTMDRGVVHACHAGGVV  609

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            H LEGWTHHE GA++VD+IDVVW AALK+GLKP
Sbjct  610  HLLEGWTHHEVGALDVDRIDVVWNAALKHGLKP  642



>emb|CAN69291.1| hypothetical protein VITISV_043141 [Vitis vinifera]
Length=155

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT STERF KIQ EAPV+ Q +LVQVTKYQAA++CKTWI+GKW TPR+Q+WAPSG HFH
Sbjct  1    MLTLSTERFQKIQREAPVEFQNYLVQVTKYQAAQNCKTWIVGKWITPRQQNWAPSGAHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPPI+ FRRDCTYG LAA+KLP+DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTH
Sbjct  61   QFVVPPILPFRRDCTYGDLAALKLPEDVQGLGSCEYTMERGVVHACHAGGVVHVLEGWTH  120

Query  320  HEAGAINVDQIDVVWEAALKNGLKP  246
            HE GA++VD+IDVVW+AALK+GLKP
Sbjct  121  HEVGALDVDRIDVVWKAALKHGLKP  145



>ref|XP_009766364.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAP + QK+LVQVTKY+AA++CKTWI+GKW TPREQS+A
Sbjct  469  RRQVRVLMLTSSTERFQKIQKEAPAEYQKYLVQVTKYEAARNCKTWIVGKWITPREQSYA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  529  PKGTHFHQFVVPPILSFRRDCTYGDLAAMRLPEDVQGLGSCEYTMERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+VD+ID+VW AA+K+GLKP
Sbjct  589  SLEGWTHHEVGAIDVDRIDLVWAAAMKHGLKP  620



>ref|XP_011018104.1| PREDICTED: protein ECERIFERUM 3 [Populus euphratica]
Length=632

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EAP++ Q + VQVTKYQAA+ CKTWI+GKW TPREQSWA
Sbjct  471  RRRVRVLMLTSSTERFEKIQKEAPLEYQSYFVQVTKYQAARSCKTWIVGKWITPREQSWA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+ FRRDCTYG LAAM+LP DV+G G+CEYTM RGVVHACHAGGVVH
Sbjct  531  PTGTHFHQFVVPPILSFRRDCTYGDLAAMRLPDDVQGRGNCEYTMDRGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+IDVVW AALK+GLKP
Sbjct  591  LLEGWTHHEVGALDVDRIDVVWNAALKHGLKP  622



>ref|XP_004309858.1| PREDICTED: protein ECERIFERUM 3 [Fragaria vesca subsp. vesca]
Length=630

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF K+Q EAP + Q +LVQVTKYQAA+ CKTWI+GKW TPREQ WA
Sbjct  470  RRKVRVLMLTLSTERFQKVQKEAPAEFQSYLVQVTKYQAAQTCKTWIVGKWITPREQRWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSG HFHQFVVPPI  FRRDCTYG LAAM+LP DVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  530  PSGAHFHQFVVPPIFHFRRDCTYGDLAAMRLPDDVEGLGSCEYTMDRGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW+AALK+GLKP
Sbjct  590  FLEGWTHHEVGAIDVDRIDLVWDAALKHGLKP  621



>gb|AFK49575.1| unknown [Lotus japonicus]
Length=153

 Score =   223 bits (567),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT S +RF +IQ EAP + Q +LVQVTKYQAA+HCKTWI GKW TPREQSWAP GTHFH
Sbjct  1    MLTLSADRFKRIQKEAPQEYQSYLVQVTKYQAAQHCKTWIAGKWITPREQSWAPRGTHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPPI+ FRRDCTYG+LAAM+LP+DVEGLGSCEYTM RGVVHACHAGGVVH+LEGWTH
Sbjct  61   QFVVPPILPFRRDCTYGELAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVVHSLEGWTH  120

Query  320  HEAGAINVDQIDVVWEAALKNGLKP  246
            HE GAI+VD+IDVVW+AALK+GL+P
Sbjct  121  HEVGAIDVDRIDVVWKAALKHGLRP  145



>gb|AAB87722.1| glossy1 homolog, partial [Oryza sativa Japonica Group]
Length=555

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT STERF+ IQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  403  RKKIRVLMLTLSTERFMNIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  462

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LP+DVEGLG+CEYTMGRGVVHACHAGGVVH
Sbjct  463  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVH  522

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID VW AAL++GL P
Sbjct  523  FLEGWDHHEVGAIDVDRIDAVWNAALRHGLTP  554



>ref|XP_006845484.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
 gb|ERN07159.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
Length=555

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            AR+ VRVLMLT S ERF  IQ EAPV+ QK LVQVTKYQA ++CKTWI+GKW  PREQ W
Sbjct  402  ARKGVRVLMLTLSQERFQIIQKEAPVEYQKNLVQVTKYQAGQNCKTWIVGKWILPREQKW  461

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPPI++ RRDCTYGKLAAM LP DVEGLG+CEYTMGRG+VHACHAGGVV
Sbjct  462  APSGTHFHQFVVPPILRLRRDCTYGKLAAMHLPDDVEGLGTCEYTMGRGIVHACHAGGVV  521

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            H LEGWTHHE GAI+VD+ID+VWEAALK+GLKP
Sbjct  522  HLLEGWTHHEVGAISVDRIDLVWEAALKHGLKP  554



>ref|XP_004965700.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=622

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT STERF+KIQ EAP + Q+FLVQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  470  RKKIRVLMLTVSTERFLKIQREAPAESQQFLVQVTKYQAAQSCKTWIVGKWLSPREQRWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  530  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGCCEYTMERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  590  CLEGWEHHEVGAIDVDRIDVVWKAALKHGLTP  621



>ref|XP_010278025.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
 ref|XP_010278026.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
Length=619

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ VRVLMLTQ+TERF KIQ EAP++CQ FLVQVTK+QA ++CK WI+GKW TPREQ WA
Sbjct  467  RKGVRVLMLTQATERFQKIQKEAPLECQNFLVQVTKHQAGQNCKAWIVGKWLTPREQRWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI QFRRDCTYG LAAM+LPKDVEGLG CEYTM RGVVHACHAGG+VH
Sbjct  527  PPGTHFHQFVVPPIFQFRRDCTYGDLAAMRLPKDVEGLGCCEYTMDRGVVHACHAGGLVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+ID+VW AALK+GL P
Sbjct  587  CLEGWTHHEVGAIDVDKIDMVWNAALKHGLTP  618



>gb|ACF79426.1| unknown [Zea mays]
Length=404

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++RVRV+M+T STERF KIQ EAP + Q++LVQVTKY++A+HC+TWI+GKW +PREQ WA
Sbjct  252  KKRVRVMMMTLSTERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWA  311

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEY++ RGVVHACHAGGVVH
Sbjct  312  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGVVHACHAGGVVH  371

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAALK+GL+P
Sbjct  372  FLEGYTHHEVGAIDVDRIDVVWEAALKHGLRP  403



>ref|XP_002451653.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
 gb|EES04629.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
Length=630

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLM T S+ERFVKIQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  478  RKKIRVLMFTMSSERFVKIQREAPPEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  537

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  538  PSGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  597

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW AALK+GL P
Sbjct  598  FLEGWDHHEVGAIDVDRIDVVWNAALKHGLAP  629



>ref|XP_002270946.1| PREDICTED: protein ECERIFERUM 3 [Vitis vinifera]
 emb|CBI36611.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +R+VRVLMLT STERF KIQ EAPV+ Q +LVQVTKYQAA++CKTWI+GKW TPR+Q+WA
Sbjct  471  QRKVRVLMLTLSTERFQKIQREAPVEFQNYLVQVTKYQAAQNCKTWIVGKWITPRQQNWA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSG HFHQFVVPPI+ FRRDCTYG LAA+KLP+DV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  531  PSGAHFHQFVVPPILPFRRDCTYGDLAALKLPEDVQGLGSCEYTMERGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GA++VD+IDVVW+AALK+GLKP
Sbjct  591  VLEGWTHHEVGALDVDRIDVVWKAALKHGLKP  622



>ref|XP_002437383.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
 gb|EER88750.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
Length=623

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT STERF+KIQ EAP + Q+FLVQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  471  RKKIRVLMLTLSTERFLKIQKEAPSEFQQFLVQVTKYQAAQSCKTWIVGKWLSPREQRWA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  531  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  591  CLEGWEHHEVGAIDVDRIDVVWKAALKHGLTP  622



>ref|NP_001266321.1| gl1 protein [Zea mays]
 gb|ACG43105.1| gl1 protein [Zea mays]
Length=622

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  470  RKRIRVLMLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA+ VD+IDVVWEAALK+GL P
Sbjct  590  CLEGWEHHEVGALEVDRIDVVWEAALKHGLTP  621



>ref|XP_003570600.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RV+MLT S+ERF+KIQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  474  RKKIRVMMLTMSSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  534  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA++VD+IDVVW+AALK+GL P
Sbjct  594  FLEGWEHHEVGALDVDRIDVVWKAALKHGLTP  625



>ref|NP_001058237.1| Os06g0653000 [Oryza sativa Japonica Group]
 dbj|BAD37412.1| putative Gl1 [Oryza sativa Japonica Group]
 dbj|BAF20151.1| Os06g0653000 [Oryza sativa Japonica Group]
 gb|EEE66138.1| hypothetical protein OsJ_22195 [Oryza sativa Japonica Group]
Length=627

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT STERF+ IQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  475  RKKIRVLMLTLSTERFMNIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LP+DVEGLG+CEYTMGRGVVHACHAGGVVH
Sbjct  535  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID VW AAL++GL P
Sbjct  595  FLEGWDHHEVGAIDVDRIDAVWNAALRHGLTP  626



>ref|XP_008658046.1| PREDICTED: uncharacterized protein LOC100192547 isoform X1 [Zea 
mays]
 gb|AFW87577.1| gl1 protein [Zea mays]
Length=622

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  470  RKRIRVLMLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA+ VD+IDVVWEAALK+GL P
Sbjct  590  CLEGWEHHEVGALEVDRIDVVWEAALKHGLTP  621



>gb|ACF79563.1| unknown [Zea mays]
Length=146

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFH
Sbjct  1    MLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW H
Sbjct  61   QFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEH  120

Query  320  HEAGAINVDQIDVVWEAALKNGLKP  246
            HE GA+ VD+IDVVWEAALK+GL P
Sbjct  121  HEVGALEVDRIDVVWEAALKHGLTP  145



>gb|EAZ01917.1| hypothetical protein OsI_23945 [Oryza sativa Indica Group]
Length=631

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT STERF+ IQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  479  RKKIRVLMLTLSTERFMNIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  538

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LP+DVEGLG+CEYTMGRGVVHACHAGGVVH
Sbjct  539  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVH  598

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID VW AAL++GL P
Sbjct  599  FLEGWDHHEVGAIDVDRIDAVWNAALRHGLTP  630



>gb|ACN25689.1| unknown [Zea mays]
 gb|AFW87576.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=635

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  483  RKRIRVLMLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWA  542

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH
Sbjct  543  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVH  602

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA+ VD+IDVVWEAALK+GL P
Sbjct  603  CLEGWEHHEVGALEVDRIDVVWEAALKHGLTP  634



>gb|AAK68765.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72130.1| Unknown protein [Arabidopsis thaliana]
Length=151

 Score =   220 bits (560),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT S ERF KIQ EAPV+ Q  LVQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFH
Sbjct  1    MLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPPI++FRR+CTYG LAAMKLPKDVEGLG+CEYTM RGVVHACHAGGVVH LEGW H
Sbjct  61   QFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKH  120

Query  320  HEAGAINVDQIDVVWEAALKNGL  252
            HE GAI+VD+ID+VWEAA+K GL
Sbjct  121  HEVGAIDVDRIDLVWEAAMKYGL  143



>dbj|BAJ85039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RV+MLT S+ERF+KIQ EAP + Q++LVQVTKYQAA++CKTW++GKW +PREQ WA
Sbjct  472  RKRIRVIMLTMSSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  532  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA++VD+IDVVW+AALK+GL P
Sbjct  592  FLEGWQHHEVGALDVDRIDVVWKAALKHGLTP  623



>ref|XP_008804902.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Phoenix dactylifera]
Length=619

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  467  RKKIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LP+DV+GLG CEYTM RG+VHACHAGGVVH
Sbjct  527  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTMDRGMVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL P
Sbjct  587  FLEGWTHHEVGAIDVDRIDVVWRAALKHGLAP  618



>dbj|BAB08850.1| lipid transfer protein; glossy1 homolog [Arabidopsis thaliana]
Length=566

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q  LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  409  RRGVRVLMLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  468

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAMKLPKDVEGLG+CEYTM RGVVHACHAGGVVH
Sbjct  469  PAGTHFHQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVH  528

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  529  MLEGWKHHEVGAIDVDRIDLVWEAAMKYGLS  559



>ref|XP_004242647.1| PREDICTED: protein ECERIFERUM 3 [Solanum lycopersicum]
Length=630

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAPV+ QK+LVQVTKY+AAK+CKTWI+GKW TPREQS+A
Sbjct  471  RRQVRVLMLTMSTERFQKIQKEAPVEYQKYLVQVTKYEAAKNCKTWIVGKWITPREQSYA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+G+ +CEYTM RGVVHACHAGGVVH
Sbjct  531  PKGTHFHQFVVPPILAFRRDCTYGDLAAMRLPEDVQGVSTCEYTMERGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+V++ID+VW+AA+K+GLKP
Sbjct  591  SLEGWTHHEVGAIDVNRIDLVWDAAMKHGLKP  622



>ref|XP_006401167.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
 dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42620.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
Length=631

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP + Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  474  RRGVRVLMLTLSVERFQKIQREAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+ FRR+CTYG LAAM+LPKDV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  534  PAGTHFHQFVVPPILNFRRNCTYGDLAAMRLPKDVQGLGHCEYTMDRGVVHACHAGGVVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID+VWEAA+K GL+P
Sbjct  594  MLEGWEHHEVGAIDVDRIDLVWEAAMKYGLRP  625



>ref|XP_006646964.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=633

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S+ERF+KIQ EAP + Q++LVQVTKYQ A++CKTW++GKW +PREQ WA
Sbjct  481  RKKIRVLMLTLSSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWA  540

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG+CEYTMGRGVVHACHAGGVVH
Sbjct  541  PAGTHFHQFVVPPIMGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVH  600

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  601  FLEGWEHHEVGAIDVDRIDVVWKAALKHGLTP  632



>ref|XP_009400348.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++ +RVLMLT STERF+KIQ EAP DCQ  LVQVTKYQAA+HCKTWI+GKW + REQ WA
Sbjct  465  KKNIRVLMLTLSTERFLKIQKEAPEDCQHHLVQVTKYQAAQHCKTWIVGKWLSLREQRWA  524

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYG LAAM+LPKDV GLGSCEYTM RGVVHACHAGGVVH
Sbjct  525  PPGTHFHQFVVPPIIGFRRDCTYGSLAAMRLPKDVRGLGSCEYTMERGVVHACHAGGVVH  584

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW AALK+GL P
Sbjct  585  CLEGWMHHEVGAIDVDRIDVVWRAALKHGLTP  616



>ref|XP_002864528.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40787.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
Length=632

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ER+ KIQ EAPV+ Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  475  RRGVRVLMLTLSVERYQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAMKLPKDVEGLG+CEYTM RGVVHACHAGGVVH
Sbjct  535  PAGTHFHQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  595  MLEGWKHHEVGAIDVDRIDLVWEAAMKYGLS  625



>gb|KEH32582.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=633

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +++VRVLMLT ST+RF KIQ EAP++ Q +LVQVTKYQAA++CK WI+GKW TPREQSWA
Sbjct  472  QKKVRVLMLTISTDRFQKIQKEAPLEYQSYLVQVTKYQAAQNCKAWIVGKWITPREQSWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  532  PSGTHFHQFVVPPILSFRRDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GA++V++ID+VWEAALK+GL+P
Sbjct  592  SLEGWTHHEVGALDVNRIDLVWEAALKHGLRP  623



