BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050N17

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097258.1|  PREDICTED: aspartokinase 2, chloroplastic is...    411   1e-137   Sesamum indicum [beniseed]
ref|XP_004143759.1|  PREDICTED: aspartokinase 2, chloroplastic-like     400   2e-134   
ref|XP_011097259.1|  PREDICTED: aspartokinase 2, chloroplastic is...    402   2e-134   Sesamum indicum [beniseed]
gb|EYU34829.1|  hypothetical protein MIMGU_mgv1a003795mg                403   2e-134   Erythranthe guttata [common monkey flower]
gb|KJB11754.1|  hypothetical protein B456_001G275700                    395   3e-134   Gossypium raimondii
ref|XP_010250546.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    402   6e-134   Nelumbo nucifera [Indian lotus]
ref|XP_009607339.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    401   6e-134   Nicotiana tomentosiformis
ref|XP_010096037.1|  Aspartokinase 3                                    401   8e-134   
ref|XP_009781447.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    400   2e-133   Nicotiana sylvestris
ref|XP_008465546.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    400   2e-133   Cucumis melo [Oriental melon]
gb|KGN51126.1|  hypothetical protein Csa_5G457770                       400   2e-133   Cucumis sativus [cucumbers]
gb|KHN00623.1|  Aspartokinase 1, chloroplastic                          394   3e-133   Glycine soja [wild soybean]
ref|XP_004164561.1|  PREDICTED: aspartokinase 3, chloroplastic-like     390   1e-132   
ref|XP_010316459.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    397   4e-132   Solanum lycopersicum
emb|CBI21283.3|  unnamed protein product                                394   4e-132   Vitis vinifera
ref|XP_006364050.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    397   6e-132   Solanum tuberosum [potatoes]
gb|KJB11756.1|  hypothetical protein B456_001G275700                    395   7e-132   Gossypium raimondii
ref|XP_009607337.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    396   7e-132   Nicotiana tomentosiformis
ref|XP_011006143.1|  PREDICTED: aspartokinase 2, chloroplastic-like     387   9e-132   Populus euphratica
ref|XP_004304561.1|  PREDICTED: aspartokinase 2, chloroplastic is...    396   9e-132   Fragaria vesca subsp. vesca
ref|XP_011024774.1|  PREDICTED: aspartokinase 2, chloroplastic is...    396   9e-132   Populus euphratica
ref|XP_006574470.1|  PREDICTED: precursor monofunctional aspartok...    395   1e-131   Glycine max [soybeans]
ref|XP_009781445.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    395   1e-131   Nicotiana sylvestris
gb|KJB11753.1|  hypothetical protein B456_001G275700                    395   1e-131   Gossypium raimondii
ref|XP_002301756.2|  hypothetical protein POPTR_0002s23800g             394   3e-131   
ref|XP_010660689.1|  PREDICTED: aspartokinase 2, chloroplastic is...    394   6e-131   Vitis vinifera
gb|KDP41849.1|  hypothetical protein JCGZ_26867                         390   7e-131   Jatropha curcas
ref|XP_007032011.1|  Aspartate kinase 3 isoform 1                       394   7e-131   
ref|XP_010250548.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    394   8e-131   Nelumbo nucifera [Indian lotus]
ref|XP_009607340.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    393   9e-131   Nicotiana tomentosiformis
ref|XP_007215316.1|  hypothetical protein PRUPE_ppa003561mg             393   1e-130   Prunus persica
ref|XP_008231031.1|  PREDICTED: aspartokinase 2, chloroplastic is...    393   2e-130   Prunus mume [ume]
ref|XP_009781448.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    392   2e-130   Nicotiana sylvestris
ref|XP_008465552.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    392   3e-130   Cucumis melo [Oriental melon]
gb|KJB33204.1|  hypothetical protein B456_006G000400                    385   4e-130   Gossypium raimondii
ref|XP_007151723.1|  hypothetical protein PHAVU_004G070100g             390   1e-129   Phaseolus vulgaris [French bean]
ref|XP_002321084.2|  hypothetical protein POPTR_0014s14270g             390   1e-129   Populus trichocarpa [western balsam poplar]
emb|CDP16734.1|  unnamed protein product                                390   2e-129   Coffea canephora [robusta coffee]
ref|XP_008465539.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    390   2e-129   Cucumis melo [Oriental melon]
ref|XP_003548032.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    390   3e-129   
gb|KHN13387.1|  Aspartokinase 1, chloroplastic                          390   3e-129   Glycine soja [wild soybean]
gb|KDO43558.1|  hypothetical protein CISIN_1g008621mg                   389   3e-129   Citrus sinensis [apfelsine]
ref|XP_006468884.1|  PREDICTED: aspartokinase 3, chloroplastic-li...    389   4e-129   Citrus sinensis [apfelsine]
ref|XP_004228743.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    389   5e-129   Solanum lycopersicum
gb|KEH25641.1|  monofunctional aspartokinase                            389   7e-129   Medicago truncatula
ref|XP_006364051.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    389   8e-129   Solanum tuberosum [potatoes]
ref|XP_010028950.1|  PREDICTED: aspartokinase 2, chloroplastic-like     389   8e-129   Eucalyptus grandis [rose gum]
ref|NP_001238151.1|  precursor monofunctional aspartokinase             388   1e-128   
ref|XP_011468211.1|  PREDICTED: aspartokinase 2, chloroplastic is...    388   1e-128   Fragaria vesca subsp. vesca
ref|XP_011024777.1|  PREDICTED: aspartokinase 3, chloroplastic is...    387   2e-128   Populus euphratica
ref|XP_011006114.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    387   2e-128   Populus euphratica
ref|XP_009607338.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    387   2e-128   Nicotiana tomentosiformis
emb|CBI35668.3|  unnamed protein product                                385   2e-128   Vitis vinifera
ref|XP_006657643.1|  PREDICTED: aspartokinase 1, chloroplastic-like     388   2e-128   Oryza brachyantha
gb|KJB11752.1|  hypothetical protein B456_001G275700                    387   2e-128   Gossypium raimondii
ref|XP_006574471.1|  PREDICTED: precursor monofunctional aspartok...    387   2e-128   
ref|XP_004515404.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    387   3e-128   Cicer arietinum [garbanzo]
ref|XP_009781446.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    387   3e-128   Nicotiana sylvestris
ref|XP_011006109.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    387   4e-128   Populus euphratica
ref|XP_007043813.1|  Aspartate kinase 1                                 387   6e-128   
ref|XP_002275779.1|  PREDICTED: aspartokinase 2, chloroplastic is...    386   7e-128   Vitis vinifera
ref|XP_007032013.1|  Aspartate kinase 3 isoform 3                       386   8e-128   
gb|KJB33201.1|  hypothetical protein B456_006G000400                    385   1e-127   Gossypium raimondii
gb|EPS64336.1|  hypothetical protein M569_10444                         382   2e-127   Genlisea aurea
ref|XP_009378035.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    385   2e-127   Pyrus x bretschneideri [bai li]
ref|XP_008231032.1|  PREDICTED: aspartokinase 2, chloroplastic is...    385   2e-127   Prunus mume [ume]
ref|NP_001059423.1|  Os07g0300900                                       385   2e-127   
ref|XP_010656841.1|  PREDICTED: aspartokinase 1, chloroplastic is...    385   2e-127   Vitis vinifera
ref|XP_008362086.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    384   6e-127   Malus domestica [apple tree]
ref|XP_007151724.1|  hypothetical protein PHAVU_004G070100g             382   2e-126   Phaseolus vulgaris [French bean]
ref|XP_006599412.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    382   4e-126   Glycine max [soybeans]
ref|XP_006468885.1|  PREDICTED: aspartokinase 3, chloroplastic-li...    381   4e-126   Citrus sinensis [apfelsine]
ref|XP_010927771.1|  PREDICTED: aspartokinase 2, chloroplastic-like     375   4e-126   
ref|XP_009131382.1|  PREDICTED: aspartokinase 2, chloroplastic          380   6e-126   Brassica rapa
gb|KDO43559.1|  hypothetical protein CISIN_1g008621mg                   381   6e-126   Citrus sinensis [apfelsine]
ref|XP_006446944.1|  hypothetical protein CICLE_v10014778mg             381   7e-126   Citrus clementina [clementine]
emb|CDX78557.1|  BnaA03g04690D                                          380   8e-126   
ref|XP_008379051.1|  PREDICTED: aspartokinase 2, chloroplastic is...    381   9e-126   
gb|KEH25640.1|  monofunctional aspartokinase                            380   1e-125   Medicago truncatula
emb|CDX70538.1|  BnaC03g06220D                                          380   1e-125   
ref|XP_002512848.1|  aspartate kinase, putative                         380   1e-125   
ref|XP_006399912.1|  hypothetical protein EUTSA_v10013157mg             379   1e-125   Eutrema salsugineum [saltwater cress]
ref|XP_011006115.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    379   2e-125   Populus euphratica
ref|XP_008379050.1|  PREDICTED: aspartokinase 2, chloroplastic is...    379   3e-125   
gb|KHM99220.1|  Aspartokinase 1, chloroplastic                          379   5e-125   Glycine soja [wild soybean]
ref|XP_004515405.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    379   5e-125   Cicer arietinum [garbanzo]
ref|XP_011006113.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    379   7e-125   Populus euphratica
dbj|BAC84902.1|  putative precursor monofunctional aspartokinase        379   8e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682652.1|  PREDICTED: aspartokinase 1, chloroplastic is...    378   9e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009125901.1|  PREDICTED: aspartokinase 1, chloroplastic-like     378   9e-125   Brassica rapa
ref|XP_010100040.1|  Aspartokinase 1                                    378   2e-124   
ref|XP_010453390.1|  PREDICTED: aspartokinase 1, chloroplastic          377   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010556239.1|  PREDICTED: aspartokinase 1, chloroplastic          373   2e-124   
ref|XP_009378037.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    377   3e-124   Pyrus x bretschneideri [bai li]
pdb|2CDQ|A  Chain A, Crystal Structure Of Arabidopsis Thaliana As...    375   3e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25564.1|  hypothetical protein AALP_AA8G131200                    376   5e-124   Arabis alpina [alpine rockcress]
ref|XP_010492197.1|  PREDICTED: aspartokinase 2, chloroplastic-like     375   7e-124   Camelina sativa [gold-of-pleasure]
ref|XP_008362087.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    376   7e-124   Malus domestica [apple tree]
ref|XP_010492075.1|  PREDICTED: aspartokinase 1, chloroplastic-like     376   9e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010419903.1|  PREDICTED: aspartokinase 1, chloroplastic-like     376   1e-123   Camelina sativa [gold-of-pleasure]
gb|EEC76545.1|  hypothetical protein OsI_14341                          375   1e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_008790700.1|  PREDICTED: aspartokinase 2, chloroplastic-like     375   1e-123   Phoenix dactylifera
ref|XP_008369639.1|  PREDICTED: aspartokinase 1, chloroplastic          375   1e-123   
ref|XP_010435684.1|  PREDICTED: aspartokinase 3, chloroplastic-like     374   2e-123   Camelina sativa [gold-of-pleasure]
gb|EEC74320.1|  hypothetical protein OsI_09598                          378   2e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_010530884.1|  PREDICTED: aspartokinase 1, chloroplastic-like     375   2e-123   Tarenaya hassleriana [spider flower]
gb|EEE58127.1|  hypothetical protein OsJ_09026                          377   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002871599.1|  lysine-sensitive aspartate kinase                  374   2e-123   
ref|XP_010453516.1|  PREDICTED: aspartokinase 2, chloroplastic          374   2e-123   Camelina sativa [gold-of-pleasure]
ref|XP_003562409.1|  PREDICTED: aspartokinase 1, chloroplastic is...    374   3e-123   Brachypodium distachyon [annual false brome]
ref|XP_003553303.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    374   3e-123   Glycine max [soybeans]
ref|XP_010496416.1|  PREDICTED: aspartokinase 3, chloroplastic          374   3e-123   Camelina sativa [gold-of-pleasure]
ref|XP_006604189.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    374   3e-123   
ref|NP_196832.1|  aspartokinase 1                                       374   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871558.1|  AK-LYS1                                            374   4e-123   Arabidopsis lyrata subsp. lyrata
ref|XP_006399820.1|  hypothetical protein EUTSA_v10013112mg             374   5e-123   Eutrema salsugineum [saltwater cress]
ref|XP_010420027.1|  PREDICTED: aspartokinase 2, chloroplastic-like     373   6e-123   Camelina sativa [gold-of-pleasure]
ref|XP_008776937.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    373   9e-123   Phoenix dactylifera
ref|NP_196910.1|  aspartokinase 2                                       372   1e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CAC06395.1|  aspartate kinase                                       372   1e-122   Arabidopsis thaliana [mouse-ear cress]
gb|AAO20063.1|  putative aspartate kinase                               372   1e-122   Oryza sativa Japonica Group [Japonica rice]
gb|AAB63104.1|  lysine-sensitive aspartate kinase                       372   1e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002466095.1|  hypothetical protein SORBIDRAFT_01g001140          372   1e-122   Sorghum bicolor [broomcorn]
ref|XP_010926856.1|  PREDICTED: aspartokinase 2, chloroplastic is...    372   2e-122   Elaeis guineensis
ref|XP_009413004.1|  PREDICTED: aspartokinase 1, chloroplastic-like     366   2e-122   
ref|XP_009121776.1|  PREDICTED: aspartokinase 1, chloroplastic          372   2e-122   Brassica rapa
ref|NP_001051906.1|  Os03g0850400                                       371   2e-122   
emb|CAA67376.1|  aspartate kinase                                       372   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682653.1|  PREDICTED: aspartokinase 1, chloroplastic is...    372   3e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008357847.1|  PREDICTED: aspartokinase 2, chloroplastic-like     371   4e-122   
ref|XP_008379052.1|  PREDICTED: aspartokinase 2, chloroplastic is...    371   4e-122   
ref|XP_006652023.1|  PREDICTED: aspartokinase 1, chloroplastic-like     371   5e-122   Oryza brachyantha
ref|XP_006408563.1|  hypothetical protein EUTSA_v10020441mg             370   7e-122   
ref|NP_001288496.1|  uncharacterized protein LOC103644325               371   7e-122   Zea mays [maize]
gb|ABO09875.1|  monofunctional aspartate kinase 1                       371   1e-121   Zea mays [maize]
ref|XP_006408564.1|  hypothetical protein EUTSA_v10020441mg             370   1e-121   Eutrema salsugineum [saltwater cress]
ref|XP_010234251.1|  PREDICTED: aspartokinase 1, chloroplastic is...    370   2e-121   
ref|XP_009359889.1|  PREDICTED: aspartokinase 1, chloroplastic-like     369   2e-121   Pyrus x bretschneideri [bai li]
ref|XP_004956005.1|  PREDICTED: aspartokinase 2, chloroplastic-like     369   3e-121   Setaria italica
ref|XP_008669985.1|  PREDICTED: aspartokinase 2, chloroplastic          369   4e-121   
ref|NP_186851.1|  aspartokinase 3                                       369   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222377.1|  PREDICTED: aspartokinase 1, chloroplastic          368   8e-121   Prunus mume [ume]
ref|XP_009411806.1|  PREDICTED: aspartokinase 2, chloroplastic-like     369   8e-121   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ28733.1|  monofunctional aspartate kinase 2                       367   1e-120   Zea mays [maize]
ref|XP_004981039.1|  PREDICTED: aspartokinase 1, chloroplastic-like     367   2e-120   Setaria italica
gb|EMS63387.1|  Aspartokinase 1, chloroplastic                          372   1e-119   Triticum urartu
gb|EMT10312.1|  Aspartokinase 1, chloroplastic                          370   1e-119   
dbj|BAA95630.1|  aspartate kinase                                       357   1e-119   Oryza sativa [red rice]
gb|EEE55936.1|  hypothetical protein OsJ_04629                          362   1e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002882151.1|  hypothetical protein ARALYDRAFT_896038             362   1e-118   Arabidopsis lyrata subsp. lyrata
emb|CDM85877.1|  unnamed protein product                                362   2e-118   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001045271.1|  Os01g0927900                                       362   3e-118   
gb|EEC72085.1|  hypothetical protein OsI_05030                          361   4e-118   Oryza sativa Indica Group [Indian rice]
gb|ABK24292.1|  unknown                                                 361   4e-118   Picea sitchensis
ref|XP_003564987.1|  PREDICTED: aspartokinase 2, chloroplastic-like     361   5e-118   Brachypodium distachyon [annual false brome]
ref|XP_006646639.1|  PREDICTED: aspartokinase 1, chloroplastic-like     359   1e-117   Oryza brachyantha
dbj|BAJ99203.1|  predicted protein                                      359   2e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004310242.1|  PREDICTED: aspartokinase 1, chloroplastic          358   3e-117   Fragaria vesca subsp. vesca
gb|KEH23492.1|  monofunctional aspartokinase                            352   6e-116   Medicago truncatula
emb|CDY06621.1|  BnaC02g13450D                                          354   3e-115   
emb|CDY20797.1|  BnaA02g09370D                                          353   5e-115   Brassica napus [oilseed rape]
gb|AES80708.2|  monofunctional aspartokinase                            352   1e-114   Medicago truncatula
ref|XP_006286781.1|  hypothetical protein CARUB_v10003334mg             350   3e-114   Capsella rubella
ref|XP_009127042.1|  PREDICTED: aspartokinase 3, chloroplastic-like     350   1e-113   Brassica rapa
ref|XP_004971149.1|  PREDICTED: aspartokinase 1, chloroplastic-like     349   2e-113   Setaria italica
ref|XP_011086875.1|  PREDICTED: aspartokinase 2, chloroplastic          348   4e-113   Sesamum indicum [beniseed]
gb|ACR35433.1|  unknown                                                 340   2e-112   Zea mays [maize]
ref|XP_002459021.1|  hypothetical protein SORBIDRAFT_03g044650          344   1e-111   Sorghum bicolor [broomcorn]
gb|KJB33203.1|  hypothetical protein B456_006G000400                    342   4e-111   Gossypium raimondii
gb|KHG14818.1|  Aspartokinase 3, chloroplastic -like protein            342   4e-111   Gossypium arboreum [tree cotton]
gb|KCW55774.1|  hypothetical protein EUGRSUZ_I01605                     342   4e-111   Eucalyptus grandis [rose gum]
ref|XP_002992028.1|  hypothetical protein SELMODRAFT_162121             339   8e-111   
gb|EYU28463.1|  hypothetical protein MIMGU_mgv1a005583mg                339   1e-110   Erythranthe guttata [common monkey flower]
ref|XP_002964498.1|  hypothetical protein SELMODRAFT_142417             338   1e-110   
ref|XP_010656844.1|  PREDICTED: aspartokinase 1, chloroplastic is...    340   3e-110   Vitis vinifera
ref|XP_003624490.1|  Aspartokinase                                      341   9e-110   
ref|XP_006287431.1|  hypothetical protein CARUB_v10000635mg             338   2e-109   
gb|KHG00746.1|  Aspartokinase 3, chloroplastic -like protein            337   2e-109   Gossypium arboreum [tree cotton]
gb|KEH25642.1|  monofunctional aspartokinase                            337   2e-109   Medicago truncatula
ref|XP_006300265.1|  hypothetical protein CARUB_v100158420mg            326   3e-109   
ref|XP_006399914.1|  hypothetical protein EUTSA_v10013157mg             335   3e-108   
emb|CDX85659.1|  BnaA02g01540D                                          332   8e-107   
emb|CDX91135.1|  BnaC02g04620D                                          330   5e-106   
emb|CDY09781.1|  BnaC09g43800D                                          327   4e-105   Brassica napus [oilseed rape]
emb|CDX69652.1|  BnaA10g20010D                                          327   4e-105   
ref|XP_007223118.1|  hypothetical protein PRUPE_ppa003770mg             324   7e-104   
gb|EMT09778.1|  Aspartokinase 1, chloroplastic                          315   5e-102   
ref|NP_001146022.1|  uncharacterized protein LOC100279553               307   7e-102   
ref|XP_006844541.1|  hypothetical protein AMTR_s00016p00169310          312   3e-100   
ref|XP_001773420.1|  predicted protein                                  313   3e-99    
gb|AFW74642.1|  hypothetical protein ZEAMMB73_320357                    309   5e-99    
gb|KJB33202.1|  hypothetical protein B456_006G000400                    308   3e-98    Gossypium raimondii
gb|KCW55775.1|  hypothetical protein EUGRSUZ_I01605                     305   1e-96    Eucalyptus grandis [rose gum]
ref|XP_001780779.1|  predicted protein                                  303   3e-96    
gb|ABF99918.1|  aspartate kinase family protein, expressed              294   8e-93    Oryza sativa Japonica Group [Japonica rice]
gb|ACN41167.1|  unknown                                                 258   3e-83    Picea sitchensis
ref|XP_008647236.1|  PREDICTED: aspartokinase 1, chloroplastic-like     260   2e-82    
gb|EMS47783.1|  Aspartokinase 1, chloroplastic                          266   2e-81    Triticum urartu
ref|XP_011399436.1|  Aspartokinase 1, chloroplastic                     257   2e-78    Auxenochlorella protothecoides
ref|XP_005846857.1|  hypothetical protein CHLNCDRAFT_134660             256   3e-78    Chlorella variabilis
ref|XP_003074218.1|  putative precursor monofunctional aspartokin...    246   3e-75    
ref|XP_001415789.1|  predicted protein                                  246   8e-75    Ostreococcus lucimarinus CCE9901
gb|KJB11755.1|  hypothetical protein B456_001G275700                    245   8e-75    Gossypium raimondii
gb|KDD72939.1|  amino acid kinase                                       247   1e-74    Helicosporidium sp. ATCC 50920
emb|CEF96568.1|  Aspartate kinase, conserved site                       246   4e-74    Ostreococcus tauri
ref|XP_002507216.1|  predicted protein                                  244   1e-73    Micromonas commoda
ref|XP_007515683.1|  aspartate kinase                                   245   4e-73    Bathycoccus prasinos
gb|KDO43561.1|  hypothetical protein CISIN_1g008621mg                   239   2e-72    Citrus sinensis [apfelsine]
gb|KJB11757.1|  hypothetical protein B456_001G275700                    238   1e-71    Gossypium raimondii
ref|XP_005650639.1|  aspartate kinase                                   237   3e-71    Coccomyxa subellipsoidea C-169
gb|EKD81471.1|  hypothetical protein ACD_39C01793G0002                  234   3e-70    uncultured bacterium
gb|AFW74641.1|  hypothetical protein ZEAMMB73_320357                    233   1e-69    
ref|XP_009388316.1|  PREDICTED: aspartokinase 2, chloroplastic-like     229   4e-68    
ref|WP_013968408.1|  aspartate kinase                                   228   9e-68    Treponema caldarium
ref|XP_001698576.1|  aspartate kinase                                   229   2e-67    Chlamydomonas reinhardtii
gb|ABC46704.1|  aspartokinase                                           215   9e-67    Arachis hypogaea [goober]
ref|XP_002947347.1|  hypothetical protein VOLCADRAFT_87637              228   1e-66    Volvox carteri f. nagariensis
ref|WP_010253784.1|  aspartate kinase                                   224   2e-66    Treponema primitia
ref|XP_003059042.1|  predicted protein                                  226   5e-66    Micromonas pusilla CCMP1545
ref|XP_002459732.1|  hypothetical protein SORBIDRAFT_02g009570          222   2e-65    
tpg|DAA39409.1|  TPA: hypothetical protein ZEAMMB73_358951              211   1e-64    
ref|WP_015707281.1|  aspartate kinase                                   219   2e-64    Treponema primitia
gb|EWM28259.1|  aspartate kinase                                        221   3e-64    Nannochloropsis gaditana
ref|WP_015710697.1|  aspartate kinase                                   217   1e-63    Treponema azotonutricium
ref|XP_005707902.1|  aspartate kinase                                   210   2e-60    Galdieria sulphuraria
ref|XP_002182416.1|  predicted protein                                  207   4e-59    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005534774.1|  aspartate kinase                                   208   4e-59    Cyanidioschyzon merolae strain 10D
ref|XP_009388108.1|  PREDICTED: aspartokinase 3, chloroplastic-like     195   4e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009035261.1|  hypothetical protein AURANDRAFT_52842              206   5e-59    Aureococcus anophagefferens