>ref|XP_009387454.1| PREDICTED: protein ECERIFERUM 3-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RVLMLT S ERF+ IQ EAP DCQ  LVQVTK QAA++CKTWI+GKW +PREQ WA
Sbjct  465  RKNIRVLMLTLSAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWA  524

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYG LAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  525  PPGTHFHQFVVPPIIGFRRDCTYGSLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  584

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW+AALK+GL P
Sbjct  585  YLEGWTHHEVGAIDVDRIDVVWKAALKHGLTP  616



>gb|ACN25333.1| unknown [Zea mays]
 gb|ACN28101.1| unknown [Zea mays]
 gb|AFW70399.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=627

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLM T S+ERFVKIQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  475  RKKIRVLMFTVSSERFVKIQREAPPEYQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GL SCEYTM RGVVHACHAGGVVH
Sbjct  535  PSGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLSSCEYTMERGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  595  FLEGWGHHEVGAIDVDRIDVVWKAALKHGLAP  626



>dbj|BAK04216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT S+ERF+KIQ EAP + Q++LVQVTKY AAK  KTW++GKW +PREQ WA
Sbjct  393  RKRIRVLMLTLSSERFLKIQREAPAEFQQYLVQVTKYHAAKTVKTWLVGKWLSPREQRWA  452

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPP+I+FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  453  PAGTHFHQFVVPPVIEFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  512

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AAL++GL P
Sbjct  513  CLEGWEHHEVGAIDVDRIDVVWKAALRHGLSP  544



>ref|XP_006657201.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=623

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ ++VLMLT STERF+ IQ EAP + Q++LVQVTKYQAA+ CKTWI+GKW +PREQ WA
Sbjct  471  RKNIKVLMLTLSTERFMTIQREAPAEFQQYLVQVTKYQAAQKCKTWIVGKWLSPREQRWA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG+CEYTMGRGVVHACHAGGVVH
Sbjct  531  PAGTHFHQFVVPPIMGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW AALK+GL P
Sbjct  591  FLEGWEHHEXGAIDVDRIDVVWNAALKHGLTP  622



>dbj|BAJ87617.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RV+MLT S+ERF+KIQ EAP + Q++LVQVTKYQAA++CKTW++GKW +PREQ WA
Sbjct  472  RKRIRVIMLTMSSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKD +GLGSCEYTM RGVVHACHAGGVVH
Sbjct  532  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDAQGLGSCEYTMERGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA++VD+IDVVW+AALK+GL P
Sbjct  592  FLEGWQHHEVGALDVDRIDVVWKAALKHGLTP  623



>ref|XP_009387453.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RVLMLT S ERF+ IQ EAP DCQ  LVQVTK QAA++CKTWI+GKW +PREQ WA
Sbjct  495  RKNIRVLMLTLSAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWA  554

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYG LAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  555  PPGTHFHQFVVPPIIGFRRDCTYGSLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  614

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW+AALK+GL P
Sbjct  615  YLEGWTHHEVGAIDVDRIDVVWKAALKHGLTP  646



>ref|XP_009798188.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            ++VRVLMLT STERF KIQ EAP + QK+LVQVTKYQAAK+CKTWI+GKW TPREQ++AP
Sbjct  470  KQVRVLMLTSSTERFQKIQKEAPAEYQKYLVQVTKYQAAKNCKTWIVGKWITPREQNFAP  529

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
            +G HFHQFVVPP++ FRRDCTYG LAAM+LP DV+GLGSCEYTM RGVVHACHAGGVVH+
Sbjct  530  TGAHFHQFVVPPVLPFRRDCTYGDLAAMRLPLDVQGLGSCEYTMERGVVHACHAGGVVHS  589

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            LEGWTHHE GAI+V++ID+VWEAALK+GLKP
Sbjct  590  LEGWTHHEVGAIDVNRIDLVWEAALKHGLKP  620



>ref|XP_002460243.1| hypothetical protein SORBIDRAFT_02g025230 [Sorghum bicolor]
 gb|EER96764.1| hypothetical protein SORBIDRAFT_02g025230 [Sorghum bicolor]
Length=146

 Score =   218 bits (554),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            M+T STERF KIQ EAP + Q++LVQVTKY+AA+HC+TWI+GKW +PREQ WAP GTHFH
Sbjct  1    MMTLSTERFQKIQKEAPAEFQQYLVQVTKYRAAQHCRTWIVGKWLSPREQRWAPPGTHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPPII FRRDCTYGKLAAM+LPKDV+GLG+CEY++ RGVVHACHAGGVVH LEG+TH
Sbjct  61   QFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTH  120

Query  320  HEAGAINVDQIDVVWEAALKNGLKP  246
            HE GAI+V +IDVVWEAALK+GL+P
Sbjct  121  HEVGAIDVHRIDVVWEAALKHGLRP  145



>ref|XP_006279594.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
 gb|EOA12492.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
Length=629

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  472  RRGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPK+VEGLG+CEYTM RGVVHACHAGGVVH
Sbjct  532  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKNVEGLGTCEYTMERGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  592  MLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  622



>ref|NP_200588.2| protein ECERIFERUM 3 [Arabidopsis thaliana]
 sp|Q8H1Z0.1|CER3_ARATH RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS 
POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein 
YORE-YORE [Arabidopsis thaliana]
 gb|AAN06975.1| cuticle protein [Arabidopsis thaliana]
 dbj|BAC81644.1| YORE-YORE protein [Arabidopsis thaliana]
 dbj|BAD06945.1| faceless pollen-1 [Arabidopsis thaliana]
 gb|AED96953.1| protein ECERIFERUM 3 [Arabidopsis thaliana]
Length=632

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q  LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  475  RRGVRVLMLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAMKLPKDVEGLG+CEYTM RGVVHACHAGGVVH
Sbjct  535  PAGTHFHQFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  595  MLEGWKHHEVGAIDVDRIDLVWEAAMKYGLS  625



>ref|XP_010483318.1| PREDICTED: protein ECERIFERUM 3 [Camelina sativa]
 gb|AIE57504.1| CER3 [Camelina sativa]
Length=632

 Score =   231 bits (589),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  475  RRGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPKDVEGL +CEYTM RGVVHACHAGGVVH
Sbjct  535  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKDVEGLATCEYTMERGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  595  MLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  625



>ref|XP_004951702.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Setaria italica]
Length=626

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLM T S+ERFVKIQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  474  RKKIRVLMFTMSSERFVKIQREAPPEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV GL SCEYTM RGVVHACHAGGVVH
Sbjct  534  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVRGLSSCEYTMERGVVHACHAGGVVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW AALK+GL P
Sbjct  594  FLEGWDHHEVGAIDVDRIDVVWRAALKHGLAP  625



>ref|XP_009132107.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=631

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT STERF KIQ EAP + Q +LVQVTKY AA+HCK+WI+GKW TPREQSWA
Sbjct  474  RRGVRVLMLTLSTERFQKIQKEAPAEFQNYLVQVTKYNAAQHCKSWIVGKWLTPREQSWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRR CTYG LAAM+LPKDV+G+G+CEYTM RGVVHACHAGG+VH
Sbjct  534  PEGTHFHQFVVPPILNFRRKCTYGDLAAMRLPKDVQGVGTCEYTMERGVVHACHAGGLVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA++NGL 
Sbjct  594  MLEGWEHHEVGAIDVDRIDIVWEAAMRNGLS  624



>gb|EMS67420.1| Protein WAX2 [Triticum urartu]
Length=697

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RV+MLT S+ERF+KIQ EAP + Q++LVQVTKYQAA++CKTW++GKW +PREQ WA
Sbjct  426  RKKIRVIMLTMSSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWA  485

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEY+M RGVVHACHAGGVVH
Sbjct  486  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYSMERGVVHACHAGGVVH  545

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GA++VD+IDVVW+AALK+GL P
Sbjct  546  FLEGWEHHEVGALDVDRIDVVWKAALKHGLTP  577



>ref|XP_002308430.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
 gb|EEE91953.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
Length=633

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +RRVRVLMLT S ERF K+Q EAP++ Q +LVQVTKYQAA+ CKTWI+GKW TP EQSWA
Sbjct  471  QRRVRVLMLTSSKERFQKVQKEAPLEYQSYLVQVTKYQAARGCKTWIVGKWITPGEQSWA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTM RGVVHACHAGG+VH
Sbjct  531  PTGTHFHQFVVPPILSFRRDCTYGDLAAMRLPVDVQGLGNCEYTMDRGVVHACHAGGMVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID+VW AALK+GLKP
Sbjct  591  LLEGWAHHEVGAIDVDRIDLVWNAALKHGLKP  622



>gb|EEC72610.1| hypothetical protein OsI_06088 [Oryza sativa Indica Group]
Length=628

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S+ERF+KIQ EAP + Q++LVQVTKYQ A++CKTW++GKW +PREQ WA
Sbjct  476  RKKIRVLMLTLSSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWA  535

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  536  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGYCEYTMERGVVHACHAGGVVH  595

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  596  FLEGWEHHEVGAIDVDRIDVVWKAALKHGLTP  627



>ref|NP_001046080.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAD28002.1| putative glossy1 protein [Oryza sativa Japonica Group]
 dbj|BAF07994.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAG90034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S+ERF+KIQ EAP + Q++LVQVTKYQ A++CKTW++GKW +PREQ WA
Sbjct  476  RKKIRVLMLTLSSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWA  535

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  536  PAGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGYCEYTMERGVVHACHAGGVVH  595

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  596  FLEGWEHHEVGAIDVDRIDVVWKAALKHGLTP  627



>gb|AAR90847.1| glossy1 protein [Zea mays]
Length=621

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++RVRV+M+T STERF KIQ EAP + Q++LVQVTKY++A+HC+TWI+GKW +PREQ WA
Sbjct  469  KKRVRVMMMTLSTERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEY++ RGVVHACHAGGVVH
Sbjct  529  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAALK+GL+P
Sbjct  589  FLEGYTHHEVGAIDVDRIDVVWEAALKHGLRP  620



>ref|XP_007154832.1| hypothetical protein PHAVU_003G1516001g [Phaseolus vulgaris]
 gb|ESW26826.1| hypothetical protein PHAVU_003G1516001g [Phaseolus vulgaris]
Length=151

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT ST+RF +IQ EAPV+ Q +LVQVTKYQAA++CKTWI+GKW TPREQ WAP GTHFH
Sbjct  1    MLTLSTDRFQRIQKEAPVEYQNYLVQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPPI+ FR+DCTYG LAAM+LP+DVEGLG CEYTM RGVVHACHAGGVVH+LEGW H
Sbjct  61   QFVVPPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMERGVVHACHAGGVVHSLEGWDH  120

Query  320  HEAGAINVDQIDVVWEAALKNGLKPF*RM  234
            HE GA++V++ID+VWEAALK+GL+P  R 
Sbjct  121  HEVGALDVNRIDLVWEAALKHGLRPVSRF  149



>emb|CDX88639.1| BnaA03g10100D [Brassica napus]
Length=631

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT STERF KIQ EAP + Q  LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  474  RRGVRVLMLTLSTERFQKIQKEAPAEFQNHLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRR CTYG LAAM+LPKDV+G+G+CEYTM RGVVHACHAGG+VH
Sbjct  534  PEGTHFHQFVVPPILNFRRKCTYGDLAAMRLPKDVQGVGTCEYTMERGVVHACHAGGLVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA++NGL 
Sbjct  594  MLEGWEHHEVGAIDVDRIDIVWEAAMRNGLS  624



>ref|XP_008794400.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=619

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++++RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA++CKTWI+GKW++PREQ WA
Sbjct  467  QKKIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQNCKTWIVGKWSSPREQRWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LP+DV+ LGSCEYT+ RGVVHACHAGGVVH
Sbjct  527  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPQDVQALGSCEYTLERGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL P
Sbjct  587  LLEGWTHHEVGAIDVDRIDVVWRAALKHGLTP  618



>tpg|DAA61563.1| TPA: glossy1 [Zea mays]
Length=621

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++RVRV+M+T STERF KIQ EAP + Q++LVQVTKY++A+HC+TWI+GKW +PREQ WA
Sbjct  469  KKRVRVMMMTLSTERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEY++ RGVVHACHAGGVVH
Sbjct  529  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAALK+GL+P
Sbjct  589  FLEGYTHHEVGAIDVDRIDVVWEAALKHGLRP  620



>ref|NP_001105247.1| glossy1 [Zea mays]
 gb|AAR97643.1| Gl1 protein [Zea mays]
Length=621

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++RVRV+M+T STERF KIQ EAP + Q++LVQVTKY++A+HC+TWI+GKW +PREQ WA
Sbjct  469  KKRVRVMMMTLSTERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV GLG+CEY++ RG+VHACHAGGVVH
Sbjct  529  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGLVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAALK+GL+P
Sbjct  589  FLEGYTHHEVGAIDVDRIDVVWEAALKHGLRP  620



>ref|XP_008643558.1| PREDICTED: uncharacterized protein LOC100280351 isoform X1 [Zea 
mays]
Length=747

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLM T S+ERFVKIQ EAP + Q++LVQVTKYQAA++CKTWI+GKW +PREQ WA
Sbjct  595  RKKIRVLMFTVSSERFVKIQREAPPEYQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWA  654

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GL SCEYTM RGVVHACHAGGVVH
Sbjct  655  PSGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLSSCEYTMERGVVHACHAGGVVH  714

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AALK+GL P
Sbjct  715  FLEGWGHHEVGAIDVDRIDVVWKAALKHGLAP  746



>ref|XP_010452800.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  475  RRGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPK+VEGL +CEYTM RGVVHACHAGGVVH
Sbjct  535  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKNVEGLATCEYTMERGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  595  MLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  625



>ref|XP_009390985.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RVLMLT STERFVKIQ E P D Q  LVQVTKYQAA++CKTWI+GKW   REQ WA
Sbjct  465  RKNIRVLMLTLSTERFVKIQKEVPADYQHHLVQVTKYQAAQNCKTWIVGKWLLLREQRWA  524

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPP+I FRRDCTYG LAAM+LPKDV+GLGSCEYTM RG+VHACHAGG+VH
Sbjct  525  PPGTHFHQFVVPPVIGFRRDCTYGNLAAMRLPKDVQGLGSCEYTMERGIVHACHAGGIVH  584

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL+P
Sbjct  585  CLEGWTHHEVGAIDVDRIDVVWNAALKHGLQP  616



>ref|XP_010443488.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  475  RRGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  534

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPK+VEGL +CEYTM RGVVHACHAGGVVH
Sbjct  535  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKNVEGLATCEYTMERGVVHACHAGGVVH  594

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+K GL 
Sbjct  595  MLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  625



>emb|CDY11848.1| BnaC03g12740D [Brassica napus]
Length=631

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT STERF KIQ EAP + Q +LVQVTKY AA+HCKTWI+GKW TPREQSWA
Sbjct  474  RRGVRVLMLTLSTERFQKIQKEAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ F R CTYG LAAM+LPKDV+G+G+CEYTM RGVVHACHAGG+VH
Sbjct  534  PEGTHFHQFVVPPILNFTRKCTYGDLAAMRLPKDVQGVGTCEYTMERGVVHACHAGGLVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA++NGL 
Sbjct  594  MLEGWEHHEVGAIDVDRIDIVWEAAMRNGLS  624



>ref|XP_009417462.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRVLMLT STERF KIQ EAPV+CQ++LVQVTKYQA ++CKTWI+GKW + REQ  A
Sbjct  468  RKRVRVLMLTLSTERFQKIQKEAPVECQEYLVQVTKYQAGQNCKTWIVGKWISLREQRCA  527

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LP+DV+GLG CEYT+ RG+VHACHAGGVVH
Sbjct  528  PPGTHFHQFVVPPIISFRRDCTYGKLAAMRLPQDVQGLGMCEYTLERGIVHACHAGGVVH  587