ref|WP_013702193.1|  aspartate kinase                                   199   5e-57    Treponema succinifaciens
ref|WP_016525852.1|  aspartate kinase                                   198   2e-56    Treponema maltophilum
ref|XP_002292078.1|  predicted protein                                  201   2e-56    Thalassiosira pseudonana CCMP1335
ref|WP_027728545.1|  aspartate kinase                                   194   4e-55    Treponema sp. C6A8
ref|WP_013758817.1|  aspartate kinase                                   193   1e-54    Treponema brennaborense
gb|ERF61453.1|  amino acid kinase family protein                        192   3e-54    Treponema socranskii subsp. socranskii VPI DR56BR1116 = ATCC 35536
ref|WP_038080481.1|  aspartate kinase                                   192   3e-54    Treponema socranskii
ref|WP_016521831.1|  aspartate kinase                                   192   3e-54    
ref|WP_009104632.1|  aspartate kinase                                   191   5e-54    Treponema sp. JC4
ref|WP_022933427.1|  aspartate kinase                                   191   1e-53    Treponema bryantii
gb|EMS60633.1|  hypothetical protein TRIUR3_25086                       184   6e-53    Triticum urartu
ref|WP_004266577.1|  aspartate kinase                                   188   7e-53    Treponema saccharophilum
ref|XP_005713499.1|  unnamed protein product                            180   9e-49    Chondrus crispus [carageen]
ref|XP_003884193.1|  Aspartokinase/homoserine dehydrogenase, related    177   3e-48    Neospora caninum Liverpool
gb|KFH09919.1|  aspartokinase                                           170   8e-47    Toxoplasma gondii MAS
gb|KFG51953.1|  aspartokinase                                           170   1e-46    Toxoplasma gondii FOU
ref|XP_008882085.1|  aspartokinase                                      171   4e-46    
ref|XP_005773177.1|  hypothetical protein EMIHUDRAFT_75153              170   2e-45    Emiliania huxleyi CCMP1516
ref|XP_005786070.1|  hypothetical protein EMIHUDRAFT_71644              170   2e-45    Emiliania huxleyi CCMP1516
gb|EPT27208.1|  aspartokinase                                           169   2e-45    Toxoplasma gondii ME49
ref|XP_002366362.1|  aspartate kinase, putative                         169   2e-45    
gb|EPR62313.1|  aspartokinase                                           169   2e-45    Toxoplasma gondii GT1
ref|WP_028992829.1|  MULTISPECIES: hypothetical protein                 168   3e-45    
ref|WP_031497328.1|  aspartate kinase                                   167   5e-45    Bryobacter aggregatus
ref|WP_013313356.1|  aspartate kinase                                   166   1e-44    Spirochaeta thermophila
ref|WP_041908852.1|  hypothetical protein                               166   2e-44    
ref|WP_014624232.1|  aspartate kinase                                   164   1e-43    Spirochaeta thermophila
ref|WP_012499894.1|  aspartate kinase                                   164   2e-43    Chloroherpeton thalassium
ref|WP_035399852.1|  aspartate kinase                                   163   2e-43    
ref|WP_042497724.1|  aspartate kinase                                   161   1e-42    Algibacter lectus
ref|WP_042504650.1|  aspartate kinase                                   161   1e-42    Algibacter lectus
ref|WP_034045835.1|  aspartate kinase                                   161   2e-42    Flaviramulus ichthyoenteri
ref|WP_033369986.1|  aspartate kinase                                   160   4e-42    
ref|WP_027138278.1|  aspartate kinase                                   158   2e-41    Gaetbulibacter saemankumensis
dbj|GAL87912.1|  aspartokinase                                          157   3e-41    Jejuia pallidilutea
ref|WP_041856414.1|  aspartate kinase                                   157   3e-41    
gb|EEC76544.1|  hypothetical protein OsI_14340                          155   3e-41    Oryza sativa Indica Group [Indian rice]
ref|WP_039745565.1|  aspartate kinase                                   157   3e-41    
gb|ABF40484.1|  aspartate kinase                                        157   4e-41    Candidatus Koribacter versatilis Ellin345
ref|WP_036120732.1|  aspartate kinase                                   155   2e-40    Mangrovimonas yunxiaonensis
ref|WP_041975355.1|  hypothetical protein                               155   4e-40    Pyrinomonas methylaliphatogenes
ref|WP_020715172.1|  aspartate kinase                                   155   4e-40    Acidobacteriaceae bacterium KBS 89
ref|WP_019385985.1|  hypothetical protein                               154   5e-40    Arenitalea lutea
ref|WP_016193944.1|  Aspartokinase                                      154   7e-40    Arcticibacter svalbardensis
tpg|DAA56007.1|  TPA: hypothetical protein ZEAMMB73_791722              153   1e-39    
ref|WP_044637374.1|  aspartate kinase                                   153   1e-39    Siansivirga zeaxanthinifaciens
ref|WP_011688615.1|  aspartate kinase                                   153   1e-39    Candidatus Solibacter usitatus
ref|WP_044401737.1|  aspartate kinase                                   153   1e-39    Lacinutrix sp. Hel_I_90
tpg|DAA56008.1|  TPA: hypothetical protein ZEAMMB73_791722              153   2e-39    
tpg|DAA39410.1|  TPA: hypothetical protein ZEAMMB73_358951              144   2e-39    
ref|WP_008823040.1|  aspartate kinase                                   152   2e-39    
ref|WP_027127596.1|  aspartate kinase                                   152   2e-39    
ref|WP_014266852.1|  aspartate kinase                                   152   4e-39    
ref|WP_038532401.1|  aspartate kinase                                   151   5e-39    
ref|XP_002459733.1|  hypothetical protein SORBIDRAFT_02g009575          143   5e-39    
ref|WP_028896097.1|  aspartate kinase                                   151   7e-39    
ref|XP_010926857.1|  PREDICTED: aspartokinase 2, chloroplastic is...    152   7e-39    
ref|WP_044633084.1|  aspartate kinase                                   151   8e-39    
ref|WP_021909792.1|  lysine-sensitive aspartokinase III                 151   8e-39    
ref|WP_044626989.1|  aspartate kinase                                   150   1e-38    
ref|WP_028290241.1|  aspartate kinase                                   150   1e-38    
ref|WP_028608180.1|  aspartate kinase                                   150   2e-38    
ref|WP_009346419.1|  aspartate kinase                                   149   2e-38    
ref|WP_010136666.1|  aspartate kinase                                   150   2e-38    
gb|EKD92513.1|  hypothetical protein ACD_28C00411G0003                  150   2e-38    
ref|WP_015896597.1|  aspartate kinase                                   149   3e-38    
ref|WP_041597832.1|  aspartate kinase                                   149   3e-38    
ref|WP_028282328.1|  aspartate kinase                                   149   3e-38    
ref|WP_008627444.1|  aspartate kinase                                   149   4e-38    
ref|WP_020719229.1|  hypothetical protein                               149   4e-38    
ref|WP_019989196.1|  aspartate kinase                                   149   4e-38    
ref|WP_021847564.1|  aspartokinase                                      145   4e-38    
gb|ADW70011.1|  aspartate kinase                                        149   5e-38    
ref|WP_044194538.1|  hypothetical protein                               149   5e-38    
ref|XP_004348870.2|  aspartokinase                                      150   6e-38    
ref|WP_009580619.1|  Aspartokinase                                      149   6e-38    
ref|WP_022218432.1|  aspartokinase                                      145   6e-38    
ref|WP_008622278.1|  aspartate kinase                                   148   6e-38    
ref|WP_021980605.1|  aspartokinase                                      148   7e-38    
ref|WP_018341575.1|  aspartate kinase                                   148   8e-38    
ref|WP_013751000.1|  aspartate kinase                                   148   8e-38    
ref|WP_035177991.1|  aspartate kinase                                   148   1e-37    
ref|WP_007368775.1|  aspartate kinase                                   147   1e-37    
ref|WP_004352395.1|  aspartate kinase                                   147   1e-37    
ref|WP_009010472.1|  aspartate kinase                                   147   1e-37    
ref|WP_036894112.1|  aspartate kinase                                   147   2e-37    
ref|WP_028908783.1|  aspartate kinase                                   147   2e-37    
gb|KGF39695.1|  aspartate kinase                                        147   2e-37    
gb|ADV81692.1|  aspartate kinase                                        147   2e-37    
ref|WP_041586414.1|  aspartate kinase                                   147   2e-37    
ref|WP_013869823.1|  aspartate kinase                                   147   2e-37    
ref|WP_009435032.1|  aspartate kinase                                   147   2e-37    
ref|WP_035335568.1|  aspartate kinase                                   147   2e-37    
ref|WP_026898411.1|  aspartate kinase                                   147   2e-37    
ref|WP_004381879.1|  aspartate kinase                                   147   3e-37    
ref|WP_018911508.1|  aspartate kinase                                   146   3e-37    
ref|XP_006392260.1|  hypothetical protein EUTSA_v10024044mg             142   3e-37    
ref|WP_044001665.1|  aspartate kinase                                   146   3e-37    
ref|WP_022481006.1|  lysine-sensitive aspartokinase III                 147   3e-37    
ref|WP_024267275.1|  Aspartokinase                                      146   3e-37    
ref|WP_028974007.1|  hypothetical protein                               146   3e-37    
ref|WP_036860440.1|  aspartate kinase                                   146   3e-37    
dbj|GAK91704.1|  aspartokinase                                          146   3e-37    
ref|WP_035348744.1|  aspartate kinase                                   147   3e-37    
ref|WP_010931789.1|  aspartate kinase                                   147   3e-37    
ref|WP_004289964.1|  MULTISPECIES: aspartate kinase                     146   4e-37    
ref|WP_021990671.1|  aspartokinase                                      146   4e-37    
ref|WP_011363031.1|  aspartate kinase                                   146   4e-37    
ref|WP_043520109.1|  aspartate kinase                                   146   4e-37    
ref|WP_022104540.1|  aspartokinase                                      146   5e-37    
ref|WP_022163052.1|  aspartokinase                                      146   5e-37    
gb|KJF41876.1|  aspartate kinase                                        146   5e-37    
ref|WP_022019939.1|  aspartokinase                                      146   5e-37    
ref|WP_012506710.1|  aspartate kinase                                   146   6e-37    
ref|WP_009121600.1|  aspartate kinase                                   145   6e-37    
dbj|GAL01950.1|  aspartokinase                                          145   6e-37    
ref|WP_005652628.1|  aspartate kinase                                   145   6e-37    
ref|WP_022276624.1|  aspartokinase                                      143   6e-37    
ref|WP_009184147.1|  aspartate kinase                                   145   7e-37    
ref|WP_026314890.1|  aspartate kinase                                   145   7e-37    
ref|WP_026445100.1|  aspartate kinase                                   146   7e-37    
ref|WP_004360361.1|  aspartate kinase                                   145   7e-37    
ref|WP_012794438.1|  aspartate kinase                                   145   8e-37    
gb|ADK97310.1|  amino acid kinase family                                145   8e-37    
ref|WP_044046166.1|  aspartate kinase                                   145   8e-37    
ref|WP_008764912.1|  MULTISPECIES: aspartate kinase                     145   9e-37    
ref|WP_036578931.1|  aspartate kinase                                   145   9e-37    
ref|WP_025277479.1|  aspartate kinase                                   145   9e-37    
gb|ETS98179.1|  amino acid kinase family protein                        145   9e-37    
ref|WP_008762401.1|  aspartate kinase                                   145   9e-37    
ref|WP_036923898.1|  aspartate kinase                                   145   9e-37    
ref|WP_013454628.1|  aspartate kinase                                   145   1e-36    
gb|ACF12392.1|  aspartate kinase                                        145   1e-36    
ref|WP_024989324.1|  aspartate kinase                                   145   1e-36    
ref|WP_022121798.1|  aspartokinase                                      145   1e-36    
ref|WP_011587059.1|  aspartate kinase                                   145   1e-36    
ref|WP_041466196.1|  aspartate kinase                                   145   1e-36    
ref|WP_014680179.1|  aspartate kinase                                   144   1e-36    
ref|WP_006846458.1|  aspartate kinase                                   144   1e-36    
ref|WP_014454692.1|  aspartate kinase                                   145   1e-36    
ref|WP_006795059.1|  aspartate kinase                                   144   2e-36    
ref|WP_027884863.1|  aspartate kinase                                   144   2e-36    
ref|WP_019208829.1|  aspartate kinase                                   144   2e-36    
ref|WP_018127828.1|  hypothetical protein                               144   2e-36    
ref|WP_039470980.1|  aspartate kinase                                   144   2e-36    
ref|WP_022149218.1|  aspartokinase                                      144   2e-36    
ref|WP_022402029.1|  aspartokinase                                      141   2e-36    
ref|WP_006365733.1|  aspartate kinase                                   144   2e-36    
ref|WP_044653154.1|  aspartate kinase                                   144   2e-36    
ref|WP_010423559.1|  aspartate kinase                                   144   2e-36    
ref|WP_029464595.1|  aspartate kinase                                   144   2e-36    
ref|WP_015363880.1|  aspartokinase                                      144   2e-36    
ref|WP_020401930.1|  hypothetical protein                               144   2e-36    
ref|WP_036873830.1|  MULTISPECIES: aspartate kinase                     144   2e-36    
gb|ERT58063.1|  amino acid kinase family protein                        144   2e-36    
ref|WP_024568822.1|  aspartate kinase                                   144   2e-36    
ref|WP_008246079.1|  aspartate kinase                                   144   2e-36    
ref|WP_009437609.1|  amino acid kinase family protein                   144   3e-36    
ref|WP_034848862.1|  aspartate kinase                                   144   3e-36    
ref|WP_015808149.1|  aspartate kinase                                   144   3e-36    
ref|WP_025076188.1|  aspartate kinase                                   144   3e-36    
ref|WP_021348996.1|  aspartate kinase                                   144   3e-36    
ref|WP_038558226.1|  aspartate kinase                                   144   3e-36    
ref|WP_025839701.1|  aspartate kinase                                   144   3e-36    
ref|WP_008510364.1|  aspartate kinase                                   144   3e-36    
ref|WP_034532896.1|  aspartate kinase                                   138   3e-36    
ref|WP_039052857.1|  aspartate kinase                                   144   3e-36    
ref|WP_007665003.1|  MULTISPECIES: aspartate kinase                     144   3e-36    
ref|WP_012241869.1|  aspartate kinase                                   144   3e-36    
ref|WP_025143515.1|  aspartate kinase                                   144   3e-36    
ref|WP_022054382.1|  aspartokinase                                      144   3e-36    
ref|WP_004313659.1|  MULTISPECIES: aspartate kinase                     144   3e-36    
ref|WP_021278371.1|  putative aspartate kinase, monofunctional class    144   3e-36    
ref|WP_029275214.1|  aspartate kinase                                   144   3e-36    
ref|WP_026763105.1|  aspartate kinase                                   144   4e-36    
ref|WP_024993495.1|  aspartate kinase                                   143   4e-36    
ref|WP_008025480.1|  aspartate kinase                                   143   4e-36    
ref|WP_005037511.1|  aspartate kinase                                   144   4e-36    
ref|WP_022040193.1|  aspartokinase                                      143   4e-36    
emb|CDA83684.1|  aspartokinase                                          144   4e-36    
ref|WP_010528812.1|  aspartate kinase                                   143   4e-36    
ref|WP_036882607.1|  aspartate kinase                                   143   4e-36    
ref|WP_010151816.1|  aspartate kinase                                   144   4e-36    
ref|WP_044165132.1|  aspartate kinase                                   143   4e-36    
ref|WP_029033274.1|  aspartate kinase                                   143   4e-36    
ref|WP_013616984.1|  aspartate kinase                                   143   4e-36    
ref|WP_021947139.1|  aspartokinase                                      143   5e-36    
ref|WP_007561801.1|  aspartate kinase                                   143   5e-36    
ref|WP_036862268.1|  aspartate kinase                                   143   5e-36    
ref|WP_022111045.1|  aspartokinase                                      143   5e-36    
ref|WP_016776018.1|  aspartate kinase                                   143   5e-36    
ref|WP_012509435.1|  aspartate kinase                                   143   6e-36    
ref|WP_005678111.1|  MULTISPECIES: aspartate kinase                     143   6e-36    
ref|WP_044514329.1|  aspartate kinase                                   143   6e-36    
ref|WP_039876725.1|  aspartate kinase                                   143   6e-36    
ref|WP_024991243.1|  aspartate kinase                                   143   6e-36    
gb|ERK00008.1|  amino acid kinase family protein                        143   6e-36    
ref|WP_004297043.1|  aspartate kinase                                   143   6e-36    
ref|WP_007748065.1|  aspartate kinase                                   143   6e-36    
ref|WP_007766339.1|  aspartate kinase                                   143   6e-36    
ref|WP_006744371.1|  aspartate kinase                                   143   7e-36    
ref|WP_027952637.1|  aspartate kinase                                   143   7e-36    
ref|WP_022252402.1|  aspartokinase                                      143   7e-36    
ref|WP_022384596.1|  aspartokinase                                      142   7e-36    
ref|WP_022284655.1|  aspartokinase                                      143   7e-36    
ref|WP_004304027.1|  MULTISPECIES: aspartate kinase                     142   7e-36    
ref|WP_007172964.1|  aspartate kinase                                   142   7e-36    
ref|WP_012930090.1|  aspartate kinase                                   142   8e-36    
gb|ETZ22217.1|  aspartate kinase                                        142   9e-36    
ref|WP_020708762.1|  aspartate kinase                                   143   9e-36    
ref|WP_010538616.1|  MULTISPECIES: aspartate kinase                     142   9e-36    
ref|WP_022326880.1|  aspartokinase                                      142   1e-35    
ref|WP_024996122.1|  aspartate kinase                                   142   1e-35    
ref|WP_018630016.1|  aspartate kinase                                   142   1e-35    
ref|WP_037443374.1|  aspartate kinase                                   142   1e-35    
ref|WP_002697509.1|  aspartate kinase                                   142   1e-35    
ref|WP_009000030.1|  aspartate kinase                                   142   1e-35    
ref|WP_005930909.1|  MULTISPECIES: aspartate kinase                     142   1e-35    
ref|WP_005841213.1|  MULTISPECIES: aspartate kinase                     142   1e-35    
ref|WP_007854227.1|  aspartate kinase                                   142   1e-35    
ref|WP_019035776.1|  aspartate kinase                                   142   1e-35    
ref|WP_002987190.1|  MULTISPECIES: aspartate kinase                     142   1e-35    
ref|WP_007899600.1|  aspartate kinase                                   142   1e-35    
ref|WP_019949086.1|  hypothetical protein                               142   1e-35    
ref|WP_025799894.1|  aspartate kinase                                   142   1e-35    
ref|WP_026474688.1|  aspartate kinase                                   142   1e-35    
ref|WP_008141737.1|  MULTISPECIES: aspartate kinase                     142   1e-35    
gb|KIG16894.1|  Aspartokinase                                           142   1e-35    
ref|WP_029328896.1|  aspartate kinase                                   142   1e-35    
ref|WP_022429650.1|  aspartokinase                                      142   1e-35    
ref|WP_021266646.1|  putative aspartate kinase, monofunctional class    142   1e-35    
ref|WP_022232574.1|  aspartokinase                                      142   1e-35    
ref|WP_021971993.1|  aspartokinase                                      142   1e-35    
ref|WP_007209749.1|  MULTISPECIES: aspartate kinase                     142   1e-35    
ref|WP_044532489.1|  aspartate kinase                                   142   2e-35    
ref|WP_036792454.1|  aspartate kinase                                   142   2e-35    
ref|WP_036867097.1|  aspartate kinase                                   142   2e-35    
ref|WP_014710013.1|  aspartate kinase                                   142   2e-35    
ref|WP_035327079.1|  aspartate kinase                                   142   2e-35    
ref|WP_028904654.1|  aspartate kinase                                   142   2e-35    
ref|WP_022391971.1|  MULTISPECIES: aspartokinase                        142   2e-35    
ref|WP_021853136.1|  aspartokinase                                      142   2e-35    
ref|WP_040294729.1|  hypothetical protein                               142   2e-35    
ref|WP_027325746.1|  aspartate kinase                                   142   2e-35    
ref|WP_025816900.1|  aspartate kinase                                   142   2e-35    
ref|WP_008446419.1|  aspartate kinase                                   142   2e-35    
ref|WP_044013184.1|  aspartate kinase                                   141   2e-35    
ref|WP_006969206.1|  aspartate kinase                                   142   2e-35    
ref|WP_041884567.1|  aspartate kinase                                   141   2e-35    
ref|WP_021896753.1|  aspartokinase                                      141   2e-35    
gb|EHB91783.1|  hypothetical protein HMPREF9450_01832                   141   2e-35    
ref|WP_004355471.1|  aspartate kinase                                   141   2e-35    
ref|WP_005831418.1|  MULTISPECIES: aspartate kinase                     141   2e-35    
ref|WP_016274338.1|  aspartate kinase                                   141   2e-35    
ref|WP_021668361.1|  amino acid kinase family protein                   141   2e-35    
ref|WP_038598969.1|  aspartate kinase                                   141   2e-35    
ref|WP_009161488.1|  putative aspartate kinase III                      141   2e-35    
gb|AFL89503.1|  aspartate kinase                                        142   2e-35    
ref|WP_018618634.1|  aspartate kinase                                   141   2e-35    
ref|WP_016277830.1|  MULTISPECIES: aspartate kinase                     141   2e-35    
ref|WP_041593403.1|  aspartate kinase                                   142   2e-35    
ref|WP_021646265.1|  amino acid kinase family protein                   141   2e-35    
ref|WP_009124181.1|  aspartate kinase                                   141   2e-35    
ref|WP_034543630.1|  aspartate kinase                                   141   2e-35    
ref|WP_022129463.1|  aspartokinase                                      141   3e-35    
ref|WP_013547450.1|  aspartate kinase                                   141   3e-35    
ref|WP_027201593.1|  aspartate kinase                                   141   3e-35    
ref|WP_021826519.1|  amino acid kinase family protein                   141   3e-35    
ref|WP_020606837.1|  aspartate kinase                                   141   3e-35    
ref|WP_004348840.1|  aspartate kinase                                   141   3e-35    
ref|WP_008582288.1|  aspartate kinase                                   141   3e-35    