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL P
Sbjct  588  LLEGWTHHEVGAIDVDRIDVVWRAALKHGLTP  619



>ref|XP_006343719.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=630

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR+VRVLMLT STERF KIQ EAPV+ +K+LVQ+TKYQAAK+CK WI+GKW TPREQS+A
Sbjct  471  RRQVRVLMLTMSTERFQKIQKEAPVEYKKYLVQITKYQAAKNCKAWIVGKWITPREQSYA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DV+G+ SCEYTM RGVVHACHAGGVVH
Sbjct  531  PKGTHFHQFVVPPILAFRRDCTYGDLAAMRLPEDVQGVSSCEYTMERGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+V +ID+VW+AA+K+G KP
Sbjct  591  SLEGWTHHEVGAIDVHRIDLVWDAAMKHGFKP  622



>dbj|BAJ85064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=660

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT S+ERF+KIQ EAP + Q++LVQVTKY AAK  KTW++GKW +PREQ WA
Sbjct  508  RKRIRVLMLTLSSERFLKIQREAPAEFQQYLVQVTKYHAAKTVKTWLVGKWLSPREQRWA  567

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPP+I+FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  568  PAGTHFHQFVVPPVIEFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  627

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+IDVVW+AAL++GL P
Sbjct  628  CLEGWEHHEVGAIDVDRIDVVWKAALRHGLSP  659



>gb|EYU21788.1| hypothetical protein MIMGU_mgv1a025856mg [Erythranthe guttata]
Length=633

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            ARR+V+V+MLT S ERF+KI+ EAP+  + +LVQVTKYQAAK+CKTWIIGKW TPR+Q +
Sbjct  480  ARRKVKVMMLTPSEERFLKIKKEAPLGFENYLVQVTKYQAAKNCKTWIIGKWTTPRQQYY  539

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPPII FR DC+YGKLAAMKLP+DVEGLGSCEYTM RGVVHACHAGGVV
Sbjct  540  APSGTHFHQFVVPPIIPFRLDCSYGKLAAMKLPEDVEGLGSCEYTMERGVVHACHAGGVV  599

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            H LEGW H+E GAI+VDQIDVVW+AAL++G KP 
Sbjct  600  HLLEGWKHNEVGAIDVDQIDVVWKAALRHGFKPL  633



>ref|XP_010914063.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Elaeis guineensis]
Length=596

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA+ CKTWI+GKW +P EQ+WA
Sbjct  444  RKRIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQSCKTWIVGKWLSPWEQTWA  503

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GT FHQFVVPPII FRRDCTYGKLAAM+LP+DV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  504  PPGTQFHQFVVPPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTMDRGVVHACHAGGVVH  563

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL P
Sbjct  564  FLEGWTHHEVGAIDVDRIDVVWRAALKHGLTP  595



>ref|XP_003563334.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S+ERF+KIQ EAP + Q FLVQVTKYQAAK+CKTW++GKW +PREQ WA
Sbjct  474  RKKIRVLMLTLSSERFLKIQREAPAEFQPFLVQVTKYQAAKNCKTWLVGKWLSPREQRWA  533

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
             +GTHFHQFVVPP+++FRRDC+YGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH
Sbjct  534  AAGTHFHQFVVPPVMEFRRDCSYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVH  593

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID VW AALK+GL P
Sbjct  594  CLEGWEHHEVGAIDVDRIDQVWHAALKHGLSP  625



>ref|XP_010914062.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Elaeis guineensis]
Length=619

 Score =   228 bits (581),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+R+RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA+ CKTWI+GKW +P EQ+WA
Sbjct  467  RKRIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQSCKTWIVGKWLSPWEQTWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GT FHQFVVPPII FRRDCTYGKLAAM+LP+DV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  527  PPGTQFHQFVVPPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTMDRGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL P
Sbjct  587  FLEGWTHHEVGAIDVDRIDVVWRAALKHGLTP  618



>gb|AGT16346.1| glossy1 protein [Saccharum hybrid cultivar R570]
 gb|AGT16349.1| glossy1 protein [Saccharum hybrid cultivar R570]
Length=622

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++RVRV+M+T STERF KIQ EAP + Q++LVQVTKY++A+HC+TWI+GKW +PREQ WA
Sbjct  470  KKRVRVMMMTLSTERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLG+CEY++ RGVVHACHAGGVVH
Sbjct  530  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+I VVWEAALK+GL+P
Sbjct  590  FLEGYTHHEVGAIDVDRIGVVWEAALKHGLRP  621



>emb|CDX88640.1| BnaA03g10090D [Brassica napus]
Length=600

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP + QK+LVQVTKY  A+HCKTWI+GKW TPREQSWA
Sbjct  443  RRGVRVLMLTLSVERFQKIQKEAPSEFQKYLVQVTKYNFAQHCKTWIVGKWLTPREQSWA  502

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTY +LAAM+LPKDV+GLG+CEYTM RGVVHACHAGG+VH
Sbjct  503  PAGTHFHQFVVPPILKFRRNCTYDELAAMRLPKDVQGLGTCEYTMDRGVVHACHAGGLVH  562

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL 
Sbjct  563  MLEGWEHHEVGAIDVDRIDLVWEAAMRHGLS  593



>gb|KJB27033.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=610

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRR+RVLMLT STERF KIQ EAP D Q +LV VTKYQAA++CKTWI GKW TP EQSWA
Sbjct  455  RRRIRVLMLTLSTERFQKIQKEAPADTQNYLVHVTKYQAAQNCKTWIAGKWITPWEQSWA  514

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP+DVEGLGSCEY + RGVVHACHAGG VH
Sbjct  515  PSGTHFHQFVVPPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAVH  574

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE G I+VD+ID+VWEAALK+G +P
Sbjct  575  QLEGWTHHEIGPIDVDRIDLVWEAALKHGFRP  606



>emb|CDY02769.1| BnaC02g11200D [Brassica napus]
Length=630

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP + Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RRGVRVLMLTMSIERFQKIQKEAPAEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPKDV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL 
Sbjct  593  MLEGWKHHEVGAIDVDRIDLVWEAAMRHGLS  623



>emb|CDY32747.1| BnaA02g08090D [Brassica napus]
Length=630

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP + Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RRGVRVLMLTMSIERFQKIQKEAPAEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPKDV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL 
Sbjct  593  MLEGWKHHEVGAIDVDRIDLVWEAAMRHGLS  623



>ref|XP_004956872.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=620

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRV+M+T S+ERF +IQ EAP + Q++LVQVTKY++A+HC+TWI+GKW +PREQ WA
Sbjct  468  RKRVRVMMMTLSSERFQRIQKEAPPEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWA  527

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLG+CEY++ RGVVHACHAGGVVH
Sbjct  528  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGTCEYSLERGVVHACHAGGVVH  587

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAAL++GL+P
Sbjct  588  FLEGYTHHEVGAIDVDRIDVVWEAALRHGLRP  619



>ref|XP_009126813.1| PREDICTED: protein ECERIFERUM 3 [Brassica rapa]
Length=630

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP + Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RRGVRVLMLTMSIERFQKIQKEAPAEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTYG LAAM+LPKDV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PAGTHFHQFVVPPILKFRRNCTYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL 
Sbjct  593  MLEGWKHHEVGAIDVDRIDLVWEAAMRHGLS  623



>emb|CDY50795.1| BnaCnng19590D [Brassica napus]
Length=630

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RRGVRVLMLTLSMERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRR+CTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PKGTHFHQFVVPPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL+
Sbjct  593  MLEGWEHHEVGAIDVDRIDLVWEAAMRHGLR  623



>gb|KJB27032.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=625

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRR+RVLMLT STERF KIQ EAP D Q +LV VTKYQAA++CKTWI GKW TP EQSWA
Sbjct  470  RRRIRVLMLTLSTERFQKIQKEAPADTQNYLVHVTKYQAAQNCKTWIAGKWITPWEQSWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPI+  RRDCTYG LAAM+LP+DVEGLGSCEY + RGVVHACHAGG VH
Sbjct  530  PSGTHFHQFVVPPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAVH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE G I+VD+ID+VWEAALK+G +P
Sbjct  590  QLEGWTHHEIGPIDVDRIDLVWEAALKHGFRP  621



>emb|CDY11847.1| BnaC03g12730D [Brassica napus]
Length=635

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP   QK+LVQVTKY +A+HCKTWI+GKW TPREQSWA
Sbjct  478  RRGVRVLMLTLSVERFQKIQKEAPSKFQKYLVQVTKYNSAQHCKTWIVGKWLTPREQSWA  537

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+CTY +LAAM+LPKDV+GLG+CEYTM RGVVHACHAGG+VH
Sbjct  538  PAGTHFHQFVVPPILKFRRNCTYDELAAMRLPKDVQGLGTCEYTMDRGVVHACHAGGLVH  597

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GA++VD+ID+VWEAA+++GL 
Sbjct  598  MLEGWEHHEVGAVDVDRIDIVWEAAMRHGLS  628



>gb|KHG04939.1| Protein WAX2 [Gossypium arboreum]
Length=625

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            +RR VRVLMLT STERF KIQ EAP D Q +LV VTKYQAA++CKTWI GKW TP EQSW
Sbjct  469  SRRHVRVLMLTSSTERFQKIQKEAPTDTQNYLVHVTKYQAAQNCKTWIAGKWITPWEQSW  528

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            APSGTHFHQFVVPPI+  RRDCTYG LAAM+LP+DVEGLGSCEY + RGVVHACHAGG V
Sbjct  529  APSGTHFHQFVVPPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAV  588

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            H LEGWTHHE G I+VD+ID+VWEAALK+G +P
Sbjct  589  HQLEGWTHHEIGPIDVDRIDLVWEAALKHGFRP  621



>ref|XP_009120300.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Brassica rapa]
Length=630

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RQGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRR+CTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PKGTHFHQFVVPPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL+
Sbjct  593  MLEGWEHHEVGAIDVDRIDLVWEAAMRHGLR  623



>emb|CDY51280.1| BnaA10g11680D [Brassica napus]
Length=630

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RQGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRR+CTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PKGTHFHQFVVPPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
             LEGW HHE GAI+VD+ID+VWEAA+++GL+
Sbjct  593  MLEGWEHHEVGAIDVDRIDLVWEAAMRHGLR  623



>ref|XP_003549515.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
Length=632

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +++V+VLMLT ST+RF +IQ EAP + Q +LVQVTKYQAA++CKTWI+GKW TPREQ WA
Sbjct  472  QKKVKVLMLTLSTDRFQRIQKEAPPENQSYLVQVTKYQAAQNCKTWIVGKWITPREQYWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FR+DCTYG LAAM+LP+DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  532  PRGTHFHQFVVPPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGW+HHE GAI+V++ID+VWEAALK+GL+P
Sbjct  592  SLEGWSHHEVGAIDVNRIDLVWEAALKHGLRP  623



>ref|NP_001063227.1| Os09g0426800 [Oryza sativa Japonica Group]
 dbj|BAD33619.1| putative Gl1 protein [Oryza sativa Japonica Group]
 dbj|BAF25141.1| Os09g0426800 [Oryza sativa Japonica Group]
 gb|EAZ09166.1| hypothetical protein OsI_31436 [Oryza sativa Indica Group]
Length=619

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R++VRV+M+T STERF KIQ EA  + Q++LVQVTKY++A+HCKTWI+GKW +PREQ WA
Sbjct  467  RKKVRVMMMTLSTERFQKIQREATPEHQQYLVQVTKYRSAQHCKTWIVGKWLSPREQRWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLG+CEY++ RGVVHACHAGGVVH
Sbjct  527  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAAL++GL+P
Sbjct  587  FLEGYTHHEVGAIDVDRIDVVWEAALRHGLRP  618



>ref|XP_011070158.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=626

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++ VRVLMLT STERF  IQ EAP DCQK L+ VTKYQAA++CKTWI+GKW TPREQS+A
Sbjct  468  KKGVRVLMLTLSTERFRMIQKEAPADCQKNLIHVTKYQAAQNCKTWIVGKWITPREQSFA  527

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGT FHQFVVPP+   RRDCTYG LAAMKLP D EGLG CEYTM RGVVHACHAGG+VH
Sbjct  528  PSGTQFHQFVVPPVSPSRRDCTYGNLAAMKLPDDAEGLGCCEYTMERGVVHACHAGGMVH  587

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI VD+ID+VWEAAL++GLKP
Sbjct  588  SLEGWTHHEVGAIEVDRIDLVWEAALRHGLKP  619



>gb|EAZ44800.1| hypothetical protein OsJ_29433 [Oryza sativa Japonica Group]
Length=621

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R++VRV+M+T STERF KIQ EA  + Q++LVQVTKY++A+HCKTWI+GKW +PREQ WA
Sbjct  469  RKKVRVMMMTLSTERFQKIQREATPEHQQYLVQVTKYRSAQHCKTWIVGKWLSPREQRWA  528

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLG+CEY++ RGVVHACHAGGVVH
Sbjct  529  PPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVH  588

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+VD+IDVVWEAAL++GL+P
Sbjct  589  FLEGYTHHEVGAIDVDRIDVVWEAALRHGLRP  620



>gb|KHN17538.1| Protein WAX2 [Glycine soja]
Length=632

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +++V+VLMLT ST+RF +IQ EAP + Q +LVQVTKYQAA++CKTWI+GKW TPREQ WA
Sbjct  472  QKKVKVLMLTLSTDRFQRIQKEAPPENQSYLVQVTKYQAAQNCKTWIVGKWITPREQYWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FR+DCTYG LAAM+LP+DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  532  PRGTHFHQFVVPPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGW HHE GAI+V++ID+VWEAALK+GL+P
Sbjct  592  SLEGWPHHEVGAIDVNRIDLVWEAALKHGLRP  623



>ref|XP_010536953.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 3-like [Tarenaya 
hassleriana]
Length=621

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EA V  Q +LVQVTKYQAA+HCKTWI+GKW TPREQ WA
Sbjct  464  RRRVRVLMLTLSTERFQKIQKEAAVGHQNYLVQVTKYQAAQHCKTWIVGKWLTPREQRWA  523

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI++FR++C+YG LAAM+LP DV GLG+CEYTM RGVVHACHAGGVVH
Sbjct  524  PKGTHFHQFVVPPILRFRKNCSYGDLAAMRLPPDVNGLGTCEYTMERGVVHACHAGGVVH  583

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW HHE GAI+VD+ID+VW AAL+ G  P
Sbjct  584  MLEGWDHHEVGAIDVDRIDIVWSAALRLGFAP  615



>ref|XP_004507787.1| PREDICTED: protein ECERIFERUM 3-like [Cicer arietinum]
Length=633

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +++VRVLMLT S +RF KI  EAPV+ Q +LVQVTKYQAA++CKTWI+GKW TPREQSWA
Sbjct  473  QKKVRVLMLTISNDRFQKILKEAPVEYQSYLVQVTKYQAAQNCKTWIVGKWITPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYG LAAM+LP+DVEG+G CEYTM RGVVHACHAGGVVH
Sbjct  533  PRGTHFHQFVVPPILSFRRDCTYGDLAAMRLPEDVEGIGCCEYTMDRGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            +LEGW+HHE GAI+V++ID+VW+AALK+GL+
Sbjct  593  SLEGWSHHEVGAIDVNRIDLVWQAALKHGLR  623



>ref|XP_003542310.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
 gb|KHN34764.1| Protein WAX2 [Glycine soja]
Length=629

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +++V+VLMLT ST+RF +IQ EAP + Q +LVQVTKYQAA++CKTWI+GKW TPREQ WA
Sbjct  472  QKKVKVLMLTLSTDRFQRIQKEAPPEYQSYLVQVTKYQAAQNCKTWIVGKWITPREQYWA  531

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FR+DCTYG LAAM+LP+DVEGLG CEYTM RGVVHACHAGGVVH
Sbjct  532  PRGTHFHQFVVPPILPFRKDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVH  591