>ref|XP_011097258.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Sesamum 
indicum]
Length=556

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/213 (95%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
            + T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+TRDMSEAVLT
Sbjct  331  LLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRTRDMSEAVLT  390

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS
Sbjct  391  SIVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  450

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQ
Sbjct  451  RELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQ  510

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVNDSEAEQCV ALHSAFFE
Sbjct  511  MISQGASKVNISLIVNDSEAEQCVRALHSAFFE  543



>ref|XP_004143759.1| PREDICTED: aspartokinase 2, chloroplastic-like [Cucumis sativus]
Length=474

 Score =   400 bits (1027),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTS
Sbjct  245  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  305  IVLKRNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  365  ELIQQASELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  424

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  425  ISQGASKVNISLIVNDNEAEQCVRALHSAFFE  456



>ref|XP_011097259.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Sesamum 
indicum]
Length=554

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 205/213 (96%), Gaps = 2/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
            + T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+TRDMSEAVLT
Sbjct  331  LLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRTRDMSEAVLT  390

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS
Sbjct  391  SIVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  450

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQ
Sbjct  451  RELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQ  508

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVNDSEAEQCV ALHSAFFE
Sbjct  509  MISQGASKVNISLIVNDSEAEQCVRALHSAFFE  541



>gb|EYU34829.1| hypothetical protein MIMGU_mgv1a003795mg [Erythranthe guttata]
Length=563

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/212 (94%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+ RDMSEA+LTS
Sbjct  335  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRRRDMSEAILTS  394

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  395  IVLKRNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  454

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL  NGVNVQM
Sbjct  455  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRANGVNVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH AFFE
Sbjct  515  ISQGASKVNISLIVNDSEAEQCVRALHFAFFE  546



>gb|KJB11754.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=364

 Score =   395 bits (1016),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  145  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTS  204

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR
Sbjct  205  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSR  264

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  265  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  324

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  325  ISQGASKVNISLIVHDTEAEQCVRALHSTFFE  356



>ref|XP_010250546.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=578

 Score =   402 bits (1033),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 205/237 (86%), Positives = 214/237 (90%), Gaps = 3/237 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK+RDMSEAVLTS
Sbjct  340  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKSRDMSEAVLTS  399

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  400  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  459

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  460  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  519

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEs---dlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISLIVNDSEAEQCV ALH  FFE          S+  S+NGS +  P+
Sbjct  520  ISQGASKVNISLIVNDSEAEQCVRALHYTFFERGVLSDVSSTSNSLSENGSPTPLPD  576



>ref|XP_009607339.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
tomentosiformis]
Length=554

 Score =   401 bits (1031),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  322  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  381

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  382  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  441

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  442  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  501

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  502  ISQGASKVNISLIVNDSEAEQCVRALHKTFFE  533



>ref|XP_010096037.1| Aspartokinase 3 [Morus notabilis]
 gb|EXB62843.1| Aspartokinase 3 [Morus notabilis]
Length=552

 Score =   401 bits (1030),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYNPKAPGTLIT+TRDMS+AVLTS
Sbjct  322  LTFDEAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNPKAPGTLITRTRDMSKAVLTS  381

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  382  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  441

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL TNGVNVQM
Sbjct  442  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQM  501

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALH AFFE
Sbjct  502  ISQGASKVNISLIVNDDEAEQCVRALHQAFFE  533



>ref|XP_009781447.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
sylvestris]
Length=561

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  325  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  384

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  385  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  444

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+NVQM
Sbjct  445  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGINVQM  504

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  505  ISQGASKVNISLIVNDSEAEQCVRALHKTFFE  536



>ref|XP_008465546.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Cucumis 
melo]
Length=566

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLT
Sbjct  330  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLT  389

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  390  SIVLKRNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWS  449

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQASELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQ
Sbjct  450  RELIQQASELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQ  509

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  510  MISQGASKVNISLIVNDNEAEQCVRALHSAFFE  542



>gb|KGN51126.1| hypothetical protein Csa_5G457770 [Cucumis sativus]
Length=560

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLT
Sbjct  330  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLT  389

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  390  SIVLKRNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWS  449

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQASELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQ
Sbjct  450  RELIQQASELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQ  509

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  510  MISQGASKVNISLIVNDNEAEQCVRALHSAFFE  542



>gb|KHN00623.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=409

 Score =   394 bits (1013),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  177  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  236

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  237  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  296

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T GV VQM
Sbjct  297  ELIQQASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGVTVQM  356

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  357  ISQGASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  404



>ref|XP_004164561.1| PREDICTED: aspartokinase 3, chloroplastic-like, partial [Cucumis 
sativus]
Length=334

 Score =   390 bits (1002),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 202/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTS
Sbjct  107  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTS  166

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  167  IVLKRNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSR  226

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  227  ELIQQ--ELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  284

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  285  ISQGASKVNISLIVNDNEAEQCVRALHSAFFE  316



>ref|XP_010316459.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
lycopersicum]
Length=567