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGW HHE GAI+V++ID+VWEAALK+GL+P
Sbjct  592  SLEGWPHHEVGAIDVNRIDLVWEAALKHGLRP  623



>ref|XP_010545441.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Tarenaya hassleriana]
Length=629

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RRRVRVLMLT STERF KIQ EA V+ Q +LVQVTKYQAA+HCKTWI+GKW TPREQ WA
Sbjct  471  RRRVRVLMLTLSTERFQKIQKEAAVEDQNYLVQVTKYQAAQHCKTWIVGKWMTPREQRWA  530

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G HFHQFVVPP+I+FR++C+YG LAAM+LP DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  531  PPGAHFHQFVVPPVIRFRKNCSYGDLAAMRLPVDVQGLGTCEYTMERGVVHACHAGGVVH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGL  252
             LEGW HHE GAI+VD+ID+VWE+AL+ G 
Sbjct  591  MLEGWDHHEVGAIDVDRIDLVWESALRLGF  620



>ref|XP_010929210.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Elaeis guineensis]
Length=619

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA++C+TWI+GKW +P EQ  A
Sbjct  467  RKKIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQNCETWIVGKWLSPLEQRCA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPII FRRDCTYG LAAM+LP+DV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  527  PPGTHFHQFVVPPIIGFRRDCTYGNLAAMRLPQDVQGLGMCEYTMQRGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE GAI+VD+IDVVW AALK+GL P
Sbjct  587  FLEGWTHHEVGAIDVDRIDVVWRAALKHGLTP  618



>ref|XP_010904609.1| PREDICTED: protein ECERIFERUM 3-like [Elaeis guineensis]
Length=617

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RV+MLT STERF+KIQ EA  +CQ +LVQVTK QAA+ CKTWI+GKW +PREQ WA
Sbjct  465  RKKIRVMMLTLSTERFLKIQKEASPECQHYLVQVTKCQAAQSCKTWIVGKWLSPREQHWA  524

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
             SGTHFHQFVVPPII FRRDCTY KLAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  525  SSGTHFHQFVVPPIIGFRRDCTYWKLAAMRLPQDVQGLGTCEYTMERGVVHACHAGGVVH  584

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI VD+IDVVW AA+K+GL P
Sbjct  585  CLEGWSHHEVGAIAVDRIDVVWRAAMKHGLTP  616



>ref|XP_008775261.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=441

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RVLMLT S ERF+KIQ EA  +CQ +LVQVTK +AA++CKTWI GKW + REQ  A
Sbjct  289  RKKIRVLMLTLSPERFLKIQKEASPECQHYLVQVTKCEAAQNCKTWIAGKWLSAREQRCA  348

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSGTHFHQFVVPPII FR+DCTYGKLAAM+LP+DV+GLG+CE+ M RGVVHACH+GGVVH
Sbjct  349  PSGTHFHQFVVPPIINFRKDCTYGKLAAMRLPQDVQGLGTCEHAMERGVVHACHSGGVVH  408

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGW+HHE GAI+VDQIDVVW AA+K+GL P
Sbjct  409  CLEGWSHHEVGAIDVDQIDVVWRAAMKHGLTP  440



>gb|EYU37115.1| hypothetical protein MIMGU_mgv1a021583mg [Erythranthe guttata]
Length=609

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ VRVLMLT S ERF  IQ EAP + Q  LVQVTKYQAA++CKTWI+GKW TPREQ +A
Sbjct  453  RKGVRVLMLTLSAERFKNIQIEAPAEFQNNLVQVTKYQAAQNCKTWIVGKWITPREQKFA  512

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G HFHQFVVPP+ QFRRDCTYG LAAM+LP+DV+GLG CEYTM RGVVHACHAGGVVH
Sbjct  513  PPGAHFHQFVVPPVFQFRRDCTYGDLAAMRLPEDVQGLGVCEYTMERGVVHACHAGGVVH  572

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGWTHHE GAI+V++ID VWEAA+K G KP
Sbjct  573  SLEGWTHHEVGAIDVERIDPVWEAAMKYGFKP  604



>dbj|BAK04110.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 139/185 (75%), Gaps = 33/185 (18%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCK----------------  570
            R+R+RV+MLT S+ERF+KIQ EAP + Q++LVQVTKYQAA++CK                
Sbjct  381  RKRIRVIMLTMSSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKVSPAFSHPIADQSVVL  440

Query  569  -----------------TWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLA  441
                             TW++GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLA
Sbjct  441  YRPCMMMCYMMVTLGVQTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLA  500

Query  440  AMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALK  261
            AM+LPKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHE GA++VD+IDVVW+AALK
Sbjct  501  AMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWQHHEVGALDVDRIDVVWKAALK  560

Query  260  NGLKP  246
            +GL P
Sbjct  561  HGLTP  565



>ref|XP_003578148.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
 ref|XP_010238185.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=619

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RV+M+T STERF KIQ EA  + Q++LVQVTKY++A  CKTWI+GKW +PREQ WA
Sbjct  467  RKKIRVMMMTLSTERFQKIQKEAAAEHQQYLVQVTKYRSAGQCKTWIVGKWLSPREQRWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYGKLAAM+LPKD  GLGSCE+++ RGVVHACHAGGVVH
Sbjct  527  PPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPKDARGLGSCEFSLERGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+THHE GAI+V +IDVVWEAALK+GL+P
Sbjct  587  FLEGYTHHEVGAIDVGRIDVVWEAALKHGLRP  618



>ref|XP_004973574.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=618

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+RVRV+MLT S ERF K+Q EAP + +++LV+VTKYQ+A+HCKTWI GKW +P +Q WA
Sbjct  466  RKRVRVMMLTASEERFQKVQEEAPPEARQYLVRVTKYQSAQHCKTWIAGKWLSPGDQRWA  525

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRRDCTYG LAAM+LP DV+GLG CEYT+GRGVVHACHAGGVVH
Sbjct  526  PAGTHFHQFVVPPILRFRRDCTYGDLAAMRLPDDVQGLGVCEYTLGRGVVHACHAGGVVH  585

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+  HE GAI+VD+IDVVWEAAL++GL+P
Sbjct  586  FLEGYEGHEVGAIDVDRIDVVWEAALRHGLRP  617



>ref|XP_009120299.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Brassica rapa]
Length=630

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ VRVLMLT S ERF KIQ EAPV+ Q +LVQVTKY AA++CKTWI+GKW TPREQSWA
Sbjct  473  RQGVRVLMLTLSVERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRR+CTYG LAAM+LP+DV+GLG+CEYTM RGVVHACHAGGVVH
Sbjct  533  PKGTHFHQFVVPPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
              EG  H E GAI+VD+ID+VWEAA+++GL+
Sbjct  593  MREGGEHQEVGAIDVDRIDLVWEAAMRHGLR  623



>ref|XP_006350059.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=629

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            ++VRVLMLT STERF KI  EAP + QK+LV VTKYQAA++CKTWI+GKW TPREQ +AP
Sbjct  471  KQVRVLMLTSSTERFQKILKEAPYEYQKYLVHVTKYQAARNCKTWIVGKWITPREQKFAP  530

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
             G HFHQFVVPP++ +R DCTYG LAAM+LP  V+GLGSCEYTM RGVVHACHAGGVVH+
Sbjct  531  VGAHFHQFVVPPVLPYRSDCTYGDLAAMRLPPHVKGLGSCEYTMERGVVHACHAGGVVHS  590

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            LEGWTHHE GAI+V +ID+VWEAALK+GL P
Sbjct  591  LEGWTHHEVGAIDVQRIDLVWEAALKHGLMP  621



>emb|CAN62442.1| hypothetical protein VITISV_009194 [Vitis vinifera]
Length=459

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 115/152 (76%), Gaps = 13/152 (9%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++ VLMLTQS+ERF  IQ EAP+DCQ+FLVQVTKYQAA+HCKTWIIGKW TPREQSWA
Sbjct  320  RKKIXVLMLTQSSERFESIQREAPIDCQQFLVQVTKYQAAQHCKTWIIGKWCTPREQSWA  379

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPPI+ FRRDCTYGKLAAM+LP+DVEGLG CE  +               
Sbjct  380  PPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPEDVEGLGXCEVVLFISYKV---------  430

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
               G T    GAI+VDQIDV W AAL +G KP
Sbjct  431  ---GLT-MRFGAIDVDQIDVAWTAALSHGFKP  458



>dbj|BAK02959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+++RV+M+T STERF KIQ EA  + Q++LVQVTK+Q+A+ C+TWI+GKW +PREQ WA
Sbjct  467  RKKIRVMMMTLSTERFQKIQKEAAAEHQQYLVQVTKFQSAEQCRTWIVGKWLSPREQRWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
              GTHFHQFVVPPI+ FRRDCTYGKLAAM+LPKD  GLGSCE+++ RGVVHACHAGGVVH
Sbjct  527  SPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPKDARGLGSCEFSLERGVVHACHAGGVVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEG+ HHE GAI+VD+IDVVWEAALK+G++P
Sbjct  587  FLEGYAHHEVGAIDVDRIDVVWEAALKHGIRP  618



>gb|ADE77418.1| unknown [Picea sitchensis]
Length=283

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RV+MLT S ERF  IQSEAP + Q FLVQVTKY+AA++CKTWI+GKW   +EQ+WA
Sbjct  130  RKGIRVMMLTYSKERFKSIQSEAPPEFQNFLVQVTKYEAAQNCKTWIVGKWIAYKEQTWA  189

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G H HQFVVPPI + R+DCTYGKLA M+LP  VEGL +CEYTM R  VHACHAGG++H
Sbjct  190  PVGCHLHQFVVPPIFELRKDCTYGKLAGMQLPDAVEGLSTCEYTMPRRCVHACHAGGILH  249

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            +LEGW HHE GAI+V++ID+VWEAAL +G KP 
Sbjct  250  SLEGWEHHEVGAIDVNKIDMVWEAALNHGFKPM  282



>emb|CDX88642.1| BnaA03g10070D [Brassica napus]
Length=637

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF  IQ EAP + Q +LVQVTKY +A+HCKTWI+GKW TPREQSWA
Sbjct  478  RRGVRVLMLTLSAERFQNIQKEAPAEFQNYLVQVTKYNSAQHCKTWIVGKWLTPREQSWA  537

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GTHFHQFVVPPI++FRR+ TY +LAA++LPKDV+GLG+CEYTM RGVVHACHAGG+VH
Sbjct  538  PAGTHFHQFVVPPILKFRRNYTYDELAAVRLPKDVQGLGTCEYTMDRGVVHACHAGGLVH  597

Query  341  ALEGWTHHEAGAINVD--QIDVVWEAALKNGLK  249
             LEGW HHE GA++V+  +ID+VWEAA+++GL 
Sbjct  598  MLEGWEHHEVGAVDVEPLRIDLVWEAAMRHGLS  630



>ref|XP_002961424.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
 gb|EFJ36684.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
Length=620

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VR++MLT S ER+  I  EAP DC+  LVQVTKYQA + CKTWI+GKWAT ++QSWA
Sbjct  467  RRNVRIMMLTTSRERYQSIVDEAPADCRHNLVQVTKYQAGQTCKTWIVGKWATSQDQSWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G+HFHQFVVPP+ ++R+DCTYGKLA MKLP+ VEG+ SCEYT  RGVV ACHAGG+VH
Sbjct  527  PHGSHFHQFVVPPVHEYRKDCTYGKLAGMKLPQSVEGVHSCEYTFDRGVVAACHAGGLVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            ALE WTHHE G+I++D ID+VWEAALK+GL+P
Sbjct  587  ALENWTHHEVGSIDIDHIDLVWEAALKHGLEP  618



>ref|XP_002990278.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
 gb|EFJ08693.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
Length=620

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VR++MLT S ER+  I  EAP DC+  LVQVTKYQA + CKTWI+GKWAT ++QSWA
Sbjct  467  RRNVRIMMLTTSRERYQSIVDEAPADCRHNLVQVTKYQAGQTCKTWIVGKWATSQDQSWA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G+HFHQFVVPP+ ++R+DCTYGKLA MKLP+ VEG+ SCEYT  RGVV ACHAGG+VH
Sbjct  527  PHGSHFHQFVVPPVHEYRKDCTYGKLAGMKLPQSVEGVHSCEYTFDRGVVAACHAGGLVH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            ALE WTHHE G+I++D ID+VWEAALK+GL+P
Sbjct  587  ALENWTHHEVGSIDIDHIDLVWEAALKHGLEP  618



>ref|XP_004252089.1| PREDICTED: protein ECERIFERUM 3-like [Solanum lycopersicum]
Length=248

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            ++VRVLM T S+ERF KI  EAP + QK+LV VTKYQAAK+CKT I+GKW TPREQ +AP
Sbjct  105  KQVRVLMSTSSSERFQKILKEAPYEYQKYLVHVTKYQAAKNCKTCIVGKWITPREQKFAP  164

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
             G HFHQFVVPPI+ +R DCTYG LAAM+LP  V+GLGSCEYTM RGVVHACHAGGVVH+
Sbjct  165  VGAHFHQFVVPPILPYRNDCTYGDLAAMRLPPHVKGLGSCEYTMERGVVHACHAGGVVHS  224

Query  338  LEGWTHHEAGAINVDQIDVVWEAA  267
            LEGWTHHE GAI+V +ID+VWEAA
Sbjct  225  LEGWTHHEVGAIDVQRIDLVWEAA  248



>ref|XP_006836672.1| hypothetical protein AMTR_s00088p00066300 [Amborella trichopoda]
 gb|ERM99525.1| hypothetical protein AMTR_s00088p00066300 [Amborella trichopoda]
Length=364

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R+VRVLMLT S +RF  I  EAPV+ +KFLV VT+Y   K+CKTWI+GKW + R+Q WAP
Sbjct  211  RKVRVLMLTNSKKRFESILHEAPVEYRKFLVHVTRYDEGKNCKTWIVGKWMSARDQRWAP  270

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
             GT+FHQF +P I + RRDC YGK+AA++LP+DV+GLGSCEY MGRGVVHACHAGG+VH 
Sbjct  271  PGTYFHQFAIPVITESRRDCKYGKMAAIRLPEDVQGLGSCEYVMGRGVVHACHAGGMVHL  330

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            LEGW HHE GAI+VD IDVVW  ALK+G KP
Sbjct  331  LEGWKHHEVGAIDVDMIDVVWNKALKHGFKP  361



>gb|ADE75704.1| unknown [Picea sitchensis]
Length=623

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RV+MLT S ERF  IQSEAP + Q FLVQVTKY+AA++CKTWI+GKW   +EQ+WA
Sbjct  470  RKGIRVMMLTYSKERFKSIQSEAPPEFQNFLVQVTKYEAAQNCKTWIVGKWIAYKEQTWA  529

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P G H HQFVVPPI + R+DCTYGKLA M+LP  VEGL +CEYTM R  VHACHAGG++H
Sbjct  530  PVGCHLHQFVVPPIFELRKDCTYGKLAGMQLPDAVEGLSTCEYTMPRRCVHACHAGGILH  589

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +LEGW HHE GAI+V++ID+VWEAALK+G KP
Sbjct  590  SLEGWEHHEVGAIDVNKIDMVWEAALKHGFKP  621



>gb|EMT23422.1| Protein WAX2 [Aegilops tauschii]
Length=694

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 135/208 (65%), Gaps = 56/208 (27%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTK------------------------  594
            R+++RV+MLT S+ERF+KIQ EAP + Q++LVQVTK                        
Sbjct  486  RKKIRVVMLTMSSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWA  545

Query  593  ----------------------YQAAKH----------CKTWIIGKWATPREQSWAPSGT  510
                                  Y+ + H            TW++GKW +PREQ WAP GT
Sbjct  546  PPGTHFHQFVVPPIIGFRRDCTYRRSNHPIAHQFVPLCYDTWLVGKWLSPREQRWAPPGT  605

Query  509  HFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEG  330
            HFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEY+M RGVVHACHAGGVVH LEG
Sbjct  606  HFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYSMERGVVHACHAGGVVHFLEG  665