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTS
Sbjct  328  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  388  IVLKRNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQM
Sbjct  448  ELIQQASELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMRTNGVNVQM  507

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  508  ISQGASKVNISLIVNDSEAEQCVRALHHSFFE  539



>emb|CBI21283.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   394 bits (1012),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 215/234 (92%), Gaps = 1/234 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  245  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRNAPGTLITRTRDMSKAVLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  305  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGN+Q SSLILEKAFHVL T GVNVQM
Sbjct  365  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNIQMSSLILEKAFHVLRTKGVNVQM  424

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISLIVND +AE+CV ALHSAFFE  LS++  + +S NGS+S F N
Sbjct  425  ISQGASKVNISLIVNDDQAEKCVRALHSAFFE-SLSEVDRECQSDNGSTSAFSN  477



>ref|XP_006364050.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
tuberosum]
Length=569

 Score =   397 bits (1019),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 197/212 (93%), Positives = 204/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTS
Sbjct  328  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  388  IVLKRNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQM
Sbjct  448  ELIQQASELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMHTNGVNVQM  507

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  508  ISQGASKVNISLIVNDSEAEQCVRALHHSFFE  539



>gb|KJB11756.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=529

 Score =   395 bits (1015),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  310  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTS  369

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR
Sbjct  370  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSR  429

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  430  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  489

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  490  ISQGASKVNISLIVHDTEAEQCVRALHSTFFE  521



>ref|XP_009607337.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 202/215 (94%), Gaps = 3/215 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  322  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  381

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKL  405
            IVLKRNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKL
Sbjct  382  IVLKRNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKL  441

Query  404  WSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVN  225
            WSR+LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVN
Sbjct  442  WSRELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVN  501

Query  224  VQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            VQMISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  502  VQMISQGASKVNISLIVNDSEAEQCVRALHKTFFE  536



>ref|XP_011006143.1| PREDICTED: aspartokinase 2, chloroplastic-like [Populus euphratica]
Length=324

 Score =   387 bits (995),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  90   LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTS  149

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  150  IVLKRNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  209

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQM
Sbjct  210  ELIQQASELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQM  269

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  270  ISQGASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  317



>ref|XP_004304561.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468210.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
Length=562

 Score =   396 bits (1017),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 203/212 (96%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGT+IT+ RDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPEAPGTVITRARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQ+SSLILEKAFHVL TNGVNVQM
Sbjct  456  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQKSSLILEKAFHVLRTNGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAEQCV ALH AFF+
Sbjct  516  ISQGASKVNISLVVNDNEAEQCVRALHQAFFD  547



>ref|XP_011024774.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011024776.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
Length=557

 Score =   396 bits (1017),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 202/230 (88%), Positives = 213/230 (93%), Gaps = 0/230 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTLITRARDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  387  IVLKRNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNV RSSLILEKAFHVL T GVNVQM
Sbjct  447  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVHRSSLILEKAFHVLRTLGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  66
            ISQGASKVNISLIVND EAEQCV++LH AFFE+D+S+L  +  S NGS+S
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVKSLHKAFFETDISELEWECVSGNGSAS  556



>ref|XP_006574470.1| PREDICTED: precursor monofunctional aspartokinase isoform X1 
[Glycine max]
Length=564

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  392  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T GV VQM
Sbjct  452  ELIQQASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGVTVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  512  ISQGASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  559



>ref|XP_009781445.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
sylvestris]
Length=564

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 202/215 (94%), Gaps = 3/215 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  325  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  384

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKL  405
            IVLKRNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKL
Sbjct  385  IVLKRNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKL  444

Query  404  WSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVN  225
            WSR+LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+N
Sbjct  445  WSRELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGIN  504

Query  224  VQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            VQMISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  505  VQMISQGASKVNISLIVNDSEAEQCVRALHKTFFE  539



>gb|KJB11753.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=558

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  459  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  518

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  519  ISQGASKVNISLIVHDTEAEQCVRALHSTFFE  550



>ref|XP_002301756.2| hypothetical protein POPTR_0002s23800g [Populus trichocarpa]
 gb|EEE81029.2| hypothetical protein POPTR_0002s23800g [Populus trichocarpa]
Length=557

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 202/230 (88%), Positives = 213/230 (93%), Gaps = 0/230 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTLITRARDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  387  IVLKRNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQ RSIISLIGNVQRSSLILEKAFHVL T GVNVQM
Sbjct  447  ELIQQASELDHVVEELEKIAVVNLLQRRSIISLIGNVQRSSLILEKAFHVLRTLGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  66
            ISQGASKVNISLIVND EAEQCV++LH AFFE+D+S+L  +  S NGS+S
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVKSLHKAFFETDISELEWECVSGNGSAS  556



>ref|XP_010660689.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Vitis vinifera]
Length=569

 Score =   394 bits (1012),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 215/234 (92%), Gaps = 1/234 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  335  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRNAPGTLITRTRDMSKAVLTS  394

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  395  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  454

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGN+Q SSLILEKAFHVL T GVNVQM
Sbjct  455  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNIQMSSLILEKAFHVLRTKGVNVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISLIVND +AE+CV ALHSAFFE  LS++  + +S NGS+S F N
Sbjct  515  ISQGASKVNISLIVNDDQAEKCVRALHSAFFE-SLSEVDRECQSDNGSTSAFSN  567



>gb|KDP41849.1| hypothetical protein JCGZ_26867 [Jatropha curcas]
Length=463

 Score =   390 bits (1003),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 199/212 (94%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDM +AVLTS
Sbjct  245  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRARDMRKAVLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK+WSR
Sbjct  305  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKVWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL TNGVNVQM
Sbjct  365  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQM  424

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV +LH  FFE
Sbjct  425  ISQGASKVNISLIVNDDEAEQCVRSLHKTFFE  456



>ref|XP_007032011.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032012.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032015.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02937.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02938.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02941.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
Length=566

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  338  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRFRDMSKAVLTS  397

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  398  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  457

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQM
Sbjct  458  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFRVLRTNGVNVQM  517

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D EAEQCV ALHSAFFE
Sbjct  518  ISQGASKVNISLIVHDDEAEQCVRALHSAFFE  549



>ref|XP_010250548.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=576

 Score =   394 bits (1012),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 212/237 (89%), Gaps = 5/237 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK+RDMSEAVLTS
Sbjct  340  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKSRDMSEAVLTS  399

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  400  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  459

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  460  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  517

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEs---dlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISLIVNDSEAEQCV ALH  FFE          S+  S+NGS +  P+
Sbjct  518  ISQGASKVNISLIVNDSEAEQCVRALHYTFFERGVLSDVSSTSNSLSENGSPTPLPD  574



>ref|XP_009607340.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
tomentosiformis]
Length=552

 Score =   393 bits (1010),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 196/212 (92%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  322  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  381

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  382  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  441

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  442  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  499

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  500  ISQGASKVNISLIVNDSEAEQCVRALHKTFFE  531



>ref|XP_007215316.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
 gb|EMJ16515.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
Length=565

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQM
Sbjct  459  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTNGVNVQM  518

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAEQCV ALH AFFE
Sbjct  519  ISQGASKVNISLVVNDNEAEQCVRALHQAFFE  550



>ref|XP_008231031.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Prunus 
mume]
Length=565

 Score =   393 bits (1009),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQM
Sbjct  459  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTNGVNVQM  518

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAEQCV ALH AFFE
Sbjct  519  ISQGASKVNISLVVNDNEAEQCVRALHQAFFE  550



>ref|XP_009781448.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
sylvestris]
Length=559

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  325  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  384

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  385  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  444

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+NVQM
Sbjct  445  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGINVQM  502

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  503  ISQGASKVNISLIVNDSEAEQCVRALHKTFFE  534



>ref|XP_008465552.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Cucumis 
melo]
Length=564

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 2/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLT
Sbjct  330  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLT  389

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  390  SIVLKRNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWS  449

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQ
Sbjct  450  RELIQQ--ELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQ  507

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  508  MISQGASKVNISLIVNDNEAEQCVRALHSAFFE  540



>gb|KJB33204.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=367

 Score =   385 bits (988),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTS
Sbjct  145  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTS  204

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  205  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  264

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  265  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  322

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAE+CV ALHS+FFE
Sbjct  323  ISQGASKVNISLVVNDNEAEECVRALHSSFFE  354



>ref|XP_007151723.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
 gb|ESW23717.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
Length=545

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+A+LT
Sbjct  325  FLTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAILT  384

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  385  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  444

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQASELDHVVEELEKIAVVNLLQ RSIISLIGNVQ+SSLILEKAF VL T GV VQ
Sbjct  445  RELIQQASELDHVVEELEKIAVVNLLQSRSIISLIGNVQKSSLILEKAFRVLRTLGVTVQ  504

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISL+VNDSEAEQCV ALHS FFE
Sbjct  505  MISQGASKVNISLVVNDSEAEQCVRALHSVFFE  537



>ref|XP_002321084.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
 gb|EEE99399.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
Length=561

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IV+KRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  387  IVMKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL   G+NVQM
Sbjct  447  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLHIKGINVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNG  75
            ISQGASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NG
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNG  553



>emb|CDP16734.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/229 (89%), Positives = 211/229 (92%), Gaps = 2/229 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLIT+ RDMSEAVLT
Sbjct  336  FLTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPKAPGTLITRARDMSEAVLT  395

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIV+KRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS
Sbjct  396  SIVVKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  455

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEK+AVVNLLQ RSIISLIGNVQRSSLILEKAFHVL TNGVNVQ
Sbjct  456  RELIQQ--ELDHVVEELEKVAVVNLLQRRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQ  513

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            MISQGASKVNISLIVNDSEAEQCV ALHSAFFES+LS L    +S NGS
Sbjct  514  MISQGASKVNISLIVNDSEAEQCVRALHSAFFESNLSDLYCGSRSGNGS  562



>ref|XP_008465539.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Cucumis 
melo]
Length=581

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 204/228 (89%), Gaps = 15/228 (7%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLT
Sbjct  330  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLT  389

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  390  SIVLKRNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWS  449

Query  398  RDLIQQAS---------------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLIL  264
            R+LIQQAS               ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLIL
Sbjct  450  RELIQQASKIRVLFSVSFERTRDELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLIL  509

Query  263  EKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            EKAFHVL TNGVNVQMISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  510  EKAFHVLRTNGVNVQMISQGASKVNISLIVNDNEAEQCVRALHSAFFE  557



>ref|XP_003548032.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Glycine 
max]
Length=567

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  391  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T G+ VQM
Sbjct  451  ELIQQASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGITVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALH AFFES+LS+L  D K+ NGS
Sbjct  511  ISQGASKVNISLVVNDSEAEQCVRALHLAFFESELSELEMDYKNGNGS  558



>gb|KHN13387.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=568

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  392  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T G+ VQM
Sbjct  452  ELIQQASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGITVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALH AFFES+LS+L  D K+ NGS
Sbjct  512  ISQGASKVNISLVVNDSEAEQCVRALHLAFFESELSELEMDYKNGNGS  559



>gb|KDO43558.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=559

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  389  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQM
Sbjct  449  ELIQQASELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  69
            ISQGASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  509  ISQGASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  557



>ref|XP_006468884.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X1 [Citrus 
sinensis]
Length=559

 Score =   389 bits (1000),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  389  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQM
Sbjct  449  ELIQQASELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  69
            ISQGASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  509  ISQGASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  557



>ref|XP_004228743.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
lycopersicum]
Length=565

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 202/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTS
Sbjct  328  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  388  IVLKRNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQM
Sbjct  448  ELIQQ--ELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMRTNGVNVQM  505

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  506  ISQGASKVNISLIVNDSEAEQCVRALHHSFFE  537



>gb|KEH25641.1| monofunctional aspartokinase [Medicago truncatula]
Length=560

 Score =   389 bits (998),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 198/229 (86%), Positives = 209/229 (91%), Gaps = 0/229 (0%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLITK RDMS+AVLT
Sbjct  327  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITKERDMSKAVLT  386

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  387  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  446

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GV VQ
Sbjct  447  RELIQQASELDHVVEELEKIAVVNLLQNRSIISLIGNVQQSSLILEKAFRVLRTLGVTVQ  506

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            MISQGASKVNISL+VNDSEAE+CV ALH AFFE++ S+L     + NGS
Sbjct  507  MISQGASKVNISLVVNDSEAEECVRALHHAFFETEFSELQIGYTNGNGS  555



>ref|XP_006364051.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
tuberosum]
Length=567

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/212 (92%), Positives = 202/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTS
Sbjct  328  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  388  IVLKRNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQM
Sbjct  448  ELIQQ--ELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMHTNGVNVQM  505

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  506  ISQGASKVNISLIVNDSEAEQCVRALHHSFFE  537



>ref|XP_010028950.1| PREDICTED: aspartokinase 2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW55773.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=565

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 202/230 (88%), Positives = 212/230 (92%), Gaps = 2/230 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+TRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEK F+VL TNGVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  66
            ISQGASKVNISLIVND EAEQCV ALHSAFFESDL +L    +S NGS++
Sbjct  514  ISQGASKVNISLIVNDDEAEQCVRALHSAFFESDLPELDHGYRSGNGSAA  563



>ref|NP_001238151.1| precursor monofunctional aspartokinase [Glycine max]
 gb|AAD41796.1| precursor monofunctional aspartokinase [Glycine max]
Length=564

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  392  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILE+   VL T GV VQM
Sbjct  452  ELIQQASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILERLSRVLRTLGVTVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  512  ISQGASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  559



>ref|XP_011468211.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Fragaria 
vesca subsp. vesca]
Length=560

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGT+IT+ RDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPEAPGTVITRARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQ+SSLILEKAFHVL TNGVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQKSSLILEKAFHVLRTNGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAEQCV ALH AFF+
Sbjct  514  ISQGASKVNISLVVNDNEAEQCVRALHQAFFD  545



>ref|XP_011024777.1| PREDICTED: aspartokinase 3, chloroplastic isoform X2 [Populus 
euphratica]
Length=555

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 211/230 (92%), Gaps = 2/230 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTLITRARDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  387  IVLKRNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNV RSSLILEKAFHVL T GVNVQM
Sbjct  447  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVHRSSLILEKAFHVLRTLGVNVQM  504

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  66
            ISQGASKVNISLIVND EAEQCV++LH AFFE+D+S+L  +  S NGS+S
Sbjct  505  ISQGASKVNISLIVNDDEAEQCVKSLHKAFFETDISELEWECVSGNGSAS  554



>ref|XP_011006114.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Populus 
euphratica]
Length=561

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  387  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQM
Sbjct  447  ELIQQASELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  554



>ref|XP_009607338.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
tomentosiformis]
Length=555

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 200/215 (93%), Gaps = 5/215 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  322  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  381

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKL  405
            IVLKRNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKL
Sbjct  382  IVLKRNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKL  441

Query  404  WSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVN  225
            WSR+LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVN
Sbjct  442  WSRELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVN  499

Query  224  VQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            VQMISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  500  VQMISQGASKVNISLIVNDSEAEQCVRALHKTFFE  534



>emb|CBI35668.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQ+MRPARE  IPVRVKNSYNP+APGTLI KTRDMS+AVLTS
Sbjct  245  LTFDEAAELAYFGAQVLHPQAMRPARESDIPVRVKNSYNPEAPGTLINKTRDMSKAVLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  305  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGN+QRSSLILEKAF+VL T GVNVQM
Sbjct  365  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQRSSLILEKAFNVLRTIGVNVQM  422

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV+ALH AFFE
Sbjct  423  ISQGASKVNISLIVNDSEAEQCVKALHHAFFE  454



>ref|XP_006657643.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=571

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/212 (90%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  334  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKSNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQA+ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  454  ELIQQANELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  514  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  545



>gb|KJB11752.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=556

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  459  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  516

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  517  ISQGASKVNISLIVHDTEAEQCVRALHSTFFE  548



>ref|XP_006574471.1| PREDICTED: precursor monofunctional aspartokinase isoform X2 
[Glycine max]
Length=562

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 212/228 (93%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  392  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T GV VQM
Sbjct  452  ELIQQ--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGVTVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  510  ISQGASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  557



>ref|XP_004515404.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Cicer 
arietinum]
Length=560

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/229 (86%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLT
Sbjct  327  FLTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKERDMSKAVLT  386

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  387  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  446

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQASELDHV EELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL   GV VQ
Sbjct  447  RELIQQASELDHVAEELEKIAVVNLLQNRSIISLIGNVQKSSLILEKAFRVLRKLGVTVQ  506

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            MISQGASKVNISL+VNDSEAEQCV ALH AFFE++ S+L  +  + NGS
Sbjct  507  MISQGASKVNISLVVNDSEAEQCVRALHEAFFENEFSELQMEYTNGNGS  555



>ref|XP_009781446.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 200/215 (93%), Gaps = 5/215 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTS
Sbjct  325  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTS  384

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKL  405
            IVLKRNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKL
Sbjct  385  IVLKRNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKL  444

Query  404  WSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVN  225
            WSR+LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+N
Sbjct  445  WSRELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGIN  502

Query  224  VQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            VQMISQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  503  VQMISQGASKVNISLIVNDSEAEQCVRALHKTFFE  537



>ref|XP_011006109.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006110.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006111.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006112.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
Length=586

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  352  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTS  411

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  412  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  471

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQM
Sbjct  472  ELIQQASELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQM  531

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  532  ISQGASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  579



>ref|XP_007043813.1| Aspartate kinase 1 [Theobroma cacao]
 gb|EOX99644.1| Aspartate kinase 1 [Theobroma cacao]
Length=575

 Score =   387 bits (993),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITKTRDMS+AVLTS
Sbjct  340  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKTRDMSKAVLTS  399

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  400  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSLSLTLDPSKLWSR  459

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQ RSIISLIGNVQRSSLILEK FHVL T GVNVQM
Sbjct  460  ELIQQ--ELDHVVEELEKIAVVNLLQRRSIISLIGNVQRSSLILEKVFHVLRTIGVNVQM  517

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE+CV+ALH +FFE
Sbjct  518  ISQGASKVNISLIVNDGEAEKCVKALHQSFFE  549



>ref|XP_002275779.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Vitis vinifera]
Length=567

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/234 (85%), Positives = 213/234 (91%), Gaps = 3/234 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  335  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRNAPGTLITRTRDMSKAVLTS  394

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  395  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  454

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGN+Q SSLILEKAFHVL T GVNVQM
Sbjct  455  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQMSSLILEKAFHVLRTKGVNVQM  512

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISLIVND +AE+CV ALHSAFFE  LS++  + +S NGS+S F N
Sbjct  513  ISQGASKVNISLIVNDDQAEKCVRALHSAFFE-SLSEVDRECQSDNGSTSAFSN  565



>ref|XP_007032013.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 ref|XP_007032014.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02939.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02940.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
Length=564

 Score =   386 bits (991),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/212 (92%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  338  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRFRDMSKAVLTS  397

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  398  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  457

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQM
Sbjct  458  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFRVLRTNGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D EAEQCV ALHSAFFE
Sbjct  516  ISQGASKVNISLIVHDDEAEQCVRALHSAFFE  547



>gb|KJB33201.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=556

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTS
Sbjct  334  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAE+CV ALHS+FFE
Sbjct  512  ISQGASKVNISLVVNDNEAEECVRALHSSFFE  543



>gb|EPS64336.1| hypothetical protein M569_10444, partial [Genlisea aurea]
Length=484

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/211 (91%), Positives = 197/211 (93%), Gaps = 2/211 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREGGIPVRVKNSYNP+APGTLIT+TRDM EAVLTS
Sbjct  276  LTFDEAAELAYFGAQVLHPLSMRPAREGGIPVRVKNSYNPEAPGTLITRTRDMDEAVLTS  335

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ GFLA+VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  336  IVLKRNVTMLDIVSTRMLGQVGFLARVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  395

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHV EELEKIAVVNL QHRSIISLIGNVQRSSLILEKAF VL TNGVNVQM
Sbjct  396  ELIQQ--ELDHVEEELEKIAVVNLWQHRSIISLIGNVQRSSLILEKAFRVLRTNGVNVQM  453

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISLIVND EAE+CV ALHSAFF
Sbjct  454  ISQGASKVNISLIVNDDEAEECVRALHSAFF  484



>ref|XP_009378035.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
Length=568

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQM
Sbjct  456  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTTGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND+EAEQCV ALH AFF
Sbjct  516  ISQGASKVNISLVVNDNEAEQCVRALHQAFF  546



>ref|XP_008231032.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Prunus 
mume]
Length=563

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQM
Sbjct  459  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTNGVNVQM  516

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND+EAEQCV ALH AFFE
Sbjct  517  ISQGASKVNISLVVNDNEAEQCVRALHQAFFE  548



>ref|NP_001059423.1| Os07g0300900 [Oryza sativa Japonica Group]
 dbj|BAC84901.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAD31992.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAF21337.1| Os07g0300900 [Oryza sativa Japonica Group]
 dbj|BAG88180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 202/212 (95%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  338  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTS  397

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  398  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  457

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+QA+ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  458  ELIKQANELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  517

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  518  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  549



>ref|XP_010656841.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Vitis vinifera]
Length=573

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/212 (91%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQ+MRPARE  IPVRVKNSYNP+APGTLI KTRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQAMRPARESDIPVRVKNSYNPEAPGTLINKTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGN+QRSSLILEKAF+VL T GVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQRSSLILEKAFNVLRTIGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAEQCV+ALH AFFE
Sbjct  514  ISQGASKVNISLIVNDSEAEQCVKALHHAFFE  545



>ref|XP_008362086.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Malus 
domestica]
Length=568

 Score =   384 bits (985),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQM
Sbjct  456  ELIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTIGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND+EAEQCV ALH AFF
Sbjct  516  ISQGASKVNISLVVNDNEAEQCVRALHQAFF  546



>ref|XP_007151724.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
 gb|ESW23718.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
Length=543

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 197/213 (92%), Gaps = 2/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+A+LT
Sbjct  325  FLTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAILT  384

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  385  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  444

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVVNLLQ RSIISLIGNVQ+SSLILEKAF VL T GV VQ
Sbjct  445  RELIQQ--ELDHVVEELEKIAVVNLLQSRSIISLIGNVQKSSLILEKAFRVLRTLGVTVQ  502

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISL+VNDSEAEQCV ALHS FFE
Sbjct  503  MISQGASKVNISLVVNDSEAEQCVRALHSVFFE  535



>ref|XP_006599412.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Glycine 
max]
Length=565

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  391  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T G+ VQM
Sbjct  451  ELIQQ--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGITVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALH AFFES+LS+L  D K+ NGS
Sbjct  509  ISQGASKVNISLVVNDSEAEQCVRALHLAFFESELSELEMDYKNGNGS  556



>ref|XP_006468885.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X2 [Citrus 
sinensis]
Length=557

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 197/229 (86%), Positives = 206/229 (90%), Gaps = 2/229 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  389  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQM
Sbjct  449  ELIQQ--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  69
            ISQGASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  555



>ref|XP_010927771.1| PREDICTED: aspartokinase 2, chloroplastic-like [Elaeis guineensis]
Length=380

 Score =   375 bits (963),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGT+ITK RDMSEA+LTS
Sbjct  145  LTFEEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTVITKARDMSEAILTS  204

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  205  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  264

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+QQ SELDH+VEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF++L  N VNVQM
Sbjct  265  ELVQQESELDHLVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNILRKNKVNVQM  324

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV ALH AFFE
Sbjct  325  ISQGASKVNISLVVHDSEAKQCVRALHLAFFE  356



>ref|XP_009131382.1| PREDICTED: aspartokinase 2, chloroplastic [Brassica rapa]
Length=537

 Score =   380 bits (976),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  323  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTS  382

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  383  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  442

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+Q+A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  443  ELVQRANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFKVLRSNGVNVQM  502

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  503  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  534



>gb|KDO43559.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=557

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 197/229 (86%), Positives = 206/229 (90%), Gaps = 2/229 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  389  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQM
Sbjct  449  ELIQQ--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  69
            ISQGASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  555



>ref|XP_006446944.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
 gb|ESR60184.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
Length=557

 Score =   381 bits (978),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 197/229 (86%), Positives = 206/229 (90%), Gaps = 2/229 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  389  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQM
Sbjct  449  ELIQQ--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  69
            ISQGASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  507  ISQGASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  555



>emb|CDX78557.1| BnaA03g04690D [Brassica napus]
Length=537

 Score =   380 bits (975),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  323  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTS  382

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  383  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  442

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+Q+A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  443  ELVQRANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFKVLRSNGVNVQM  502

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  503  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  534



>ref|XP_008379051.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Malus domestica]
Length=568

 Score =   381 bits (978),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE+AF VL T GVNVQM
Sbjct  456  ELIQQASELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILERAFQVLRTIGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND EAEQCV ALH AFF
Sbjct  516  ISQGASKVNISLVVNDDEAEQCVRALHQAFF  546



>gb|KEH25640.1| monofunctional aspartokinase [Medicago truncatula]
Length=558

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/229 (86%), Positives = 207/229 (90%), Gaps = 2/229 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLITK RDMS+AVLT
Sbjct  327  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITKERDMSKAVLT  386

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  387  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  446

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GV VQ
Sbjct  447  RELIQQ--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQQSSLILEKAFRVLRTLGVTVQ  504

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            MISQGASKVNISL+VNDSEAE+CV ALH AFFE++ S+L     + NGS
Sbjct  505  MISQGASKVNISLVVNDSEAEECVRALHHAFFETEFSELQIGYTNGNGS  553



>emb|CDX70538.1| BnaC03g06220D [Brassica napus]
Length=546

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  392  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+Q+A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  452  ELVQRANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFKVLRSNGVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  512  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  543



>ref|XP_002512848.1| aspartate kinase, putative [Ricinus communis]
 gb|EEF49351.1| aspartate kinase, putative [Ricinus communis]
Length=556

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  335  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRARDMSKAVLTS  394

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  395  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  454

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHV+EELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL TNGVNVQM
Sbjct  455  ELIQQASELDHVLEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCV  147
            ISQGASKVNISLIVND EAEQCV
Sbjct  515  ISQGASKVNISLIVNDDEAEQCV  537



>ref|XP_006399912.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 ref|XP_006399913.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41365.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41366.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=545

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  391  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +++Q+A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  451  EIVQRANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_011006115.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Populus 
euphratica]
Length=559

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 207/228 (91%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  387  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQM
Sbjct  447  ELIQQ--ELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQM  504

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  505  ISQGASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  552



>ref|XP_008379050.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Malus domestica]
Length=568

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQASELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE AF VL T GVNVQM
Sbjct  456  ELIQQASELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILEXAFQVLRTIGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND EAEQCV ALH AFF
Sbjct  516  ISQGASKVNISLVVNDDEAEQCVRALHQAFF  546



>gb|KHM99220.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=553

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 208/228 (91%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLI KTRDMS+A+LTS
Sbjct  323  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLIAKTRDMSKALLTS  382

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  383  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  442

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVVNLL+ RSIISLIGNVQRSSLILEKAFHVL T GV VQM
Sbjct  443  ELIQQ--ELDYVVEELEKIAVVNLLKTRSIISLIGNVQRSSLILEKAFHVLRTLGVTVQM  500

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL+VNDSEAEQCV ALH AFFES+L +L ++    NGS
Sbjct  501  ISQGASKVNISLVVNDSEAEQCVRALHKAFFESELFELENECIPGNGS  548



>ref|XP_004515405.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Cicer 
arietinum]
Length=558

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 195/229 (85%), Positives = 206/229 (90%), Gaps = 2/229 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLT
Sbjct  327  FLTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKERDMSKAVLT  386

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  387  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  446

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHV EELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL   GV VQ
Sbjct  447  RELIQQ--ELDHVAEELEKIAVVNLLQNRSIISLIGNVQKSSLILEKAFRVLRKLGVTVQ  504

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            MISQGASKVNISL+VNDSEAEQCV ALH AFFE++ S+L  +  + NGS
Sbjct  505  MISQGASKVNISLVVNDSEAEQCVRALHEAFFENEFSELQMEYTNGNGS  553



>ref|XP_011006113.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=584

 Score =   379 bits (973),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 207/228 (91%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTS
Sbjct  352  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTS  411

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  412  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  471

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQM
Sbjct  472  ELIQQ--ELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQM  529

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  530  ISQGASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  577



>dbj|BAC84902.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAD31993.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
Length=573

 Score =   379 bits (972),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  338  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTS  397

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  398  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  457

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+Q  ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  458  ELIKQ--ELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  516  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  547



>ref|XP_010682652.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=567

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYNPKAPGTLI +TRDMSE +LTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNPKAPGTLINRTRDMSEVLLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKR+VTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  392  IVLKRSVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQA ELD VVEEL+ IAVVNLLQ+RSIISLIGNV  SSLILEKAFHVL TN VNVQM
Sbjct  452  ELIQQARELDRVVEELQNIAVVNLLQNRSIISLIGNVHYSSLILEKAFHVLRTNNVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE+CV+ALH AFFE
Sbjct  512  ISQGASKVNISLIVNDDEAEKCVKALHYAFFE  543



>ref|XP_009125901.1| PREDICTED: aspartokinase 1, chloroplastic-like [Brassica rapa]
Length=574

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 198/213 (93%), Gaps = 2/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++ VLT
Sbjct  338  FLTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKTVLT  397

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSEVSISLTLDPSKLWS
Sbjct  398  SIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSEVSISLTLDPSKLWS  457

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQ
Sbjct  458  RELIQQ--ELDHVVEELEKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQ  515

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND+EAE CVEALH +FFE
Sbjct  516  MISQGASKVNISLIVNDAEAEGCVEALHKSFFE  548



>ref|XP_010100040.1| Aspartokinase 1 [Morus notabilis]
 gb|EXB81211.1| Aspartokinase 1 [Morus notabilis]
Length=575

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 199/214 (93%), Gaps = 5/214 (2%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  567
            DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNPKAPGTLIT+TRDM+EAVLTSIVL
Sbjct  338  DEAAELAYFGAQVLHPLSMRPAREGDIPVRVKNSYNPKAPGTLITRTRDMAEAVLTSIVL  397

Query  566  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  387
            KRNVTMLDI STRMLGQ GFLA VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LI
Sbjct  398  KRNVTMLDIVSTRMLGQVGFLAMVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELI  457

Query  386  QQAS-----ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  222
            QQAS     ELD+V EEL+KIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TN VNV
Sbjct  458  QQASMKSYRELDNVEEELKKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNDVNV  517

Query  221  QMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            QMISQGASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  518  QMISQGASKVNISLIVNDSEAERCVKALHQAFFE  551



>ref|XP_010453390.1| PREDICTED: aspartokinase 1, chloroplastic [Camelina sativa]
Length=573

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTS
Sbjct  338  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTS  397

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  398  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  457

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  458  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  515

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVND+EAE CV+ALH +FFE
Sbjct  516  ISQGASKVNISFIVNDAEAEGCVQALHKSFFE  547



>ref|XP_010556239.1| PREDICTED: aspartokinase 1, chloroplastic, partial [Tarenaya 
hassleriana]
Length=452

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 196/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITK RDM+  VLTS
Sbjct  218  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTIITKARDMTGTVLTS  277

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ GFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  278  IVLKRNVTMLDIVSTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSLSLTLDPSKLWSR  337

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILEKAFHVL T GVNVQM
Sbjct  338  ELIQQ--ELDHVVEELEKIAVVNLLRRRAIISLIGNVQHSSLILEKAFHVLRTKGVNVQM  395

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVN+ EAE+C+EALH AFFE
Sbjct  396  ISQGASKVNISLIVNEDEAERCIEALHRAFFE  427



>ref|XP_009378037.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Pyrus 
x bretschneideri]
Length=566

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTTGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND+EAEQCV ALH AFF
Sbjct  514  ISQGASKVNISLVVNDNEAEQCVRALHQAFF  544



>pdb|2CDQ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Aspartate 
Kinase Complexed With Lysine And S-Adenosylmethionine
 pdb|2CDQ|B Chain B, Crystal Structure Of Arabidopsis Thaliana Aspartate 
Kinase Complexed With Lysine And S-Adenosylmethionine
Length=510

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++++LTS
Sbjct  275  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKSILTS  334

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  335  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  394

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  395  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  452

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  453  ISQGASKVNISFIVNEAEAEGCVQALHKSFFE  484



>gb|KFK25564.1| hypothetical protein AALP_AA8G131200 [Arabis alpina]
Length=572

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++++LTS
Sbjct  337  LTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKSILTS  396

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+L ISVDVVATSEVSISLTLDPSKLWSR
Sbjct  397  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELEISVDVVATSEVSISLTLDPSKLWSR  456

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQM
Sbjct  457  ELIQQ--ELDHVVEELEKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLFTKGINVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND+EAE CVEALH +FFE
Sbjct  515  ISQGASKVNISLIVNDAEAEGCVEALHKSFFE  546



>ref|XP_010492197.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010492198.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=546

 Score =   375 bits (963),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  392  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  452  ELIQRTNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  512  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  543



>ref|XP_008362087.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Malus 
domestica]
Length=566

 Score =   376 bits (965),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTIGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND+EAEQCV ALH AFF
Sbjct  514  ISQGASKVNISLVVNDNEAEQCVRALHQAFF  544



>ref|XP_010492075.1| PREDICTED: aspartokinase 1, chloroplastic-like [Camelina sativa]
Length=574

 Score =   376 bits (965),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTS
Sbjct  339  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  459  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  516

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVND+EAE CV+ALH +FFE
Sbjct  517  ISQGASKVNISFIVNDAEAEGCVQALHKSFFE  548



>ref|XP_010419903.1| PREDICTED: aspartokinase 1, chloroplastic-like [Camelina sativa]
Length=574

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTS
Sbjct  339  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  458

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  459  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  516

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVND+EAE CV+ALH +FFE
Sbjct  517  ISQGASKVNISFIVNDAEAEGCVQALHKSFFE  548



>gb|EEC76545.1| hypothetical protein OsI_14341 [Oryza sativa Indica Group]
Length=566