Query  329  WTHHEAGAINVDQIDVVWEAALKNGLKP  246
            W HHE GA++VD+IDVVW+AALK+GL P
Sbjct  666  WEHHEVGALDVDRIDVVWKAALKHGLTP  693



>ref|XP_001781794.1| predicted protein [Physcomitrella patens]
 gb|EDQ53442.1| predicted protein [Physcomitrella patens]
Length=625

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R +RVLMLT STERF  IQ EAP DC+  L+ VTKYQA K+CKTWI+GKW   ++Q WAP
Sbjct  471  RGIRVLMLTTSTERFDAIQREAPADCRNNLIHVTKYQAGKNCKTWIVGKWTFAKDQQWAP  530

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKD-VEGLGSCEYTMGRgvvhachaggvvh  342
             GT FHQFVVP I + R+DCTYG+LA M LPK+ V+GL +CE+TM RG VHACHAGG++H
Sbjct  531  PGTFFHQFVVPVISEVRKDCTYGQLAGMVLPKEGVKGLRTCEFTMERGAVHACHAGGMIH  590

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
             LEGWTHHE G+I+V +IDVVWEAA+++G  P
Sbjct  591  TLEGWTHHEVGSIDVSRIDVVWEAAMRHGFAP  622



>ref|XP_002960347.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
 gb|EFJ37886.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
Length=626

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ER+  +  +APV+ QK LVQVTKYQA ++CKTWI+GKW   ++QSWA
Sbjct  473  RRGVRVLMLTNSRERYEAVVKDAPVEFQKNLVQVTKYQAGQNCKTWIVGKWIFAKDQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GT FHQFVVPP+ + R+D TYGKL+ M LPK+ EGL  CE+TM RGVVHACHAGG++H
Sbjct  533  PPGTFFHQFVVPPVAEIRKDVTYGKLSGMYLPKNHEGLHFCEFTMPRGVVHACHAGGLLH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            ALEGW HHE G+I+++ ID VW+AAL+ G  P+
Sbjct  593  ALEGWDHHEIGSIDIENIDKVWQAALRQGFAPY  625



>ref|XP_002967368.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
 gb|EFJ31967.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
Length=626

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ER+  +  +APV+ QK LVQVTKYQA ++CKTWI+GKW   ++QSWA
Sbjct  473  RRGVRVLMLTNSRERYEAVVKDAPVEFQKNLVQVTKYQAGQNCKTWIVGKWIFAKDQSWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GT FHQFVVPP+ + R+D TYGKL+ M LPK+ EGL  CE+TM RGVVHACHAGG++H
Sbjct  533  PPGTFFHQFVVPPVAEIRKDVTYGKLSGMYLPKNHEGLHFCEFTMPRGVVHACHAGGLLH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            ALEGW HHE G+I+++ ID VW+AAL+ G  P+
Sbjct  593  ALEGWDHHEIGSIDIENIDKVWQAALRQGFAPY  625



>ref|XP_001783415.1| predicted protein [Physcomitrella patens]
 gb|EDQ51755.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
             R VRVLMLT S +RF  IQSE     ++ ++QVTKYQA ++CK W++GKWATP EQ WA
Sbjct  473  HRGVRVLMLTTSRDRFEMIQSELAPQHRENMIQVTKYQAGQNCKRWVLGKWATPSEQKWA  532

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPP+++ R+DCTYGKL+AM++PK+++GL SCE TM RGVVHACHAGG+VH
Sbjct  533  PPGTHFHQFVVPPVMECRKDCTYGKLSAMQVPKEMKGLRSCEMTMPRGVVHACHAGGLVH  592

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            ALEGW  HE GAI+V +ID  W AALK G KP
Sbjct  593  ALEGWEFHEVGAIDVGRIDETWAAALKQGFKP  624



>ref|XP_002993505.1| hypothetical protein SELMODRAFT_137211 [Selaginella moellendorffii]
 gb|EFJ05397.1| hypothetical protein SELMODRAFT_137211 [Selaginella moellendorffii]
Length=146

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT S  R+  I SEA  + ++ LV VTKYQA ++CK WIIGKW T REQ +AP GTHFH
Sbjct  1    MLTSSRSRYESILSEAAAEHRRNLVHVTKYQAGQYCKRWIIGKWVTEREQGFAPVGTHFH  60

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            QFVVPP+ + R DCTYGKL  M+LPKDV G+ +CEY   RGVV ACHAGG++HALE W+H
Sbjct  61   QFVVPPVQEVRSDCTYGKLVGMRLPKDVAGVHTCEYINDRGVVAACHAGGLLHALEEWSH  120

Query  320  HEAGAINVDQIDVVWEAALKNGL  252
            HE G+I+V++ID VW+AAL  G 
Sbjct  121  HEVGSIDVERIDTVWQAALSRGF  143



>ref|XP_009132284.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=580

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR VRVLMLT S ERF KIQ EAP + QK+LVQVTKY +A+HCKTWI+GKW TPREQSWA
Sbjct  478  RRGVRVLMLTLSVERFEKIQKEAPSEFQKYLVQVTKYNSAQHCKTWIVGKWLTPREQSWA  537

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  396
            P+GTHFHQFVVPPI++FRR+CTY +LAAM+LPKDV+GLG+CE
Sbjct  538  PAGTHFHQFVVPPILKFRRNCTYDELAAMRLPKDVQGLGTCE  579



>ref|XP_002975687.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
 gb|EFJ23316.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
Length=628

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ VRVLMLT S  R+  I SEA  + ++ LV VTKYQA ++CK WIIGKW T REQ +A
Sbjct  476  RKGVRVLMLTSSRSRYESILSEAAAEHRRNLVHVTKYQAGQYCKRWIIGKWVTEREQGFA  535

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P GTHFHQFVVPP+ + R DCTYGKL  MKLPKDV G+ +CEY   RGVV ACHAGG++H
Sbjct  536  PVGTHFHQFVVPPVQEVRSDCTYGKLVGMKLPKDVAGVHTCEYINDRGVVAACHAGGLLH  595

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGL  252
            ALE W+HHE G+I+V++ID VW+AAL  G 
Sbjct  596  ALEEWSHHEVGSIDVERIDTVWQAALSRGF  625



>ref|XP_010103144.1| Protein WAX2 [Morus notabilis]
 gb|EXB94909.1| Protein WAX2 [Morus notabilis]
Length=623

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -3

Query  680  MLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFH  501
            MLT STERF KIQ EAP DCQ +LVQ+TKY AA++CKTWI+GKW TPREQ WAPSGTHFH
Sbjct  453  MLTISTERFQKIQKEAPADCQSYLVQITKYHAAQNCKTWIVGKWITPREQGWAPSGTHFH  512

Query  500  QFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMG  384
            QFVVPPI+ FRRDCTYG LAAM+LP+DVEGLGSCE   G
Sbjct  513  QFVVPPILSFRRDCTYGDLAAMRLPEDVEGLGSCEEING  551



>ref|XP_009387452.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RVLMLT S ERF+ IQ EAP DCQ  LVQVTK QAA++CKTWI+GKW +PREQ WA
Sbjct  465  RKNIRVLMLTLSAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWA  524

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  396
            P GTHFHQFVVPPII FRRDCTYG LAAM+LPKDV+GLGSCE
Sbjct  525  PPGTHFHQFVVPPIIGFRRDCTYGSLAAMRLPKDVQGLGSCE  566



>ref|XP_001782380.1| predicted protein [Physcomitrella patens]
 gb|EDQ52834.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R +RV+MLT S +RF  IQ EAP + +  L+ VTKYQA   CKTWI+GKW   ++Q WAP
Sbjct  468  RGIRVMMLTTSKDRFDTIQREAPGEFKNNLIHVTKYQAGSKCKTWIVGKWTWQKDQQWAP  527

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLP-KDVEGLGSCEYTMGRgvvhachaggvvh  342
             GTHFHQFVVP I ++R+DCTYG+LA MKLP + V+GL +CE  M R  VHACHAGG+VH
Sbjct  528  PGTHFHQFVVPAIGEWRKDCTYGRLAGMKLPDRGVKGLRTCEMNMERRAVHACHAGGLVH  587

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGL  252
            ALEGWTHHE GAI+VD+IDVVW AA+++G 
Sbjct  588  ALEGWTHHEVGAIDVDRIDVVWAAAMRHGF  617



>ref|XP_009387450.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R+ +RVLMLT S ERF+ IQ EAP DCQ  LVQVTK QAA++CKTWI+GKW +PREQ WA
Sbjct  495  RKNIRVLMLTLSAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWA  554

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  396
            P GTHFHQFVVPPII FRRDCTYG LAAM+LPKDV+GLGSCE
Sbjct  555  PPGTHFHQFVVPPIIGFRRDCTYGSLAAMRLPKDVQGLGSCE  596



>ref|XP_011012180.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=527

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = -3

Query  638  EAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDC  459
            EA +   +  V+V    A    KTWI+GKW TP EQSWAP+GTHFHQFVVPPI+ FRRDC
Sbjct  388  EAILRANRLGVKVISLAALN--KTWIVGKWITPGEQSWAPTGTHFHQFVVPPILSFRRDC  445

Query  458  TYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVV  279
            TYG LAAM+LP +V+GLG+CEYTM RGVVHACHAGGVVH LEGW HHE GAI+VD+ID+V
Sbjct  446  TYGDLAAMRLPDEVQGLGNCEYTMDRGVVHACHAGGVVHLLEGWAHHEVGAIDVDRIDLV  505

Query  278  WEAALKNGLKP  246
            W AALK+GLKP
Sbjct  506  WNAALKHGLKP  516



>gb|KHG04940.1| Protein WAX2 [Gossypium arboreum]
Length=571

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -3

Query  602  VTKYQAAKHCK--TWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  429
            +  Y + +H +  TWI GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  447  IALYLSRRHVRVLTWIAGKWITPWEQSWAPSGTHFHQFVVPPILASRRDCTYGDLAAMRL  506

Query  428  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            P+DVEGLGSCEY + RGVVHACHAGG VH LEGWTHHE G I+VD+ID+VWEAALK+G +
Sbjct  507  PEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIGPIDVDRIDLVWEAALKHGFR  566

Query  248  P  246
            P
Sbjct  567  P  567



>ref|XP_005822223.1| hypothetical protein GUITHDRAFT_158756 [Guillardia theta CCMP2712]
 gb|EKX35243.1| hypothetical protein GUITHDRAFT_158756 [Guillardia theta CCMP2712]
Length=538

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 0/152 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            AR+ V+V M+TQS ERF  I+S+ P   +  L      +  ++C  W++G++ TP EQ  
Sbjct  379  ARKGVKVTMMTQSRERFEGIRSDCPAAYRGNLKHSLSIEDGRNCSCWVVGRFLTPAEQKV  438

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP GT FHQFVVPP+ + R+DC+Y  L A  LP    G  SCE TM R  VHACHAG +V
Sbjct  439  APRGTTFHQFVVPPLPELRKDCSYTSLPAFTLPDSATGFRSCEMTMERRNVHACHAGALV  498

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            H LEGWTHHE GAI+ D+IDV WEAA ++G +
Sbjct  499  HLLEGWTHHEVGAIDPDRIDVTWEAAERHGFR  530



>emb|CEF99557.1| Uncharacterised domain Wax2, C-terminal [Ostreococcus tauri]
Length=621

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            A R VRV+M T S ERF  I++EAP   Q   VQ T      + K W+IGK  + ++Q  
Sbjct  468  AERGVRVVMYTTSEERFEMIRAEAPKKDQHLFVQSTSLTDGANIKDWVIGKHCSMKDQKS  527

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP G  FHQFVVPPI + R+DC Y  L A KLP++ +   SCE TM RG VHACHAG +V
Sbjct  528  APRGATFHQFVVPPIPESRKDCVYTDLPAFKLPRESKDFRSCEMTMPRGHVHACHAGALV  587

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            HALEGW HHE GAI+  +ID+ WEAALK+G  
Sbjct  588  HALEGWDHHEVGAIDHTRIDLTWEAALKHGFS  619



>ref|XP_003081883.1| faceless pollen-1 (ISS) [Ostreococcus tauri]
Length=675

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 100/152 (66%), Gaps = 0/152 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
            A R VRV+M T S ERF  I++EAP   Q   VQ T      + K W+IGK  + ++Q  
Sbjct  522  AERGVRVVMYTTSEERFEMIRAEAPKKDQHLFVQSTSLTDGANIKDWVIGKHCSMKDQKS  581

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP G  FHQFVVPPI + R+DC Y  L A KLP++ +   SCE TM RG VHACHAG +V
Sbjct  582  APRGATFHQFVVPPIPESRKDCVYTDLPAFKLPRESKDFRSCEMTMPRGHVHACHAGALV  641

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            HALEGW HHE GAI+  +ID+ WEAALK+G  
Sbjct  642  HALEGWDHHEVGAIDHTRIDLTWEAALKHGFS  673



>ref|XP_001420263.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98556.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=621

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 98/149 (66%), Gaps = 0/149 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R +RV+M T S ERF KI++EA    Q  LVQ T        K W+IGK    ++Q+ AP
Sbjct  470  RGMRVVMYTTSEERFEKIRNEAAKKDQHLLVQSTSLSDGAKIKDWVIGKHCPEKDQNMAP  529

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
             G  FHQFVVPPI + R+DC Y  L A KLPK+ +   SCE TM RG +HACHAG +VH+
Sbjct  530  RGAIFHQFVVPPIPETRKDCVYTDLPAFKLPKEAKDFRSCEMTMKRGHIHACHAGALVHS  589

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGL  252
            LEGW HHE GAI+  +ID  WEAALK+G 
Sbjct  590  LEGWDHHEVGAIDHTRIDTTWEAALKHGF  618



>ref|XP_003061467.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54097.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            + VRV+M T S ERF KI+ EA    QK +VQ T  +  +  K W++GK  +P++Q  AP
Sbjct  469  KGVRVVMYTTSKERFEKIRGEARRQDQKNIVQATTLEEGRGIKDWVVGKHCSPKDQEKAP  528

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
                FHQFVVPPI + RRDC Y  L A  LPKD +   SCE TM RG VHACHAG +VHA
Sbjct  529  KHATFHQFVVPPIPETRRDCVYTNLPAFALPKDAKDFRSCEMTMERGHVHACHAGALVHA  588

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            LEGWT++E GAI+  +ID  WEAA+K+G K
Sbjct  589  LEGWTYNEVGAIDHTRIDSTWEAAMKHGFK  618



>ref|XP_002509294.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70552.1| predicted protein [Micromonas sp. RCC299]
Length=620

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R VRV+M T + +RF KI++EA  + ++ LVQ T  +     K W++GK+ + R+Q+ AP
Sbjct  469  RGVRVVMYTTAKDRFEKIKAEAREEHRELLVQATTLEEGSGIKDWVVGKFCSARDQAKAP  528

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
                FHQFVVPP+ + RRDC Y  L A KLPK+ +   SCE TM RG VHACHAG +VHA
Sbjct  529  KHATFHQFVVPPLEESRRDCAYTDLPAFKLPKEAKDFRSCEMTMERGHVHACHAGALVHA  588

Query  338  LEGWTHHEAGAINVDQIDVVWEAALKNGL  252
            LEGWT++E GAI+  +IDV W+AA+K+G 
Sbjct  589  LEGWTYNEVGAIDHTKIDVTWDAAVKHGF  617



>gb|AAA33934.1| lipid transfer protein, partial [Senecio odorus]
Length=524

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR V VLMLT STERF  IQ EAP  C+K LVQVTKYQAAK+CKTW+IGKW TP +Q WA
Sbjct  437  RRGVHVLMLTLSTERFQNIQEEAPSKCRKNLVQVTKYQAAKNCKTWVIGKWITPGQQRWA  496