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 201/212 (95%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPA+EGGIPVRVKNSYN +APGT+ITKTRD+S+++LTS
Sbjct  329  LTFEEAAELAYFGAQVLHPQSMRPAKEGGIPVRVKNSYNRRAPGTVITKTRDLSKSILTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R
Sbjct  389  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  449  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QC++ALHSAFFE
Sbjct  507  ISQGASKVNISLVVHDSEAKQCIQALHSAFFE  538



>ref|XP_008790700.1| PREDICTED: aspartokinase 2, chloroplastic-like [Phoenix dactylifera]
Length=569

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGT+ITK RDMS+A+LTS
Sbjct  334  LTFEEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTVITKARDMSKAILTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDIASTRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW+R
Sbjct  394  IVLKSNITMLDIASTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWNR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+QQ SELDH+VEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF++L  N VNVQM
Sbjct  454  ELVQQESELDHLVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNILRKNKVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QC+ ALHSAFF+
Sbjct  514  ISQGASKVNISLVVHDSEAKQCIRALHSAFFK  545



>ref|XP_008369639.1| PREDICTED: aspartokinase 1, chloroplastic [Malus domestica]
Length=565

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 197/213 (92%), Gaps = 2/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITKTRDMS+AVLT
Sbjct  330  FLTFDEAAELAYFGAQVLHPQSMRPARDGEIPVRVKNSYNPKAPGTLITKTRDMSKAVLT  389

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLK+NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WS
Sbjct  390  SIVLKQNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWS  449

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDH+ EELEKIA VNLLQHRSIISLIGNVQ SSLILEKAFHVL TN VNVQ
Sbjct  450  RELIQQ--ELDHMEEELEKIAFVNLLQHRSIISLIGNVQYSSLILEKAFHVLRTNQVNVQ  507

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  508  MISQGASKVNISLIVNDSEAEKCVKALHHAFFE  540



>ref|XP_010435684.1| PREDICTED: aspartokinase 3, chloroplastic-like [Camelina sativa]
Length=553

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 194/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  322  LTFDEAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  381

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR
Sbjct  382  IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSR  441

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  442  ELIQQ--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  499

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  500  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  531



>gb|EEC74320.1| hypothetical protein OsI_09598 [Oryza sativa Indica Group]
Length=659

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  424  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTS  483

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  484  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  543

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+Q  ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  544  ELIKQ--ELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  601

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  602  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  633



>ref|XP_010530884.1| PREDICTED: aspartokinase 1, chloroplastic-like [Tarenaya hassleriana]
Length=572

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITK RDM+E VLTS
Sbjct  337  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTIITKARDMTETVLTS  396

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ GFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  397  IVLKRNVTMLDIVSTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSLSLTLDPSKLWSR  456

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILEKAFHVL T GVNVQM
Sbjct  457  ELIQQ--ELDHVVEELEKIAVVNLLRRRAIISLIGNVQHSSLILEKAFHVLRTKGVNVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVN+ EAE+C+EALH +FFE
Sbjct  515  ISQGASKVNISLIVNEDEAERCIEALHQSFFE  546



>gb|EEE58127.1| hypothetical protein OsJ_09026 [Oryza sativa Japonica Group]
Length=659

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  424  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTS  483

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  484  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  543

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+Q  ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  544  ELIKQ--ELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  601

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  602  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  633



>ref|XP_002871599.1| lysine-sensitive aspartate kinase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47858.1| lysine-sensitive aspartate kinase [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  391  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  451  ELIQRVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_010453516.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
 ref|XP_010453517.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
Length=545

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLA+VF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  391  IVLKRNVTMLDIASTRMLGQYGFLARVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  451  ELIQRTNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_003562409.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=569

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTS
Sbjct  330  LTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTS  389

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  390  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDSVATSEVSISLTLDPSKLWSR  449

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  450  ELIQQ--ELDNVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  507

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  508  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  539



>ref|XP_003553303.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Glycine 
max]
 gb|KHN28578.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=562

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLI KTRDMS+A+LTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLIAKTRDMSKALLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  392  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVVNLL+ RSIISLIGNVQ+SSLILEKAFHVL T G+ VQM
Sbjct  452  ELIQQ--ELDYVVEELEKIAVVNLLKTRSIISLIGNVQKSSLILEKAFHVLRTLGITVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL++NDSEA+QCV ALH AFFES+LS+L ++   +NGS
Sbjct  510  ISQGASKVNISLVINDSEADQCVRALHKAFFESELSELENECIPRNGS  557



>ref|XP_010496416.1| PREDICTED: aspartokinase 3, chloroplastic [Camelina sativa]
 ref|XP_010496417.1| PREDICTED: aspartokinase 3, chloroplastic [Camelina sativa]
Length=568

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 194/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  335  LTFDEAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  394

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR
Sbjct  395  IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSR  454

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  455  ELIQQ--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  512

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  513  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  544



>ref|XP_006604189.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Glycine 
max]
 ref|XP_006604190.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X3 [Glycine 
max]
 ref|XP_006604191.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X4 [Glycine 
max]
Length=571

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLI KTRDMS+A+LTS
Sbjct  341  LTFDEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLIAKTRDMSKALLTS  400

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  401  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  460

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVVNLL+ RSIISLIGNVQ+SSLILEKAFHVL T G+ VQM
Sbjct  461  ELIQQ--ELDYVVEELEKIAVVNLLKTRSIISLIGNVQKSSLILEKAFHVLRTLGITVQM  518

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  72
            ISQGASKVNISL++NDSEA+QCV ALH AFFES+LS+L ++   +NGS
Sbjct  519  ISQGASKVNISLVINDSEADQCVRALHKAFFESELSELENECIPRNGS  566



>ref|NP_196832.1| aspartokinase 1 [Arabidopsis thaliana]
 sp|Q9LYU8.1|AK1_ARATH RecName: Full=Aspartokinase 1, chloroplastic; AltName: Full=Aspartate 
kinase 1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86635.1| aspartate kinase [Arabidopsis thaliana]
 gb|AAL15305.1| AT5g13280/T31B5_100 [Arabidopsis thaliana]
 gb|AAN18062.1| At5g13280/T31B5_100 [Arabidopsis thaliana]
 gb|AED91874.1| aspartokinase 1 [Arabidopsis thaliana]
Length=569

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++++LTS
Sbjct  334  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKSILTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  512  ISQGASKVNISFIVNEAEAEGCVQALHKSFFE  543



>ref|XP_002871558.1| AK-LYS1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47817.1| AK-LYS1 [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++++LTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKSILTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  514  ISQGASKVNISFIVNEAEAEGCVQALHKSFFE  545



>ref|XP_006399820.1| hypothetical protein EUTSA_v10013112mg [Eutrema salsugineum]
 gb|ESQ41273.1| hypothetical protein EUTSA_v10013112mg [Eutrema salsugineum]
Length=571

 Score =   374 bits (960),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND+EAE CVEALH +FFE
Sbjct  514  ISQGASKVNISLIVNDAEAEGCVEALHKSFFE  545



>ref|XP_010420027.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010420028.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=545

 Score =   373 bits (957),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLA+VF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  391  IVLKRNVTMLDIASTRMLGQYGFLARVFTKFEDLGISVDVVATSEVSISLTLDPAKLWGR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  451  ELIQRTNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_008776937.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776944.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776949.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Phoenix 
dactylifera]
Length=567

 Score =   373 bits (957),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGTLITK RD+SE VLTS
Sbjct  334  LTFEEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTLITKARDLSETVLTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF VL  N VNVQM
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFSVLRKNNVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  512  ISQGASKVNISLVVHDSEAKQCVKALHSAFFE  543



>ref|NP_196910.1| aspartokinase 2 [Arabidopsis thaliana]
 ref|NP_001078581.1| aspartokinase 2 [Arabidopsis thaliana]
 sp|O23653.2|AK2_ARATH RecName: Full=Aspartokinase 2, chloroplastic; AltName: Full=Aspartate 
kinase 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08285.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
 gb|AED91982.1| aspartokinase 2 [Arabidopsis thaliana]
 gb|AED91983.1| aspartokinase 2 [Arabidopsis thaliana]
Length=544

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  330  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  389

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  390  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  449

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F V  +NGVNVQM
Sbjct  450  ELIQRVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  510  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  541



>emb|CAC06395.1| aspartate kinase [Arabidopsis thaliana]
Length=544

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  330  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  389

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  390  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  449

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F V  +NGVNVQM
Sbjct  450  ELIQRVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  510  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  541



>gb|AAO20063.1| putative aspartate kinase [Oryza sativa Japonica Group]
 gb|ABF99917.1| aspartate kinase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE60306.1| hypothetical protein OsJ_13379 [Oryza sativa Japonica Group]
Length=565

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 208/234 (89%), Gaps = 2/234 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPA+EG IPVRVKNSYN +APGT+ITKTRD+S+++LTS
Sbjct  328  LTFEEAAELAYFGAQVLHPQSMRPAKEGDIPVRVKNSYNRRAPGTVITKTRDLSKSILTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R
Sbjct  388  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  448  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  505

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISL+V+DSEA+QC++ALHSAFFE+     V +   Q+  S   PN
Sbjct  506  ISQGASKVNISLVVHDSEAKQCIQALHSAFFENGFLSEVEEEDLQHNGSPVSPN  559



>gb|AAB63104.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
Length=544

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  330  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  389

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  390  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  449

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F V  +NGVNVQM
Sbjct  450  ELIQRVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  510  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  541



>ref|XP_002466095.1| hypothetical protein SORBIDRAFT_01g001140 [Sorghum bicolor]
 gb|EER93093.1| hypothetical protein SORBIDRAFT_01g001140 [Sorghum bicolor]
Length=566

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/230 (83%), Positives = 209/230 (91%), Gaps = 3/230 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK+RDMS+++LTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKSRDMSKSILTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  389  IVLKSNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEK +VV+LLQ RSIISLIGNVQRSSL+LEKAF+VL  NGVNVQM
Sbjct  449  ELIQQ--ELDHVVEELEKFSVVHLLQRRSIISLIGNVQRSSLVLEKAFNVLRRNGVNVQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsd-lsklvsd*kSQNGSS  69
            ISQGASKVNISL+VNDSEA+QCV+ALHSAFFE+  LS++      QNGSS
Sbjct  507  ISQGASKVNISLVVNDSEAKQCVQALHSAFFENGFLSEVEGADVPQNGSS  556



>ref|XP_010926856.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=567

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGTLITK RD+SE +LTS
Sbjct  334  LTFEEAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTLITKARDLSETILTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  N VNVQM
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRKNKVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV ALHSAFFE
Sbjct  512  ISQGASKVNISLVVHDSEAKQCVRALHSAFFE  543



>ref|XP_009413004.1| PREDICTED: aspartokinase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 199/220 (90%), Gaps = 10/220 (5%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGT+ITK RDMS+ VLTS
Sbjct  145  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTVITKARDMSKVVLTS  204

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW+R
Sbjct  205  IVLKSNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWNR  264

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  265  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRKNGVNVQM  322

Query  215  ISQGASK--------VNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASK        VNISL+V+DSEA+QC+ ALHS+FF+
Sbjct  323  ISQGASKVLSNNSGYVNISLVVHDSEAQQCISALHSSFFD  362



>ref|XP_009121776.1| PREDICTED: aspartokinase 1, chloroplastic [Brassica rapa]
Length=571

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLT
Sbjct  335  FLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLT  394

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSEVS+SLTLDPSKLWS
Sbjct  395  SIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSEVSLSLTLDPSKLWS  454

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQ
Sbjct  455  RELIQQ--ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQ  512

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND EAE CVEALH +FFE
Sbjct  513  MISQGASKVNISLIVNDDEAEGCVEALHKSFFE  545



>ref|NP_001051906.1| Os03g0850400 [Oryza sativa Japonica Group]
 dbj|BAF13820.1| Os03g0850400, partial [Oryza sativa Japonica Group]
Length=537

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 208/234 (89%), Gaps = 2/234 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPA+EG IPVRVKNSYN +APGT+ITKTRD+S+++LTS
Sbjct  300  LTFEEAAELAYFGAQVLHPQSMRPAKEGDIPVRVKNSYNRRAPGTVITKTRDLSKSILTS  359

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R
Sbjct  360  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCR  419

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  420  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  477

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  54
            ISQGASKVNISL+V+DSEA+QC++ALHSAFFE+     V +   Q+  S   PN
Sbjct  478  ISQGASKVNISLVVHDSEAKQCIQALHSAFFENGFLSEVEEEDLQHNGSPVSPN  531



>emb|CAA67376.1| aspartate kinase [Arabidopsis thaliana]
Length=569

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 199/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVK+SYNPKAPGT+ITKTRDM++++LTS
Sbjct  334  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKSSYNPKAPGTIITKTRDMTKSILTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  511

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  512  ISQGASKVNISFIVNEAEAEGCVQALHKSFFE  543



>ref|XP_010682653.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=565

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 196/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYNPKAPGTLI +TRDMSE +LTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNPKAPGTLINRTRDMSEVLLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKR+VTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  392  IVLKRSVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD VVEEL+ IAVVNLLQ+RSIISLIGNV  SSLILEKAFHVL TN VNVQM
Sbjct  452  ELIQQ--ELDRVVEELQNIAVVNLLQNRSIISLIGNVHYSSLILEKAFHVLRTNNVNVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE+CV+ALH AFFE
Sbjct  510  ISQGASKVNISLIVNDDEAEKCVKALHYAFFE  541



>ref|XP_008357847.1| PREDICTED: aspartokinase 2, chloroplastic-like [Malus domestica]
Length=566

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 192/211 (91%), Gaps = 2/211 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE AF VL T GVNVQM
Sbjct  456  ELIQQ--ELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILEXAFQVLRTIGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND EAEQCV ALH AFF
Sbjct  514  ISQGASKVNISLVVNDDEAEQCVRALHQAFF  544



>ref|XP_008379052.1| PREDICTED: aspartokinase 2, chloroplastic isoform X3 [Malus domestica]
Length=566

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 192/211 (91%), Gaps = 2/211 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE AF VL T GVNVQM
Sbjct  456  ELIQQ--ELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILEXAFQVLRTIGVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASKVNISL+VND EAEQCV ALH AFF
Sbjct  514  ISQGASKVNISLVVNDDEAEQCVRALHQAFF  544



>ref|XP_006652023.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=561

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 200/212 (94%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPA+EGGIPVRVKNSYN +APGT+ITKTRD+S+++LTS
Sbjct  324  LTFEEAAELAYFGAQVLHPQSMRPAKEGGIPVRVKNSYNRRAPGTVITKTRDLSKSILTS  383

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R
Sbjct  384  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCR  443

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  444  ELIQQ--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  501

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QC++ALHSAFFE
Sbjct  502  ISQGASKVNISLVVHDSEAKQCIQALHSAFFE  533



>ref|XP_006408563.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50016.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
Length=549

 Score =   370 bits (950),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  324  LTFDEAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  383

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  S+
Sbjct  384  IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSK  443

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQ RSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  444  ELIQQ--ELDHVVEELEKIAIVNLLQQRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  501

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  502  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  533



>ref|NP_001288496.1| uncharacterized protein LOC103644325 [Zea mays]
 gb|ACR34218.1| unknown [Zea mays]
 tpg|DAA52504.1| TPA: aspartokinase [Zea mays]
Length=568

 Score =   371 bits (952),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK+RDMS+++LTS
Sbjct  331  LTFDEAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKSRDMSKSILTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  391  IVLKSNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEEL+K AVV+LLQ RSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  451  ELIQQ--ELDHVVEELKKFAVVHLLQRRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  509  ISQGASKVNISLVVNDSEAKQCVQALHSAFFE  540



>gb|ABO09875.1| monofunctional aspartate kinase 1 [Zea mays]
Length=581

 Score =   371 bits (952),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK+RDMS+++LTS
Sbjct  344  LTFDEAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKSRDMSKSILTS  403

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  404  IVLKSNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  463

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEEL+K AVV+LLQ RSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  464  ELIQQ--ELDHVVEELKKFAVVHLLQRRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  521

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  522  ISQGASKVNISLVVNDSEAKQCVQALHSAFFE  553



>ref|XP_006408564.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 ref|XP_006408565.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 ref|XP_006408566.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 dbj|BAJ33777.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50017.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50018.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50019.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
Length=552

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  327  LTFDEAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  S+
Sbjct  387  IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSK  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLLQ RSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  447  ELIQQ--ELDHVVEELEKIAIVNLLQQRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  504

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  505  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  536



>ref|XP_010234251.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=570

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 200/213 (94%), Gaps = 3/213 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTS
Sbjct  330  LTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTS  389

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  390  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDSVATSEVSISLTLDPSKLWSR  449

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  450  ELIQQ--ELDNVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  507

Query  215  ISQGASK-VNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASK VNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  508  ISQGASKQVNISLVVHDSEAKQCVQALHSAFFE  540



>ref|XP_009359889.1| PREDICTED: aspartokinase 1, chloroplastic-like [Pyrus x bretschneideri]
Length=566