Query  521  PSGTHFHQFVVPPIIQFRR  465
            PSGTHFHQFVVPPI+ FRR
Sbjct  497  PSGTHFHQFVVPPILAFRR  515



>gb|AFW70401.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=90

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -3

Query  572  KTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  396
            +TWI+GKW +PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GL SCE
Sbjct  8    QTWIVGKWLSPREQRWAPSGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLSSCE  66



>gb|ADE77466.1| unknown [Picea sitchensis]
Length=228

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = -3

Query  698  RRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAP  519
            R +RV +L  S E+F K +   P +    L QVT YQ+  +CKTWI+G W T  +Q  AP
Sbjct  70   RGIRVQLLVDSEEQFQKSKMGVPWEFTHNLFQVTSYQSCINCKTWIVGSWLTREDQMKAP  129

Query  518  SGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhA  339
             GT F  F+  PI   R DCTY  + AM +PK++E L +CE  + R V+ A   GG+VHA
Sbjct  130  KGTRFIPFLPFPIPNVREDCTYQTVPAMSVPKNLENLHACENGLPRRVMSAWRVGGIVHA  189

Query  338  LEGWTHHEA-GAINVDQIDVVWEAALKNGLKPF  243
            LE W HHE    I+   +  VW+AA K+G  PF
Sbjct  190  LEEWNHHECDDVIDSASVTRVWDAATKHGFLPF  222



>gb|EPS58637.1| hypothetical protein M569_16175, partial [Genlisea aurea]
Length=320

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            ++RV VLMLT STERF  IQ EA  D +KFLVQVT ++AA++CKTWI+GKW T  +Q WA
Sbjct  235  KKRVTVLMLTASTERFRDIQKEAAADGRKFLVQVTGHEAAQNCKTWIMGKWITQEQQRWA  294

Query  521  PSGTHFHQFVVPPI  480
            P+GTHFHQFVVPPI
Sbjct  295  PAGTHFHQFVVPPI  308



>ref|XP_001756318.1| predicted protein [Physcomitrella patens]
 gb|EDQ78714.1| predicted protein [Physcomitrella patens]
Length=628

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 2/154 (1%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSW  525
             RR VRVL+LT S   F   Q +     Q+ +V V  +Q  +HC+ WI+ ++   ++  W
Sbjct  472  VRRGVRVLVLTNSPRYFGSTQPKVTKVNQQLIVNVMSFQEGQHCREWILDEYVEGKDLKW  531

Query  524  APSGTHFHQFV--VPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachagg  351
            AP G   H       P+ + R+DCTY    AM +PK ++GL SCE  + RGV+ A HA G
Sbjct  532  APPGADLHHVCQGSKPLPRTRKDCTYAMYPAMHVPKSMKGLRSCEGGLPRGVISASHAAG  591

Query  350  vvhALEGWTHHEAGAINVDQIDVVWEAALKNGLK  249
            VVH+LE WTH+E G I+V++ID VW AALK+G +
Sbjct  592  VVHSLEKWTHNEVGPIDVERIDTVWAAALKHGFQ  625



>ref|XP_007509665.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19468.1| predicted protein [Bathycoccus prasinos]
Length=681

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 101/203 (50%), Gaps = 53/203 (26%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQV--------------------------  600
            ++  RVLM T S ERF KI+ E P   +  L +V                          
Sbjct  476  KKNCRVLMCTTSEERFEKIKMECPEKFRHLLFRVNNANEKVEITQESTSNVLKKSGSFLL  535

Query  599  --------------------------TKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQ  498
                                      T Y + + C+ W++G+     EQS APS T FHQ
Sbjct  536  SRLGSLKNNNNNNNREVETEEKNDTKTNYSSGRTCRNWVVGRHCDKNEQSLAPSKTTFHQ  595

Query  497  FVVPPIIQFRRDCTYGKLAAMKLP-KDVEGLGSCEYTMGRgvvhachaggvvhALEGWTH  321
            FVVPPI + R DC Y  L A +LP K+ +   +CE TM RG VHACHAG ++HALEGW H
Sbjct  596  FVVPPIPETRSDCAYTDLPAFRLPEKEAKDFKTCEMTMERGCVHACHAGALIHALEGWQH  655

Query  320  HEAGAINVDQIDVVWEAALKNGL  252
            HE GAI+ ++IDV W+A+ K+G 
Sbjct  656  HEVGAIDPEKIDVTWKASKKHGF  678



>gb|KFK27319.1| hypothetical protein AALP_AA8G367000, partial [Arabis alpina]
Length=77

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  458  TYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVV  279
            TYG LAAM+LPKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHE GAI+VD+ID+V
Sbjct  1    TYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLV  60

Query  278  WEAALKNGL  252
            WEAA++NGL
Sbjct  61   WEAAMRNGL  69



>ref|XP_002964260.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
 gb|EFJ34593.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
Length=615

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 82/137 (60%), Gaps = 1/137 (1%)
 Frame = -3

Query  650  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  471
             ++   P + Q  LV V   +  +HCK WI+G+     EQ  APSG  F+QF    + + 
Sbjct  478  SLKKSVPQESQHKLVAVESLEHGRHCKAWIVGEPLRAMEQLHAPSGACFYQFTEEAMEET  537

Query  470  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAG-AINVD  294
            R DC Y KL AM+LP + +G+ +CE +M RGVV A HAGG++  +E W HHE G  I+VD
Sbjct  538  RPDCLYAKLPAMRLPPEYKGIRACEGSMPRGVVQASHAGGILATMENWNHHEVGNTIDVD  597

Query  293  QIDVVWEAALKNGLKPF  243
            +ID V  AA+  G  P+
Sbjct  598  KIDAVMRAAVNRGFVPY  614



>ref|XP_002989550.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
 gb|EFJ09426.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
Length=621

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 5/154 (3%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            R R   ++   S+  F  ++   P + Q  L+ VT +      + WI+G+     EQ  A
Sbjct  471  RHRATEVLAKSSSYAFESLKKSVPQESQHKLLDVTCWN----LQAWIVGEPLRAMEQLHA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            PSG  F+QF    + + R DC+Y KL AM+LP + +G+ +CE +M RGVV A HAGG++ 
Sbjct  527  PSGACFYQFTEEAMEETRPDCSYAKLPAMRLPPEYKGIRACEGSMPRGVVQASHAGGILA  586

Query  341  ALEGWTHHEAG-AINVDQIDVVWEAALKNGLKPF  243
             +E W HHE G  I+VD+ID V  AA+  G  P+
Sbjct  587  TMENWNHHEVGNTIDVDKIDAVMRAAVNRGFVPY  620



>dbj|BAF01865.1| CER1 protein [Arabidopsis thaliana]
Length=373

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + KI+S  P +C+  LV +T  +A    K W++G+  T  EQ  A  GT F  F
Sbjct  225  TLRLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPF  283

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  284  SQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHE  343

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++ +  +D VWEA L +G +P 
Sbjct  344  CGTSLLLSDLDQVWEACLSHGFQPL  368



>ref|XP_009118866.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=644

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 85/162 (52%), Gaps = 9/162 (6%)
 Frame = -3

Query  686  VLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTH  507
            V +LT   E + K++S  P +C+  LV +T    A + K W++G+  T  EQ  A  GT 
Sbjct  487  VEVLTLLPEEYEKLRSLVPQECRDRLVLLTSETLASN-KVWLMGEGTTREEQEMATKGTL  545

Query  506  FHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGW  327
            F  F   P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW
Sbjct  546  FIPFSQFPLKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGW  605

Query  326  THHEAGAINV--DQIDVVWEAALKNGLKPF*RMPFLLLSSHL  207
              HE G  N+    +D VWEA L +G +P      LLL  H 
Sbjct  606  EMHECGTSNILLSDLDQVWEACLTHGFQP------LLLPHHF  641



>gb|AHD24918.1| CER1 [Brassica napus]
Length=628

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 84/162 (52%), Gaps = 9/162 (6%)
 Frame = -3

Query  686  VLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTH  507
            V +LT   E + K+ S  P +C+  L+ +T    A + K W++G+  T  EQ  A  GT 
Sbjct  471  VEVLTLLPEEYEKLSSFVPKECRDRLILLTSETLASN-KVWLMGEGTTREEQEMATKGTL  529

Query  506  FHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGW  327
            F  F   P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW
Sbjct  530  FIPFSQFPLKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGW  589

Query  326  THHEAGAINV--DQIDVVWEAALKNGLKPF*RMPFLLLSSHL  207
              HE G  N+    +D VWEA L +G +P      LLL  H 
Sbjct  590  ETHECGTSNILLSDLDQVWEACLSHGFQP------LLLPHHF  625



>ref|NP_850932.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 dbj|BAE98972.1| CER1 protein [Arabidopsis thaliana]
 gb|AEE27400.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=461

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + KI+S  P +C+  LV +T  +A    K W++G+  T  EQ  A  GT F  F
Sbjct  313  TLRLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPF  371

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  372  SQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHE  431

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++ +  +D VWEA L +G +P 
Sbjct  432  CGTSLLLSDLDQVWEACLSHGFQPL  456



>emb|CDY38059.1| BnaCnng09200D [Brassica napus]
Length=829

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 86/167 (51%), Gaps = 11/167 (7%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            +R V VL L    E + K+ S  P +C+  L+ +T    A + K W++G+  T  EQ  A
Sbjct  669  QRGVEVLTLLP--EEYEKLSSFVPKECRDRLILLTSETLASN-KVWLMGEGTTREEQEMA  725

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
              GT F  F   P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++H
Sbjct  726  TKGTLFIPFSQFPLKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILH  785

Query  341  ALEGWTHHEAGAINV--DQIDVVWEAALKNGLKPF*RMPFLLLSSHL  207
            ALEGW  HE G  N+    +D VWEA L +G +P      LLL  H 
Sbjct  786  ALEGWETHECGTSNILLSDLDQVWEACLSHGFQP------LLLPHHF  826



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + KI+S  P +C+  LV +T  +A    K W++G+  T  EQ  A  GT F  F
Sbjct  477  TLRLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPF  535

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  536  SQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHE  595

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++ +  +D VWEA L +G +P 
Sbjct  596  CGTSLLLSDLDQVWEACLSHGFQPL  620



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 83/152 (55%), Gaps = 8/152 (5%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++S  P +C+  LV +T  +A    K W++G+  T  +Q  A +GT F  F   P
Sbjct  471  DEYEKLRSSVPRECRGHLVHLTS-EAFSSSKVWLVGEGTTREDQEKATNGTLFIPFSQFP  529

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGA-  306
            + Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HA+EGW  HE GA 
Sbjct  530  LKQLRKDCIYHTTPALIVPKSLVNIHSCENWLPRKAMSATRVAGILHAVEGWEMHECGAS  589

Query  305  INVDQIDVVWEAALKNGLKPF*RMPFLLLSSH  210
            + +  +D VWEA L +G +P      LLL  H
Sbjct  590  VLLSDLDQVWEACLSHGFQP------LLLPDH  615



>gb|KFK27321.1| hypothetical protein AALP_AA8G367700 [Arabis alpina]
Length=70

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  437  MKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKN  258
            M+LPKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHE GAI+VD+ID+VWEAA+K+
Sbjct  1    MRLPKDVQGLGTCEYTMERGVVHACHAGGVVHILEGWEHHEVGAIDVDRIDLVWEAAMKH  60

Query  257  GL  252
             L
Sbjct  61   NL  62



>gb|EMT05122.1| Protein WAX2 [Aegilops tauschii]
Length=465

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQ  531
            R+++RV+M+T STERF KIQ EA  + Q++LVQVTK+Q+A+ CKTWI+GKW +PREQ
Sbjct  341  RKKIRVMMMTLSTERFQKIQKEAAAEDQQYLVQVTKFQSAEQCKTWIVGKWLSPREQ  397



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (53%), Gaps = 1/144 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + K++S  P +C+  LV +T   +    K W++G+  T  EQ  A  GT F  F
Sbjct  500  TLRLDEYEKLRSCVPQECRDHLVYLTT-DSLSSKKVWLVGEGTTREEQEKATKGTLFIPF  558

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  559  SQFPLKQLRRDCIYHTTPALIVPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWDMHE  618

Query  314  AGAINVDQIDVVWEAALKNGLKPF  243
             G   +  +D VW+A L +G +P 
Sbjct  619  CGTSLLSDLDQVWDACLSHGFQPL  642



>ref|XP_010512796.1| PREDICTED: protein ECERIFERUM 1-like, partial [Camelina sativa]
Length=326

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + K++S  P +C+ +LV  T  +     K W++G+  T  EQ  A  GT F  F
Sbjct  178  TLRLDEYEKLRSCIPQECRDYLVYQTS-EVLSSNKVWLVGEGTTSEEQEKATKGTLFIPF  236

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  237  SQFPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHE  296

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++    +D VWEA L +G +P 
Sbjct  297  CGTSLLPSDLDQVWEAFLSHGFQPL  321



>gb|EMS58990.1| Protein WAX2 [Triticum urartu]
Length=532

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQ  531
            R+++RV+M+T STERF KIQ EA  + Q++LVQVTK+Q+A+ CKTWI+GKW +PREQ
Sbjct  422  RKKIRVMMMTLSTERFQKIQKEAAAEDQQYLVQVTKFQSAEQCKTWIVGKWLSPREQ  478



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 78/145 (54%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + KI+S  P +C+  LV +T  +A    K W++G+  T  EQ  A  GT F  F
Sbjct  477  TLRLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPF  535

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q R DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  536  SQFPLKQLRSDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWETHE  595

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++ +  +D VWEA L +G +P 
Sbjct  596  CGTSLLLSDLDKVWEACLSHGFQPL  620



>ref|XP_010496698.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=386

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + K++S  P +C+ +LV  T  +     K W++G+  T  EQ  A  GT F  F
Sbjct  238  TLRLDEYEKLRSCIPQECRDYLVYQTS-EVLSSNKVWLVGEGTTSEEQEKATKGTLFIPF  296

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  297  SQFPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHE  356

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++    +D VWEA L +G +P 
Sbjct  357  CGTSLLPSDLDQVWEACLSHGFQPL  381



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 79/149 (53%), Gaps = 5/149 (3%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKH----CKTWIIGKWATPREQSWAPSGTH  507
            T   + + KI+S  P +C+  LV +T    + +     K W++G+  T  EQ  A  GT 
Sbjct  477  TLRLDEYEKIRSCVPQECRDHLVYLTSEALSSNKGFWVKVWLVGEGTTREEQEKATKGTL  536

Query  506  FHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGW  327
            F  F   P+ Q RRDC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW
Sbjct  537  FIPFSQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGW  596

Query  326  THHEAG-AINVDQIDVVWEAALKNGLKPF  243
              HE G ++ +  +D VWEA L +G +P 
Sbjct  597  EMHECGTSLLLSDLDQVWEACLSHGFQPL  625



>gb|KDO85390.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=376

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y AA   K W++G   T +EQ+ AP GT F  +   P
Sbjct  235  DDYEKLKLRIPVEAQHNLVLSTSY-AAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  293

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  294  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  353

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  354  MCD-IHQVWHASLRHGFRPL  372



>gb|KFK42594.1| hypothetical protein AALP_AA1G015600 [Arabis alpina]
Length=624

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 1/144 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T     + K++S  P +C+  LV +T  +A    K W++G+  +  EQ  A  GT F  F
Sbjct  477  TLRLHEYEKLRSCIPRECRDQLVHITT-EALSSNKVWLVGEGTSKEEQEKAIKGTLFIPF  535

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q R DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  536  SQFPLKQLRGDCIYHTTPALVVPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWEMHE  595

Query  314  AGAINVDQIDVVWEAALKNGLKPF  243
             G   +  +D VWEA L +G +P 
Sbjct  596  CGTSLLSDLDQVWEACLSHGFQPL  619



>gb|ACN35049.1| unknown [Zea mays]
Length=520

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 90/147 (61%), Gaps = 0/147 (0%)
 Frame = +3