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 203/234 (87%), Gaps = 3/234 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+  IPVRVKNSYNPKAPGTLITKTRDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPQSMRPARDAEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK+NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR
Sbjct  391  IVLKQNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDH+ EELEKIA VNLLQHRSIISLIGNVQ SSLILEK FHVL TN VNVQM
Sbjct  451  ELIQQ--ELDHMEEELEKIAFVNLLQHRSIISLIGNVQYSSLILEKVFHVLRTNQVNVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*-kSQNGSSSDFP  57
            ISQGASKVNISLIVNDSEAE+CV+ALH AFFES     +       NGS+S  P
Sbjct  509  ISQGASKVNISLIVNDSEAEKCVKALHHAFFESGDLSELVPEFGFGNGSASPLP  562



>ref|XP_004956005.1| PREDICTED: aspartokinase 2, chloroplastic-like [Setaria italica]
Length=568

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+++LTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRQAPGTLITKARDMSKSILTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS 
Sbjct  389  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSC  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+QQ  ELD V+EELEKIAVV+LLQ+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  449  ELVQQKIELDDVIEELEKIAVVHLLQNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  509  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  540



>ref|XP_008669985.1| PREDICTED: aspartokinase 2, chloroplastic [Zea mays]
 gb|ACF79023.1| unknown [Zea mays]
 tpg|DAA39408.1| TPA: aspartokinase [Zea mays]
Length=565

 Score =   369 bits (947),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  326  LTFDEAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNRRAPGTLITKARDMSKTVLTS  385

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS 
Sbjct  386  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSC  445

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+Q  +ELD V+EELEKIAVV+LLQ+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  446  ELVQHKNELDDVIEELEKIAVVHLLQNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  505

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  506  ISQGASKVNISLVVHDSEAKQCVQALHSAFFE  537



>ref|NP_186851.1| aspartokinase 3 [Arabidopsis thaliana]
 sp|Q9S702.1|AK3_ARATH RecName: Full=Aspartokinase 3, chloroplastic; AltName: Full=Aspartate 
kinase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF03452.1|AC010797_28 putative aspartate kinase [Arabidopsis thaliana]
 gb|AAF14833.1|AC011664_15 putative aspartate kinase [Arabidopsis thaliana]
 gb|AAM65905.1| putative aspartate kinase [Arabidopsis thaliana]
 dbj|BAE98365.1| putative aspartate kinase [Arabidopsis thaliana]
 gb|AEE73750.1| aspartokinase 3 [Arabidopsis thaliana]
Length=559

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR
Sbjct  391  IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ   ELD VVEELEKIAVVNLL+HRSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  451  ELIQH--ELDQVVEELEKIAVVNLLRHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  509  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  540



>ref|XP_008222377.1| PREDICTED: aspartokinase 1, chloroplastic [Prunus mume]
Length=570

 Score =   368 bits (945),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITKTRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPARDGEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK+NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR
Sbjct  396  IVLKQNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD + EELEKIA VNLLQ RSIISLIGNVQ SSLILEKAFHVL TN VNVQM
Sbjct  456  ELIQQ--ELDKMEEELEKIAFVNLLQRRSIISLIGNVQYSSLILEKAFHVLRTNQVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  514  ISQGASKVNISLIVNDSEAEKCVKALHHAFFE  545



>ref|XP_009411806.1| PREDICTED: aspartokinase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411807.1| PREDICTED: aspartokinase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=579

 Score =   369 bits (946),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFG+QVLHPQSM PAREG IPVRVKNSYNP+APGT+I K RDMS+AVLTS
Sbjct  337  LTFEEAAELAYFGSQVLHPQSMWPAREGDIPVRVKNSYNPQAPGTVIDKVRDMSKAVLTS  396

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVS+SLTLDPSKLWSR
Sbjct  397  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDSVATSEVSVSLTLDPSKLWSR  456

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEEL+KIAVVNLLQHRSIISL+GNVQRSSLILEKAF+VL  +GVNVQM
Sbjct  457  ELIQQ--ELDHVVEELKKIAVVNLLQHRSIISLVGNVQRSSLILEKAFNVLRKSGVNVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QC+ ALHSAFFE
Sbjct  515  ISQGASKVNISLVVHDSEAKQCIRALHSAFFE  546



>gb|ABQ28733.1| monofunctional aspartate kinase 2 [Zea mays]
Length=527

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  288  LTFDEAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNRRAPGTLITKARDMSKTVLTS  347

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS 
Sbjct  348  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSC  407

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +L+Q  +ELD V+EELEKIAVV+LLQ+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQM
Sbjct  408  ELVQHKNELDDVIEELEKIAVVHLLQNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQM  467

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+V+DSEA+QC +ALHSAFFE
Sbjct  468  ISQGASKVNISLVVHDSEAKQCFQALHSAFFE  499



>ref|XP_004981039.1| PREDICTED: aspartokinase 1, chloroplastic-like [Setaria italica]
Length=565

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK RDMS+++LTS
Sbjct  328  LTFDEAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKARDMSKSILTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  388  IVLKSNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEK AVV+LLQ RSIISL+GNVQRSSLILEKAF+VL   GVNVQM
Sbjct  448  ELIQQ--ELDHVVEELEKFAVVHLLQRRSIISLVGNVQRSSLILEKAFNVLRRQGVNVQM  505

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VND EA+QCV+ALHSAFFE
Sbjct  506  ISQGASKVNISLVVNDCEAKQCVQALHSAFFE  537



>gb|EMS63387.1| Aspartokinase 1, chloroplastic [Triticum urartu]
Length=814

 Score =   372 bits (955),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 200/217 (92%), Gaps = 7/217 (3%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTS
Sbjct  243  LTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTS  302

Query  575  IVLKRNVTMLDIASTRMLGQYGFL-----AKVFSIFEDLGISVDVVATSEVSISLTLDPS  411
            IVLK N+TMLDI STRMLGQYGFL     AKVFSIFEDLGISVD VATSEVSISLTLDPS
Sbjct  303  IVLKSNITMLDIVSTRMLGQYGFLAKVFSAKVFSIFEDLGISVDSVATSEVSISLTLDPS  362

Query  410  KLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNG  231
            KLWSR+LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NG
Sbjct  363  KLWSRELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNG  420

Query  230  VNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            VNVQMISQGASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  421  VNVQMISQGASKVNISLVVNDSEAKQCVQALHSAFFE  457


 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 80/126 (63%), Gaps = 27/126 (21%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQ----------------------VLHPQSMRPAREGGIPVRVKNSY  642
             T  EAAE+AYFGAQ                      +L        REGG+PVRVKNSY
Sbjct  689  LTFYEAAEVAYFGAQGVGCVGRDLYSTDNFLLYVFLELLVLLGDLATREGGMPVRVKNSY  748

Query  641  NPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIASTRMLGQYGFL-----AKVFSIFED  477
            N  APGT+ITKTRDM +++LT+IVLK N+ MLD+ +TRMLGQYG L     AKVFSIFE 
Sbjct  749  NCHAPGTVITKTRDMRKSILTNIVLKSNIAMLDMVNTRMLGQYGVLAKVSSAKVFSIFEH  808

Query  476  LGISVD  459
            LGISV+
Sbjct  809  LGISVE  814



>gb|EMT10312.1| Aspartokinase 1, chloroplastic [Aegilops tauschii]
Length=748

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 200/217 (92%), Gaps = 7/217 (3%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTS
Sbjct  389  LTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTS  448

Query  575  IVLKRNVTMLDIASTRMLGQYGFL-----AKVFSIFEDLGISVDVVATSEVSISLTLDPS  411
            IVLK N+TMLDI STRMLGQYGFL     AKVFSIFEDLGISVD VATSEVSISLTLDPS
Sbjct  449  IVLKSNITMLDIVSTRMLGQYGFLAKVFSAKVFSIFEDLGISVDSVATSEVSISLTLDPS  508

Query  410  KLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNG  231
            KLWSR+LIQQ  ELD+VVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NG
Sbjct  509  KLWSRELIQQ--ELDNVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNG  566

Query  230  VNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            VNVQMISQGASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  567  VNVQMISQGASKVNISLVVNDSEAKQCVQALHSAFFE  603



>dbj|BAA95630.1| aspartate kinase [Oryza sativa]
Length=354

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  130  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTS  189

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  190  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  249

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVE LEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GVNVQM
Sbjct  250  ELIQQ--ELDHVVEGLEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGVNVQM  307

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  308  ISQGASKVNMSLIVHDSEAKQCIKALHQAFFE  339



>gb|EEE55936.1| hypothetical protein OsJ_04629 [Oryza sativa Japonica Group]
Length=552

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 198/220 (90%), Gaps = 8/220 (4%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  318  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTS  377

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  378  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  437

Query  395  DLIQQAS--------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLL  240
            +LIQQAS        ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL 
Sbjct  438  ELIQQASAPIYMQNQELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLR  497

Query  239  TNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
             +GVNVQMISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  498  KSGVNVQMISQGASKVNMSLIVHDSEAKQCIKALHQAFFE  537



>ref|XP_002882151.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58410.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 191/212 (90%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAY GAQVLHP SMRPA+EG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYIGAQVLHPLSMRPAQEGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR
Sbjct  391  IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ   ELD VVEELEKIA+VNLL+HRSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  451  ELIQH--ELDQVVEELEKIAIVNLLRHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  509  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  540



>emb|CDM85877.1| unnamed protein product [Triticum aestivum]
Length=563

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  392  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILEKAFHVL   GVNVQM
Sbjct  452  ELIQQ--ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKAFHVLRRIGVNVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+QCVEALH AFFE
Sbjct  510  ISQGASKVNMSLIVHDSEAKQCVEALHQAFFE  541



>ref|NP_001045271.1| Os01g0927900 [Oryza sativa Japonica Group]
 dbj|BAD88162.1| putative aspartate kinase [Oryza sativa Japonica Group]
 dbj|BAD88202.1| putative aspartate kinase [Oryza sativa Japonica Group]
 dbj|BAF07185.1| Os01g0927900 [Oryza sativa Japonica Group]
 dbj|BAG93334.1| unnamed protein product [Oryza sativa Japonica Group]
Length=570

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  346  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTS  405

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  406  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  465

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GVNVQM
Sbjct  466  ELIQQ--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGVNVQM  523

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  524  ISQGASKVNMSLIVHDSEAKQCIKALHQAFFE  555



>gb|EEC72085.1| hypothetical protein OsI_05030 [Oryza sativa Indica Group]
Length=570

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  346  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTS  405

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  406  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  465

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GVNVQM
Sbjct  466  ELIQQ--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGVNVQM  523

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  524  ISQGASKVNMSLIVHDSEAKQCIKALHQAFFE  555



>gb|ABK24292.1| unknown [Picea sitchensis]
Length=568

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+TRDMS+AVLTS
Sbjct  342  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRTRDMSKAVLTS  401

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLA+VFSIFE+LGISVDVVATSEVSISLTLDPSK+W R
Sbjct  402  IVLKRNVTMLDIVSTRMLGQFGFLARVFSIFEELGISVDVVATSEVSISLTLDPSKMWER  461

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+Q  ELD +VEELEK+AVV LLQ+RSIISLIGN+Q SSLILEK F V  T GVNVQM
Sbjct  462  ELIKQ--ELDRMVEELEKVAVVKLLQNRSIISLIGNIQYSSLILEKVFCVFRTLGVNVQM  519

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVN+SEAE CV+ALHS FF+
Sbjct  520  ISQGASKVNISLIVNESEAESCVKALHSTFFD  551



>ref|XP_003564987.1| PREDICTED: aspartokinase 2, chloroplastic-like [Brachypodium 
distachyon]
Length=567

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 197/212 (93%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA+ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  333  LTFEEASELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKRREMDKVVLTS  392

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            +VLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  393  LVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  452

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAFHVL  +GVNVQM
Sbjct  453  ELIQQ--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFHVLRKSGVNVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  511  ISQGASKVNMSLIVHDSEAKQCMKALHQAFFE  542



>ref|XP_006646639.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=560

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  336  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  396  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            DLIQQ  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  + VNVQM
Sbjct  456  DLIQQ--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSRVNVQM  513

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  514  ISQGASKVNMSLIVHDSEAKQCIKALHQAFFE  545



>dbj|BAJ99203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  392  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  451

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILEKAFHVL   GVNVQM
Sbjct  452  ELIQQ--ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKAFHVLRRIGVNVQM  509

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+ CVEALH AFFE
Sbjct  510  ISQGASKVNMSLIVHDSEAKLCVEALHQAFFE  541



>ref|XP_004310242.1| PREDICTED: aspartokinase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=561

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITK RDM++AVLTS
Sbjct  327  LTFEEAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNPKAPGTLITKARDMTKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK+N+T+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR
Sbjct  387  IVLKQNITLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSR  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD + EELEKIA VNLLQ RSIISLIGNVQ SSLILEKAF VL TN VNVQM
Sbjct  447  ELIQQ--ELDKMEEELEKIAFVNLLQQRSIISLIGNVQYSSLILEKAFQVLRTNQVNVQM  504

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAE CV+ALH AFFE
Sbjct  505  ISQGASKVNISLIVNDSEAEICVKALHHAFFE  536



>gb|KEH23492.1| monofunctional aspartokinase [Medicago truncatula]
Length=450

 Score =   352 bits (902),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 191/212 (90%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKA GTLITKTRDMS+A+LTS
Sbjct  219  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKASGTLITKTRDMSKALLTS  278

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVT LDI STRMLG  GFLAKVFSIFEDLGIS+D+VATSEVSISLTLDPSKLWSR
Sbjct  279  IVLKRNVTTLDIVSTRMLGTVGFLAKVFSIFEDLGISIDMVATSEVSISLTLDPSKLWSR  338

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKI+VVNLL++RSIISLIGNVQ SS ILEKAF VL + GVNVQM
Sbjct  339  ELIQQ--ELDYVVEELEKISVVNLLKNRSIISLIGNVQMSSKILEKAFQVLGSLGVNVQM  396

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VN+ EAEQ V  LH  FFE
Sbjct  397  ISQGASKVNISLVVNNDEAEQSVRTLHKIFFE  428



>emb|CDY06621.1| BnaC02g13450D [Brassica napus]
Length=576

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 191/216 (88%), Gaps = 4/216 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAA+LAYFGAQVLHP SMRPA EG IPVRVKNSYNP +PGTLIT++RDMS+AVLTS
Sbjct  327  LTFDEAAQLAYFGAQVLHPLSMRPASEGNIPVRVKNSYNPNSPGTLITRSRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI S RMLGQYGFL+KV S FE +GISVDVVATSEVS+SLTLDPSK  S+
Sbjct  387  IVLKRNVTMLDITSNRMLGQYGFLSKVLSTFEKMGISVDVVATSEVSVSLTLDPSKFCSK  446

Query  395  DLIQQAS---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQR-SSLILEKAFHVLLTNGV  228
            +LIQQAS   E++HVVEELEKIA VNLLQHRSIISLIGN QR SS ILEK F VL TNG+
Sbjct  447  ELIQQASFIWEINHVVEELEKIATVNLLQHRSIISLIGNFQRSSSFILEKGFRVLRTNGI  506

Query  227  NVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            NVQMISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  507  NVQMISQGASKVNISLIVNDDEAEHCVKALHSAFFE  542



>emb|CDY20797.1| BnaA02g09370D [Brassica napus]
Length=578

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 191/216 (88%), Gaps = 4/216 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAA+LAYFGAQVLHP SMRPA EG IPVRVKNSYNP APGTLIT++RDMS+AVLTS
Sbjct  327  LTFDEAAQLAYFGAQVLHPLSMRPASEGNIPVRVKNSYNPTAPGTLITRSRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI S RMLGQYGFL+KV S FE +GISVDVVATSEVS+SLTLDPSK  S+
Sbjct  387  IVLKRNVTMLDITSNRMLGQYGFLSKVLSTFEKMGISVDVVATSEVSVSLTLDPSKFCSK  446

Query  395  DLIQQAS---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQR-SSLILEKAFHVLLTNGV  228
            +LIQQAS   E++HVVEELEKIA VNLLQHRSIISLIGN QR SS ILEK F VL TNG+
Sbjct  447  ELIQQASFIWEINHVVEELEKIATVNLLQHRSIISLIGNFQRSSSFILEKGFRVLRTNGI  506

Query  227  NVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            N+QMISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  507  NIQMISQGASKVNISLIVNDDEAEHCVKALHSAFFE  542



>gb|AES80708.2| monofunctional aspartokinase [Medicago truncatula]
Length=557

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 191/212 (90%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKA GTLITKTRDMS+A+LTS
Sbjct  326  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKASGTLITKTRDMSKALLTS  385

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVT LDI STRMLG  GFLAKVFSIFEDLGIS+D+VATSEVSISLTLDPSKLWSR
Sbjct  386  IVLKRNVTTLDIVSTRMLGTVGFLAKVFSIFEDLGISIDMVATSEVSISLTLDPSKLWSR  445

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKI+VVNLL++RSIISLIGNVQ SS ILEKAF VL + GVNVQM
Sbjct  446  ELIQQ--ELDYVVEELEKISVVNLLKNRSIISLIGNVQMSSKILEKAFQVLGSLGVNVQM  503

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISL+VN+ EAEQ V  LH  FFE
Sbjct  504  ISQGASKVNISLVVNNDEAEQSVRTLHKIFFE  535



>ref|XP_006286781.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
 gb|EOA19679.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
Length=545

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  391  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQ+ +ELD+++EELEKIAVV LLQ RSIISLIGNV++SS ILEK F VL +NGVNVQM
Sbjct  451  ELIQRTNELDNLLEELEKIAVVKLLQRRSIISLIGNVKKSSQILEKVFQVLRSNGVNVQM  510