Query  252  QPILQCSLPDYINLVYIDSSCLVVRPPFESMNHSACMARMNNASSHCVLT*SKPLNILWK  431
            +P+L+  LP  ++ V+++ + LVV PPF++++H+A +AR+++ + H VL  ++ L++L +
Sbjct  34   EPVLERRLPHDVDPVHLEGAHLVVLPPFQAVHHAAGVARVHHPALHRVLAGAETLDVLGE  93

Query  432  LHCCQLPVSAVSTELDDRRDYKLMKMCS*RSPALLSRCSPFPNYPRLTVFSCLILGNLN*  611
             H  +L V AV  E DD R Y+L+++ + R P LL R  P  + P LT    L+LG+L+ 
Sbjct  94   PHGGELAVGAVPAEADDGRHYELVEVRARRRPPLLPRRQPLAHDPCLTALRRLVLGDLHD  153

Query  612  EFLAIHRGFTLDFYESLSGLGKHQNSD  692
              L + R   L+  + L    +HQ+ D
Sbjct  154  VLLELWRRLPLNLQKPLRRKRQHQDPD  180



>ref|XP_011073243.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Sesamum indicum]
Length=547

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  704  ARRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCK  570
            ARR+V+VLMLT S ERF+KIQ EAPVDCQK+LVQVTKYQAAKHCK
Sbjct  490  ARRKVKVLMLTLSKERFLKIQEEAPVDCQKYLVQVTKYQAAKHCK  534



>gb|ACN34356.1| unknown [Zea mays]
Length=637

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 90/147 (61%), Gaps = 0/147 (0%)
 Frame = +3

Query  252  QPILQCSLPDYINLVYIDSSCLVVRPPFESMNHSACMARMNNASSHCVLT*SKPLNILWK  431
            +P+L+  LP  ++ V+++ + LVV PPF++++H+A +AR+++ + H VL  ++ L++L +
Sbjct  34   EPVLERRLPHDVDPVHLEGAHLVVLPPFQAVHHAAGVARVHHPALHRVLAGAETLDVLGE  93

Query  432  LHCCQLPVSAVSTELDDRRDYKLMKMCS*RSPALLSRCSPFPNYPRLTVFSCLILGNLN*  611
             H  +L V AV  E DD R Y+L+++ + R P LL R  P  + P LT    L+LG+L+ 
Sbjct  94   PHGGELAVGAVPAEADDGRHYELVEVRARRRPPLLPRRQPLAHDPCLTALRRLVLGDLHD  153

Query  612  EFLAIHRGFTLDFYESLSGLGKHQNSD  692
              L + R   L+  + L    +HQ+ D
Sbjct  154  VLLELWRRLPLNLQKPLRRKRQHQDPD  180



>gb|AIE57503.1| CER1 [Camelina sativa]
Length=625

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 2/145 (1%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + K++S  P +C+ +LV  T  +     K W++G+  T  EQ  A  GT F  F
Sbjct  477  TLRLDEYEKLRSCIPQECRDYLVYQTS-EVLSSNKVWLVGEGTTSEEQEKATKGTLFIPF  535

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P+ Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  536  SQFPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHE  595

Query  314  AG-AINVDQIDVVWEAALKNGLKPF  243
             G ++    +D VWEA L +G +P 
Sbjct  596  CGTSLLPSDLDQVWEACLSHGFQPL  620



>gb|KDO85389.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=474

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y A K  K W++G   T +EQ+ AP GT F  +   P
Sbjct  333  DDYEKLKLRIPVEAQHNLVLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  391

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  392  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  451

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  452  MCD-IHQVWHASLRHGFRPL  470



>gb|KDO85388.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=529

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y A K  K W++G   T +EQ+ AP GT F  +   P
Sbjct  388  DDYEKLKLRIPVEAQHNLVLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  446

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  447  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  506

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  507  MCD-IHQVWHASLRHGFRPL  525



>ref|XP_006464363.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Citrus sinensis]
Length=611

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y A K  K W++G   T +EQ+ AP GT F  +   P
Sbjct  470  DDYEKLKLRIPVEAQHNLVLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  528

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  529  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  588

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  589  MCD-IHQVWHASLRHGFRPL  607



>gb|KDO85387.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y A K  K W++G   T +EQ+ AP GT F  +   P
Sbjct  498  DDYEKLKLRIPVEAQHNLVLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  556

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  557  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  616

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  617  MCD-IHQVWHASLRHGFRPL  635



>ref|XP_006464361.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|KDO85380.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y A K  K W++G   T +EQ+ AP GT F  +   P
Sbjct  498  DDYEKLKLRIPVEAQHNLVLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  556

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  557  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  616

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  617  MCD-IHQVWHASLRHGFRPL  635



>ref|XP_006445499.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58739.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=639

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 2/140 (1%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y A K  K W++G   T +EQ+ AP GT F  +   P
Sbjct  498  DDYEKLKLRIPVEAQHNLVLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIP  556

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  557  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  616

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  617  MCD-IHQVWHASLRHGFRPL  635



>ref|XP_010535406.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Tarenaya hassleriana]
Length=628

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR ++V  L ++   + ++    P +C+  L+  T      H K W++G+    R+Q  A
Sbjct  470  RRGIQVTALRRN--EYERLTLCVPAECKGRLLYSTSKTLPSH-KIWLVGEGMDERDQERA  526

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
              GT F  F   P  + R+DC Y    A+ +PK +E   SCE  + R  + A  A G++H
Sbjct  527  TEGTVFIPFSPFPPKELRKDCIYHTTPALTVPKSLENFHSCENWLPRKAISATRAAGILH  586

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF*RMPFLLLSSHL  207
            ALEGW  HE G+  +  +D +W+A L +G +P   +PF  +S+ +
Sbjct  587  ALEGWETHEHGSTLLHDLDFIWDACLGHGFRP---LPFPPISNQV  628



>ref|XP_010535407.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Tarenaya hassleriana]
Length=584

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
            RR ++V  L ++   + ++    P +C+  L+  T      H K W++G+    R+Q  A
Sbjct  426  RRGIQVTALRRN--EYERLTLCVPAECKGRLLYSTSKTLPSH-KIWLVGEGMDERDQERA  482

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
              GT F  F   P  + R+DC Y    A+ +PK +E   SCE  + R  + A  A G++H
Sbjct  483  TEGTVFIPFSPFPPKELRKDCIYHTTPALTVPKSLENFHSCENWLPRKAISATRAAGILH  542

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF*RMPFLLLSSHL  207
            ALEGW  HE G+  +  +D +W+A L +G +P   +PF  +S+ +
Sbjct  543  ALEGWETHEHGSTLLHDLDFIWDACLGHGFRP---LPFPPISNQV  584



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -3

Query  629  VDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYG  450
            V  Q  LV ++K  AA   KTW++G   T ++Q  AP G  F  F   P  + R DC+Y 
Sbjct  481  VASQSNLVVLSKSVAA--YKTWLVGDGLTEKQQLNAPKGALFIPFSTFPPKKVRSDCSYL  538

Query  449  KLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEA  270
               AM  P  ++ L SCE  + R  + A  A G+VHALEGWT HE G  N+  ++ VW+A
Sbjct  539  HTPAMLAPASLQNLDSCENWLPRRALSAVRAAGIVHALEGWTEHECGE-NMLNVEEVWQA  597

Query  269  ALKNGLKPF  243
            ALK+G +P 
Sbjct  598  ALKHGFRPL  606



>ref|XP_006464362.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
 gb|KDO85381.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=638

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 3/140 (2%)
 Frame = -3

Query  662  ERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPP  483
            + + K++   PV+ Q  LV  T Y  A H   W++G   T +EQ+ AP GT F  +   P
Sbjct  498  DDYEKLKLRIPVEAQHNLVLSTSY--AAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIP  555

Query  482  IIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAI  303
              + R+DC Y    AM +P  +  + SCE  +GR V+ A    G++HALEGW  +E G  
Sbjct  556  PRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT  615

Query  302  NVDQIDVVWEAALKNGLKPF  243
              D I  VW A+L++G +P 
Sbjct  616  MCD-IHQVWHASLRHGFRPL  634



>gb|KJB67450.1| hypothetical protein B456_010G191300 [Gossypium raimondii]
Length=671

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -3

Query  590  QAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEG  411
            ++   CK W++G   T  EQ  A  GT F  F   P+   R+DC Y    AM+ PK +E 
Sbjct  549  KSYSSCKVWLVGDDLTEEEQRKANKGTLFIPFSQFPLKNLRKDCFYHTTPAMQAPKALEN  608

Query  410  LGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            + SCE  + R V+      G++HALEGW  HE G   +  ID VWEA LK+G +P 
Sbjct  609  VDSCENWLPRRVMSVWRIAGILHALEGWEEHECGY-TISNIDKVWEACLKHGFQPL  663



>ref|XP_007015845.1| CER1 protein [Theobroma cacao]
 gb|EOY33464.1| CER1 protein [Theobroma cacao]
Length=618

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = -3

Query  575  CKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  396
             K W++G   T +EQS AP GT F  F + P  Q R+DC Y    AM+ PK VE + SCE
Sbjct  505  VKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQIRKDCYYHTTPAMEAPKSVENMHSCE  564

Query  395  YTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
              + R V+ A    G++HA EGW  +E G      ID VWEA+L++G +P 
Sbjct  565  DWLPRRVMSASRVAGIIHASEGWEVNECGGTTF-SIDKVWEASLEHGFRPL  614



>ref|XP_007015842.1| CER1 protein isoform 1 [Theobroma cacao]
 gb|EOY33461.1| CER1 protein isoform 1 [Theobroma cacao]
Length=618

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 1/116 (1%)
 Frame = -3

Query  590  QAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEG  411
             A    K W++G   T +EQS AP GT F  F + P  Q R+DC Y    AM+ PK VE 
Sbjct  500  SARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQIRKDCYYHTTPAMEAPKSVEN  559

Query  410  LGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            + SCE  + R V+ A    G++HA EGW  +E G      ID VWEA+L++G +P 
Sbjct  560  MHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTF-SIDKVWEASLEHGFRPL  614



>ref|XP_008804903.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Phoenix dactylifera]
Length=565

 Score = 62.8 bits (151),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKH  576
            R+++RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA++
Sbjct  467  RKKIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQN  508


 Score = 39.3 bits (90),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  567  VDNWEMGYTSRAKLGSFRNTFSSICSPAYHPIP*RLHLREVGSNEASKGC  418
            +D W++  T  A +G+ R+    +C  +Y+ +   LHL + G +EAS GC
Sbjct  510  MDRWQVAITKGAAVGTTRHALPPVCGSSYYWLQEGLHLWKAGCHEASPGC  559



>gb|KDO42773.1| hypothetical protein CISIN_1g041887mg [Citrus sinensis]
Length=223

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -3

Query  572  KTWIIGKWATPREQSWAPSGTHFHQFV-VPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  396
            K W++G   T  EQS A  GT F  F   PP  + R+DCTY    AM  P  +E + SCE
Sbjct  108  KIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCE  167

Query  395  YTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
              + R V+ A   GG+VHALEGW  HE G   +  +D VW+AAL++G  P 
Sbjct  168  NWLPRRVMSAWRIGGIVHALEGWNEHECG-YTISNVDTVWDAALRHGFVPL  217



>ref|XP_010496713.1| PREDICTED: protein ECERIFERUM 1 isoform X1 [Camelina sativa]
Length=625

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = -3

Query  650  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  471
            K++S  P++ +  LV  T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q 
Sbjct  485  KLRSCVPLEYRDHLVYQTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQL  543

Query  470  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAG-AINVD  294
            R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++   
Sbjct  544  RKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLPS  603

Query  293  QIDVVWEAALKNGLKPF  243
             +D VWEA L +G +P 
Sbjct  604  DLDQVWEACLSHGFQPL  620



>ref|XP_010496714.1| PREDICTED: protein ECERIFERUM 1 isoform X2 [Camelina sativa]
Length=625

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = -3

Query  650  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  471
            K++S  P++ +  LV  T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q 
Sbjct  485  KLRSCVPLEYRDHLVYQTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQL  543

Query  470  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAG-AINVD  294
            R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++   
Sbjct  544  RKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLPS  603

Query  293  QIDVVWEAALKNGLKPF  243
             +D VWEA L +G +P 
Sbjct  604  DLDQVWEACLSHGFQPL  620



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 82/153 (54%), Gaps = 8/153 (5%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWII-GKWATPREQSW  525
            RR V+V M+ +    F K++ + P +  + LV  T Y      K W++  + +   EQ  
Sbjct  470  RRGVQVAMVDKVD--FDKLKLQLPTELWRNLVLSTSYN----YKVWLVEDRVSREEEQKQ  523

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
            AP GTHF  F   P+ + R DC Y    A+ +PK +E + SCE  + R V+ A    G+V
Sbjct  524  APEGTHFIPFSQFPLKRIRNDCVYYTTPALLIPKALENVHSCENWLPRRVMSAWRVAGIV  583

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            HALEGW  HE G   +D +D VW A L++G  P
Sbjct  584  HALEGWEEHECGDTVLD-VDKVWNATLRHGFLP  615



>ref|XP_010496480.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=625

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 2/137 (1%)
 Frame = -3

Query  650  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  471
            K++S  P++ +  LV  T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q 
Sbjct  485  KLRSCVPLEYRDHLVYQTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQL  543

Query  470  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAG-AINVD  294
            R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++   
Sbjct  544  RKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLPS  603

Query  293  QIDVVWEAALKNGLKPF  243
             +D VWEA L +G +P 
Sbjct  604  DLDQVWEACLSHGFQPL  620



>ref|XP_004308720.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=614

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 64/110 (58%), Gaps = 1/110 (1%)
 Frame = -3

Query  572  KTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEY  393
            K W++G   + +EQ  AP GT F  F   P  + RRDC Y    AMK+PK +E + SCE 
Sbjct  502  KIWLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKIPKSLENVYSCEN  561

Query  392  TMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
             + R V+ A    G+VHA+EGW  HE G   +  ID VW+A L++G +P 
Sbjct  562  WLPRRVMSAWRIAGIVHAMEGWNEHECGY-TMSNIDKVWQATLRHGFQPL  610



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 77/153 (50%), Gaps = 7/153 (5%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWA  522
             R ++V+M  +     +K+Q   P     +L     Y      + WI+G      EQ  A
Sbjct  470  NRGIQVMMTKKQEFHILKLQ--MPESTASYLTLSNTYSP----QVWIVGDGLDDTEQRRA  523

Query  521  PSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvh  342
            P+GT F  F   P  +  +DCTY    AMK+P+ +E + SCE  + R V+ A    G+VH
Sbjct  524  PTGTRFIPFSQFPPKKLNKDCTYNTTPAMKIPETLENMHSCENWLPRRVMSAWRIAGIVH  583

Query  341  ALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            ALEGW+ HE G   +D I+ +W A L +G  P 
Sbjct  584  ALEGWSAHECGETMLD-IEKIWSATLHHGFLPL  615



>ref|XP_007219469.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
 gb|EMJ20668.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
Length=218

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = -3

Query  572  KTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEY  393
            K W++G   +  EQ  AP GT F  F   P  + R+DC Y    AMK P  +E + +CE 
Sbjct  101  KIWLVGDGLSEEEQLRAPKGTLFVPFSQFPQKKLRKDCFYHYTPAMKTPPSLENVHACEN  160

Query  392  TMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
             + R V+ A    G+VHALEGW  HE G  N+  ID VW+A L++G +P 
Sbjct  161  WLPRRVMSAWRIAGIVHALEGWKEHECG-YNMSNIDKVWQATLQHGFQPL  209



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (55%), Gaps = 6/144 (4%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + +VK+++      + F+++ +  Q     KTW++G+  T  EQ  AP GT F  +
Sbjct  477  TMHKDDYVKLKNSFSSFGKNFIIEKSYTQ-----KTWLVGEGLTEEEQLKAPKGTLFITY  531

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P I++R+DC+Y    AM +P  ++ + SCE  + R V+ A    G+VH LEGW+ HE
Sbjct  532  SQFPPIKYRKDCSYHFTPAMLVPSSIQNVHSCENWLPRKVMSAWRIAGIVHCLEGWSEHE  591

Query  314  AGAINVDQIDVVWEAALKNGLKPF  243
                 +  ID VW + L++G +P 
Sbjct  592  CNY-TMHNIDKVWRSTLQHGFQPL  614



>ref|XP_006583526.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Glycine max]
Length=522

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (55%), Gaps = 6/144 (4%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + +VK+++      + F+++ +  Q     KTW++G+  T  EQ  AP GT F  +
Sbjct  374  TMHKDDYVKLKNSFSSFGKNFIIEKSYTQ-----KTWLVGEGLTEEEQLKAPKGTLFITY  428

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P I++R+DC+Y    AM +P  ++ + SCE  + R V+ A    G+VH LEGW+ HE
Sbjct  429  SQFPPIKYRKDCSYHFTPAMLVPSSIQNVHSCENWLPRKVMSAWRIAGIVHCLEGWSEHE  488

Query  314  AGAINVDQIDVVWEAALKNGLKPF  243
                 +  ID VW + L++G +P 
Sbjct  489  CNY-TMHNIDKVWRSTLQHGFQPL  511



>ref|XP_010517047.1| PREDICTED: protein CER1-like 2 isoform X2 [Camelina sativa]
Length=586

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = -3

Query  626  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  447
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  453  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHT  508

Query  446  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEA  270
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N V     VWEA
Sbjct  509  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSVLNSPRVWEA  568

Query  269  ALKNGLKPF  243
            AL+NG +P 
Sbjct  569  ALRNGFQPL  577



>ref|XP_010505369.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=634

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = -3

Query  626  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  447
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  493  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTMFLPFSQFPPDKLRKDCVYHT  548

Query  446  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEA  270
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N +     VWEA
Sbjct  549  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSILNSPRVWEA  608

Query  269  ALKNGLKPF  243
            AL+NG +P 
Sbjct  609  ALRNGFQPL  617



>ref|XP_006410962.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
 gb|ESQ52415.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
Length=628

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 76/151 (50%), Gaps = 7/151 (5%)
 Frame = -3

Query  692  VRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSG  513
            ++VL+L +   R   +      DC++ LV    Y        W++G   +  EQ  A  G
Sbjct  470  IKVLVLREEEHRM--LAELLGGDCKENLVLTRNYSPT----IWLVGDGLSKEEQKMAGKG  523

Query  512  THFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALE  333
            T F  F   P  + R+DC Y    AM +P   + + SCE  +GR V+ A   GG+VHALE
Sbjct  524  TRFLPFSQFPPTKLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALE  583

Query  332  GWTHHEAGAIN-VDQIDVVWEAALKNGLKPF  243
            GW  HE G  N +     VWEAAL+NG KP 
Sbjct  584  GWEEHECGLHNSILNPPKVWEAALRNGFKPL  614



>ref|XP_010517046.1| PREDICTED: protein CER1-like 2 isoform X1 [Camelina sativa]
Length=623

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = -3

Query  626  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  447
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  490  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHT  545

Query  446  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEA  270
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N V     VWEA
Sbjct  546  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSVLNSPRVWEA  605

Query  269  ALKNGLKPF  243
            AL+NG +P 
Sbjct  606  ALRNGFQPL  614



>ref|XP_010520222.1| PREDICTED: protein ECERIFERUM 1-like [Tarenaya hassleriana]
Length=631

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (52%), Gaps = 4/158 (3%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            T   + + K+    P + +  L+  T      H K W++G+    +EQ  A  G+ F  F
Sbjct  477  TLRKDEYDKLMGCIPHEWRDRLLYSTSKTLPSH-KIWLVGEGIDEKEQGKATQGSIFIPF  535

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P  + R+DC Y    A+ +PK +E + SCE  + R  + A  A G+VHALEGW  HE
Sbjct  536  SQFPPKELRKDCLYHTTPALTVPKSLENIHSCENWLPRKAISAARAAGIVHALEGWERHE  595

Query  314  AGAINVDQIDVVWEAALKNGLKPF*RMPFLLLSSHLMK  201
             G+  +  +D +W+A+L +G +P   +P    S+H +K
Sbjct  596  CGSSLLHDLDAIWDASLSHGFRP---LPLPHFSTHNLK  630



>gb|KJB23545.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=525

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKT  567
            RRRVRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CK 
Sbjct  469  RRRVRVLMLTLSTERFQKIQREAPADCQNYLVQVTKYQAAQNCKV  513



>ref|XP_009143457.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=628

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 66/128 (52%), Gaps = 5/128 (4%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
            C++ LV  T Y        W++G   +  EQ  A  GT F  F   P  Q R+DC Y   
Sbjct  491  CKENLVLTTNYSPM----IWLVGDGLSKEEQKMATKGTRFLPFSQFPPTQLRKDCFYHTT  546

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEAA  267
             AM +P   + + SCE  +GR V+ A   GG+VHALEGW  HE G    V     VWEAA
Sbjct  547  PAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGPVVNPPRVWEAA  606

Query  266  LKNGLKPF  243
            L+NG KP 
Sbjct  607  LRNGFKPL  614



>ref|XP_010509285.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=630

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = -3

Query  626  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  447
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  490  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHT  545

Query  446  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEA  270
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N +     VWEA
Sbjct  546  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSILNSPRVWEA  605

Query  269  ALKNGLKPF  243
            AL+NG +P 
Sbjct  606  ALRNGFQPL  614



>emb|CDX74937.1| BnaA05g06830D [Brassica napus]
Length=619

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 66/128 (52%), Gaps = 5/128 (4%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
            C++ LV  T Y        W++G   +  EQ  A  GT F  F   P  Q R+DC Y   
Sbjct  482  CKENLVLTTNYSPM----IWLVGDGLSKEEQKMATKGTRFLPFSQFPPTQLRKDCFYHTT  537

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEAA  267
             AM +P   + + SCE  +GR V+ A   GG+VHALEGW  HE G    V     VWEAA
Sbjct  538  PAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGPVVNPPRVWEAA  597

Query  266  LKNGLKPF  243
            L+NG KP 
Sbjct  598  LRNGFKPL  605



>ref|XP_011469549.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=618

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 12/127 (9%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
             QKF +Q+           W++G   + +EQ  AP GT F  F   P  + RRDC Y   
Sbjct  500  AQKFAMQI-----------WLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYT  548

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAAL  264
             AMK+PK +E + SCE  + R V+ A    G+VHA+EGW  HE G   +  ID VW+A L
Sbjct  549  PAMKIPKSLENVYSCENWLPRRVMSAWRIAGIVHAMEGWNEHECGY-TMSNIDKVWQATL  607

Query  263  KNGLKPF  243
            ++G +P 
Sbjct  608  RHGFQPL  614



>emb|CDX93352.1| BnaC04g45440D [Brassica napus]
Length=632

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 7/129 (5%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
            C++ LV  T Y    +   W++G   +  EQ  A  GT F  F   P  Q R+DC Y   
Sbjct  498  CKENLVLTTNY----YPMIWLVGDRISKEEQKRAAKGTRFLPFSQFPPTQLRKDCFYHTT  553

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDV--VWEA  270
             AM +P   E + SCE  +GR V+ A   GG+VHALEGW  HE G ++V  +    VWEA
Sbjct  554  PAMIIPDTAENIDSCENWLGRRVMSAWRVGGIVHALEGWDEHECG-LDVPMVSPHGVWEA  612

Query  269  ALKNGLKPF  243
            AL+NG +P 
Sbjct  613  ALRNGFQPL  621



>ref|XP_004253517.1| PREDICTED: protein CER1-like 1, partial [Solanum lycopersicum]
Length=215

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 78/148 (53%), Gaps = 4/148 (3%)
 Frame = -3

Query  686  VLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTH  507
            + ++T   E + +++++   +    LV    Y  +K   TW++G   +  EQ  AP GT 
Sbjct  66   IQVVTLDEEDYKRLKAKLTPEAATNLVLSKSYNVSK---TWLVGDGLSKDEQLKAPKGTL  122

Query  506  FHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGW  327
            F  +   P  + R+DC Y    AM  PK VE + SCE  + R V+ A    G++HALEGW
Sbjct  123  FIPYSQFPPRKVRKDCFYFNTPAMIAPKHVENVDSCENWLPRRVMSAWRIAGILHALEGW  182

Query  326  THHEAGAINVDQIDVVWEAALKNGLKPF  243
              HE G + +D    VW+A+LK+G  P 
Sbjct  183  NEHECGDMILD-TQKVWKASLKHGFCPL  209



>emb|CDX91381.1| BnaC04g07690D [Brassica napus]
Length=619

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 66/128 (52%), Gaps = 5/128 (4%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
            C++ LV  T Y        W++G   +  EQ  A  GT F  F   P  Q R+DC Y   
Sbjct  482  CKENLVLTTNYSPM----IWLVGDGLSREEQEMATKGTRFLPFSQFPPTQLRKDCFYHTT  537

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAIN-VDQIDVVWEAA  267
             AM +P   + + SCE  +GR V+ A   GG+VHALEGW  HE G    V     VWEAA
Sbjct  538  PAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGPVVNPPRVWEAA  597

Query  266  LKNGLKPF  243
            L+NG KP 
Sbjct  598  LRNGFKPL  605



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 8/156 (5%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWA-TPREQSW  525
            +R ++V M+ ++  +F +++   P +    L   T Y      K W++G+ A    EQ  
Sbjct  564  QRGIQVAMIDKN--QFDRLKLRLPTELWSNLFLSTNYNY----KVWLVGEGALKDEEQRQ  617

Query  524  APSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvv  345
             P GTHF  F   P  + R DC Y    A+++PK +E + SCE  + R V+ A    G+V
Sbjct  618  LPEGTHFIPFSQFPPKRVRSDCIYYTTPALRIPKALENVHSCENWLPRRVMSAWRVAGIV  677

Query  344  hALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF*R  237
            HALEGW  HE G   +D +D VW A+L++G  P  R
Sbjct  678  HALEGWDEHECGDTVLD-VDKVWTASLRHGFLPVAR  712



>ref|XP_002528208.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF34165.1| sterol desaturase, putative [Ricinus communis]
Length=578

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCK  570
            RR+VRVLMLT STERF KIQ EAP+DCQ +LVQVTKYQAA++CK
Sbjct  473  RRKVRVLMLTLSTERFQKIQKEAPLDCQSYLVQVTKYQAAQNCK  516


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  404  SCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKP  246
            +C+YTM RGVVHACHAGGVVH LEGW+HHE GAI+VD+ID+VW AALK+GLKP
Sbjct  514  NCKYTMDRGVVHACHAGGVVHLLEGWSHHEVGAIDVDRIDLVWNAALKHGLKP  566



>dbj|BAA11025.1| CER1-like [Arabidopsis thaliana]
Length=148

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 1/116 (1%)
 Frame = -3

Query  572  KTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEY  393
            K W++G      EQ  A  GT F  F   P  + R+DC Y    AM++PK  + + SCE 
Sbjct  33   KVWLVGDGIENEEQMKAKEGTLFVPFSHFPPNKLRKDCFYQSTPAMRVPKSAQNIDSCEN  92

Query  392  TMGRgvvhachaggvvhALEGWTHHEAG-AINVDQIDVVWEAALKNGLKPF*RMPF  228
             +GR V+ A   GG+VHALEGW  H+ G   NV ++  +WEAAL++  +P    P 
Sbjct  93   WLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPLPPSPL  148



>ref|XP_008223563.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Prunus mume]
Length=575

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  701  RRRVRVLMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKT  567
            RR+VRVLMLT STERF KIQ EAP DCQ +LVQVTKYQAA++CK 
Sbjct  472  RRKVRVLMLTLSTERFQKIQKEAPADCQHYLVQVTKYQAARNCKV  516



>ref|XP_010097746.1| Protein WAX2 [Morus notabilis]
 gb|EXB70701.1| Protein WAX2 [Morus notabilis]
Length=618

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 4/146 (3%)
 Frame = -3

Query  674  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  495
            + S + FVK++     +  K  + ++KY + +H + W++G   T  EQS A  GT F  F
Sbjct  469  SSSEDEFVKLKKSQNDEDSKSNLVISKYYS-RH-QIWLVGDGLTEEEQSKASKGTIFVPF  526

Query  494  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  315
               P  + RRDC Y    AM  PK +E + +CE  + R  + A    G+VHAL GW  HE
Sbjct  527  SQFPPKKLRRDCFYHHTPAMLTPKTLENIHACENWLPRRAMSAWRVAGIVHALAGWDEHE  586

Query  314  AG--AINVDQIDVVWEAALKNGLKPF  243
             G    NV   + VWEA+L++G +P 
Sbjct  587  CGFNITNVCNFEKVWEASLRHGFQPL  612



>gb|KJB67446.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=528

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = -3

Query  590  QAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEG  411
            ++   CK W++G   T  EQ  A  GT F  F   P  + R+DC Y    AM+ P  +E 
Sbjct  406  KSYSSCKVWLVGDDLTEEEQRKANKGTLFIPFSQLPPKKLRKDCFYHTTPAMQTPTALEN  465

Query  410  LGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDVVWEAALKNGLKPF  243
            + SCE  + R V+      G++HALEGW  HE G   +  ID VWEA LK+G +P 
Sbjct  466  VDSCENWLPRRVMSVWRIAGILHALEGWEEHECGY-TMSNIDKVWEACLKHGFQPL  520



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 6/147 (4%)
 Frame = -3

Query  683  LMLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHF  504
            +++T+  E ++ ++S+ P     +L+    +      + W++G      EQ  AP GT F
Sbjct  475  VIITRKHEYYM-LKSQIPESIAGYLLLSNNHNT----QVWLVGDGLEDVEQRTAPKGTLF  529

Query  503  HQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWT  324
              +   P  + R+DCTY    AMK+P  VE + SCE  + R V+ A    G+VHALEGW 
Sbjct  530  VPYSSFPPKKVRKDCTYCTTPAMKIPDTVENMHSCENWLPRRVMSASRVAGIVHALEGWD  589

Query  323  HHEAGAINVDQIDVVWEAALKNGLKPF  243
             HE G    D ID +W AAL++G  P 
Sbjct  590  SHECGDKTQD-IDKMWSAALRHGFLPL  615



>ref|XP_009141683.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=619

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 8/135 (6%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
            C + L+  T +        W++G   +  EQ  A  GTHF  F   P  + R+DC Y   
Sbjct  491  CMENLILTTNHSPM----IWLVGDSLSNEEQKMAEEGTHFLPFSQFPPTELRKDCFYHTT  546

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDV--VWEA  270
             AM +P   + + SCE  +GR V+ A    G+VHALEGW  HE G ++V  ++    WEA
Sbjct  547  PAMIIPDSAQNIDSCENWLGRRVMSAWRVSGIVHALEGWEEHECG-LDVPMVNPHRAWEA  605

Query  269  ALKNGLKPF*RMPFL  225
            AL++G +P   +PFL
Sbjct  606  ALRHGFQPL-VLPFL  619



>emb|CDY55893.1| BnaA04g29140D [Brassica napus]
Length=626

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 8/135 (6%)
 Frame = -3

Query  623  CQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKL  444
            C + L+  T +        W++G   +  EQ  A  GTHF  F   P  + R+DC Y   
Sbjct  498  CMENLILTTNHSPM----IWLVGDSLSNEEQKMAEEGTHFLPFSQFPPTELRKDCFYHTT  553

Query  443  AAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEAGAINVDQIDV--VWEA  270
             AM +P   + + SCE  +GR V+ A    G+VHALEGW  HE G ++V  ++    WEA
Sbjct  554  PAMIIPDSAQNIDSCENWLGRRVMSAWRVSGIVHALEGWEEHECG-LDVPMVNPHRAWEA  612

Query  269  ALKNGLKPF*RMPFL  225
            AL++G +P   +PFL
Sbjct  613  ALRHGFQPL-VLPFL  626



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350