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_009127042.1| PREDICTED: aspartokinase 3, chloroplastic-like [Brassica rapa]
Length=573

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 189/213 (89%), Gaps = 3/213 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAA+LAYFGAQVLHP SMRPA EG IPVRVKNSYNP APGTLIT++RDMS+AVLTS
Sbjct  327  LTFDEAAQLAYFGAQVLHPLSMRPASEGNIPVRVKNSYNPTAPGTLITRSRDMSKAVLTS  386

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI S RMLGQYGFL+KV S FE +GISVDVVATSEVS+SLTLDPSK  S+
Sbjct  387  IVLKRNVTMLDITSNRMLGQYGFLSKVLSTFEKMGISVDVVATSEVSVSLTLDPSKFCSK  446

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQR-SSLILEKAFHVLLTNGVNVQ  219
            +LIQQ  E++H+VEELEKIA VNLLQHRSIISLIGN QR SS ILEK F VL TNG+NVQ
Sbjct  447  ELIQQ--EINHMVEELEKIASVNLLQHRSIISLIGNFQRSSSFILEKGFRVLRTNGINVQ  504

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  505  MISQGASKVNISLIVNDDEAEHCVKALHSAFFE  537



>ref|XP_004971149.1| PREDICTED: aspartokinase 1, chloroplastic-like [Setaria italica]
Length=554

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS
Sbjct  329  LTFEEATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLA+VFSIFEDLGISVD VATSEVSIS++LDPSK+WSR
Sbjct  389  IVLKSNVTMLDIVSTRMLGQFGFLARVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSR  448

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIA+V+LLQ R+IISLIGNV+RSSLILEK F VL   GVN+QM
Sbjct  449  ELIQQ--ELDNVVEELEKIAIVHLLQQRAIISLIGNVKRSSLILEKTFQVLRKCGVNIQM  506

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+ C++ALH AFFE
Sbjct  507  ISQGASKVNMSLIVHDSEAKACIKALHQAFFE  538



>ref|XP_011086875.1| PREDICTED: aspartokinase 2, chloroplastic [Sesamum indicum]
 ref|XP_011086876.1| PREDICTED: aspartokinase 2, chloroplastic [Sesamum indicum]
Length=570

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 191/212 (90%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA ELAYFGAQVLHP SMRPA +  IPVRVKNSYNPKAPGTLIT+ RDM++A+LTS
Sbjct  337  LTFEEATELAYFGAQVLHPLSMRPAMDASIPVRVKNSYNPKAPGTLITRNRDMTKALLTS  396

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK+N+TMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK+WSR
Sbjct  397  IVLKQNITMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKIWSR  456

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+Q  ELDHV+EEL KIAVV LL HRSIISLIGN+Q SSLILEKAF V     VNVQM
Sbjct  457  ELIKQ--ELDHVIEELGKIAVVKLLPHRSIISLIGNIQYSSLILEKAFSVFGRINVNVQM  514

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIVNDSEAEQC++ALH+AFFE
Sbjct  515  ISQGASKVNMSLIVNDSEAEQCIKALHNAFFE  546



>gb|ACR35433.1| unknown [Zea mays]
Length=380

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 189/212 (89%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+ RDM + VLTS
Sbjct  156  LTFEEATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRQRDMDKVVLTS  215

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLA+VF+IFEDL ISVD VATSEVS+S++LDPSK+WSR
Sbjct  216  IVLKSNVTMLDIVSTRMLGQYGFLARVFAIFEDLCISVDCVATSEVSVSVSLDPSKIWSR  275

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+V LLQ R+IISLIGNV++SSLILEK   VL  +GVNVQM
Sbjct  276  ELIQQ--ELDHVVEELEKIAIVRLLQQRAIISLIGNVEQSSLILEKTGRVLRKSGVNVQM  333

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DS+A+  VEALH AFFE
Sbjct  334  ISQGASKVNMSLIVHDSDAKALVEALHQAFFE  365



>ref|XP_002459021.1| hypothetical protein SORBIDRAFT_03g044650 [Sorghum bicolor]
 gb|EES04141.1| hypothetical protein SORBIDRAFT_03g044650 [Sorghum bicolor]
Length=555

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 191/212 (90%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK RDM + VLTS
Sbjct  331  LTFEEATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQRDMDKVVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLA+VF+IFEDLGISVD VATSEVS+S++LDPSK+WSR
Sbjct  391  IVLKSNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDCVATSEVSVSVSLDPSKIWSR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELD+VVEELEKIA+V+LLQ R+IISLIGNV++ SLILEK  HVL  +GVNVQM
Sbjct  451  ELIQQ--ELDNVVEELEKIAIVHLLQQRAIISLIGNVRQMSLILEKTGHVLRKSGVNVQM  508

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+  VEALH AFF+
Sbjct  509  ISQGASKVNMSLIVHDSEAKALVEALHQAFFQ  540



>gb|KJB33203.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=543

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 178/188 (95%), Gaps = 2/188 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTS
Sbjct  334  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQM
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQM  511

Query  215  ISQGASKV  192
            ISQGASKV
Sbjct  512  ISQGASKV  519



>gb|KHG14818.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=536

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 181/212 (85%), Gaps = 22/212 (10%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSE               
Sbjct  399  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSE---------------  443

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
                   ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQM
Sbjct  444  -------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQM  496

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  497  ISQGASKVNISLIVHDNEAEQCVRALHSTFFE  528



>gb|KCW55774.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=539

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 178/188 (95%), Gaps = 2/188 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+TRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEK F+VL TNGVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQM  513

Query  215  ISQGASKV  192
            ISQGASKV
Sbjct  514  ISQGASKV  521



>ref|XP_002992028.1| hypothetical protein SELMODRAFT_162121 [Selaginella moellendorffii]
 gb|EFJ06877.1| hypothetical protein SELMODRAFT_162121 [Selaginella moellendorffii]
Length=468

 Score =   339 bits (870),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 183/212 (86%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEA ELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP  PGTLITK RDMSE +LTS
Sbjct  245  LTFDEATELAYFGAQVLHPQSMRPAREANIPVRVKNSYNPHVPGTLITKKRDMSETLLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRN+TMLDI STRMLGQ GFLAKVFS FE+LGISVDVVATSEVSISLTLDP K+WSR
Sbjct  305  IVLKRNITMLDIVSTRMLGQVGFLAKVFSTFEELGISVDVVATSEVSISLTLDPIKIWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            DLIQ  +ELD++V +L KIA V LLQ RSIISLIGNV+RSSL+L+K F V    GV VQM
Sbjct  365  DLIQ--TELDNMVTKLRKIAKVKLLQKRSIISLIGNVERSSLVLKKVFSVFEELGVKVQM  422

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAE+CV  LHSAFFE
Sbjct  423  ISQGASKVNISLIVNDSEAERCVRELHSAFFE  454



>gb|EYU28463.1| hypothetical protein MIMGU_mgv1a005583mg [Erythranthe guttata]
Length=478

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 188/212 (89%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELA+FGAQVLHPQSMRPA +G IPVRVKNSYNPKAPGTLIT  RDM++A+LTS
Sbjct  245  LTFEEAAELAFFGAQVLHPQSMRPAMDGNIPVRVKNSYNPKAPGTLITGNRDMTKALLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK+NV MLDI STRMLGQ+GFLAKVF+IFEDL ISVDVVATSEVSISLTLDPSK+WSR
Sbjct  305  IVLKQNVLMLDIVSTRMLGQFGFLAKVFAIFEDLDISVDVVATSEVSISLTLDPSKIWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LI+Q  ELD V EEL KIA+V LL HRSIISLIGN+Q SSLILEKAF+V     VNVQM
Sbjct  365  ELIKQ--ELDRVAEELGKIAIVKLLPHRSIISLIGNIQYSSLILEKAFNVFGKINVNVQM  422

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SL+VNDSEAE+CV+ALH  FFE
Sbjct  423  ISQGASKVNMSLVVNDSEAEECVKALHYDFFE  454



>ref|XP_002964498.1| hypothetical protein SELMODRAFT_142417 [Selaginella moellendorffii]
 gb|EFJ34831.1| hypothetical protein SELMODRAFT_142417 [Selaginella moellendorffii]
Length=468

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 183/212 (86%), Gaps = 2/212 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEA ELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP  PGTLITK RDMSE +LTS
Sbjct  245  LTFDEATELAYFGAQVLHPQSMRPAREANIPVRVKNSYNPHVPGTLITKKRDMSETLLTS  304

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRN+TMLDI STRMLGQ GFLAKVFS FE+LGISVDVVATSEVSISLTLDP K+WSR
Sbjct  305  IVLKRNITMLDIVSTRMLGQVGFLAKVFSTFEELGISVDVVATSEVSISLTLDPIKIWSR  364

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            DLIQ  +ELD++V +L KIA V LLQ RSIISLIGNV+RSSL+L+K F V    G+ VQM
Sbjct  365  DLIQ--TELDNMVTKLRKIAKVKLLQKRSIISLIGNVERSSLVLKKVFSVFEELGIKVQM  422

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAE+CV  LHSAFFE
Sbjct  423  ISQGASKVNISLIVNDSEAERCVRELHSAFFE  454



>ref|XP_010656844.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Vitis vinifera]
Length=534

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 179/190 (94%), Gaps = 2/190 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQ+MRPARE  IPVRVKNSYNP+APGTLI KTRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQAMRPARESDIPVRVKNSYNPEAPGTLINKTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGN+QRSSLILEKAF+VL T GVNVQM
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQRSSLILEKAFNVLRTIGVNVQM  513

Query  215  ISQGASKVNI  186
            ISQGASK+ I
Sbjct  514  ISQGASKILI  523



>ref|XP_003624490.1| Aspartokinase [Medicago truncatula]
Length=602

 Score =   341 bits (874),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 179/243 (74%), Positives = 191/243 (79%), Gaps = 31/243 (13%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKA GTLITKTRDMS+A+LTS
Sbjct  338  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKASGTLITKTRDMSKALLTS  397

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVT LDI STRMLG  GFLAKVFSIFEDLGIS+D+VATSEVSISLTLDPSKLWSR
Sbjct  398  IVLKRNVTTLDIVSTRMLGTVGFLAKVFSIFEDLGISIDMVATSEVSISLTLDPSKLWSR  457

Query  395  DLIQQA-------------------------------SELDHVVEELEKIAVVNLLQHRS  309
            +LIQQ                                 ELD+VVEELEKI+VVNLL++RS
Sbjct  458  ELIQQGQDIESRKVGYRVQGSAVIYGVQRHRCFFSETKELDYVVEELEKISVVNLLKNRS  517

Query  308  IISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSA  129
            IISLIGNVQ SS ILEKAF VL + GVNVQMISQGASKVNISL+VN+ EAEQ V  LH  
Sbjct  518  IISLIGNVQMSSKILEKAFQVLGSLGVNVQMISQGASKVNISLVVNNDEAEQSVRTLHKI  577

Query  128  FFE  120
            FFE
Sbjct  578  FFE  580



>ref|XP_006287431.1| hypothetical protein CARUB_v10000635mg [Capsella rubella]
 gb|EOA20329.1| hypothetical protein CARUB_v10000635mg [Capsella rubella]
Length=548

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTS
Sbjct  337  LTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTS  396

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  397  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSR  456

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQM
Sbjct  457  ELIQQ--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQM  514

Query  215  ISQGASKVN  189
            ISQGASKVN
Sbjct  515  ISQGASKVN  523



>gb|KHG00746.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=517

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 179/208 (86%), Gaps = 22/208 (11%)
 Frame = -1

Query  743  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  564
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTSIVLK
Sbjct  316  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTSIVLK  375

Query  563  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  384
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSE                   
Sbjct  376  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSE-------------------  416

Query  383  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  204
               ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  417  ---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  473

Query  203  ASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ASKVNISL+VND+EAE+CV ALHS+FFE
Sbjct  474  ASKVNISLVVNDNEAEECVRALHSSFFE  501



>gb|KEH25642.1| monofunctional aspartokinase [Medicago truncatula]
Length=515

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 177/190 (93%), Gaps = 2/190 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLITK RDMS+AVLT
Sbjct  327  FLTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITKERDMSKAVLT  386

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWS
Sbjct  387  SIVLKRNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWS  446

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R+LIQQ  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GV VQ
Sbjct  447  RELIQQ--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQQSSLILEKAFRVLRTLGVTVQ  504

Query  218  MISQGASKVN  189
            MISQGASKV+
Sbjct  505  MISQGASKVS  514



>ref|XP_006300265.1| hypothetical protein CARUB_v100158420mg, partial [Capsella rubella]
 gb|EOA33163.1| hypothetical protein CARUB_v100158420mg, partial [Capsella rubella]
Length=209

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  25   LTFDEAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTS  84

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FE+LGISVDVVATSEVSISLTLDPSK  SR
Sbjct  85   IVLKRNVTMLDITSTRMLGQYGFLAKVFSTFENLGISVDVVATSEVSISLTLDPSKFCSR  144

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +LIQQ  ELDHVVEELEKIA+VNLL+HRSIISLIGNVQRSS ILEK F VL TNG+NVQM
Sbjct  145  ELIQQ--ELDHVVEELEKIAIVNLLRHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQM  202

Query  215  ISQGASK  195
            ISQGASK
Sbjct  203  ISQGASK  209



>ref|XP_006399914.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41367.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=554

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTS
Sbjct  331  LTFDEAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTS  390

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R
Sbjct  391  IVLKRNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGR  450

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            +++Q+A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQM
Sbjct  451  EIVQRANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQM  510

Query  215  ISQGASKVNI  186
            ISQGASKV I
Sbjct  511  ISQGASKVEI  520



>emb|CDX85659.1| BnaA02g01540D [Brassica napus]
Length=554

 Score =   332 bits (850),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 178/213 (84%), Gaps = 22/213 (10%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++ VLT
Sbjct  338  FLTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKTVLT  397

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE              
Sbjct  398  SIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE--------------  443

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                    ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQ
Sbjct  444  --------ELDHVVEELEKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQ  495

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND+EAE CVEALH +FFE
Sbjct  496  MISQGASKVNISLIVNDAEAEGCVEALHKSFFE  528



>emb|CDX91135.1| BnaC02g04620D [Brassica napus]
Length=555

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 178/212 (84%), Gaps = 22/212 (10%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++ VLTS
Sbjct  340  LTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKTVLTS  399

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE               
Sbjct  400  IVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE---------------  444

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
                   ELDHVVEEL+KIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQM
Sbjct  445  -------ELDHVVEELKKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQM  497

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVND+EAE CVEALH +FFE
Sbjct  498  ISQGASKVNISLIVNDAEAEGCVEALHKSFFE  529



>emb|CDY09781.1| BnaC09g43800D [Brassica napus]
Length=550

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 176/213 (83%), Gaps = 22/213 (10%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLT
Sbjct  334  FLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLT  393

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE              
Sbjct  394  SIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE--------------  439

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                    ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQ
Sbjct  440  --------ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQ  491

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND EAE CVEALH +FFE
Sbjct  492  MISQGASKVNISLIVNDDEAEGCVEALHKSFFE  524



>emb|CDX69652.1| BnaA10g20010D [Brassica napus]
Length=551

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 176/213 (83%), Gaps = 22/213 (10%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLT
Sbjct  335  FLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLT  394

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLKRNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE              
Sbjct  395  SIVLKRNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE--------------  440

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                    ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQ
Sbjct  441  --------ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQ  492

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNISLIVND EAE CVEALH +FFE
Sbjct  493  MISQGASKVNISLIVNDDEAEGCVEALHKSFFE  525



>ref|XP_007223118.1| hypothetical protein PRUPE_ppa003770mg [Prunus persica]
 gb|EMJ24317.1| hypothetical protein PRUPE_ppa003770mg [Prunus persica]
Length=550

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 176/212 (83%), Gaps = 22/212 (10%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITKTRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPARDGEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK+NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSE               
Sbjct  396  IVLKQNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSE---------------  440

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
                   ELD + EELEKIA VNLLQ RSIISLIGNVQ SSLILEKAFHVL TN VNVQM
Sbjct  441  -------ELDKMEEELEKIAFVNLLQRRSIISLIGNVQYSSLILEKAFHVLRTNQVNVQM  493

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  494  ISQGASKVNISLIVNDSEAEKCVKALHHAFFE  525



>gb|EMT09778.1| Aspartokinase 1, chloroplastic [Aegilops tauschii]
Length=418

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 173/212 (82%), Gaps = 22/212 (10%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTS
Sbjct  205  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTS  264

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSE               
Sbjct  265  IVLKSNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSE---------------  309

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
                   ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILEKAFHVL   GVNVQM
Sbjct  310  -------ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKAFHVLRRIGVNVQM  362

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ISQGASKVN+SLIV+DSEA+ CVEALH AFFE
Sbjct  363  ISQGASKVNMSLIVHDSEAKLCVEALHQAFFE  394



>ref|NP_001146022.1| uncharacterized protein LOC100279553 [Zea mays]
 gb|ACL53049.1| unknown [Zea mays]
Length=204

 Score =   307 bits (786),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = -1

Query  692  MRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIASTRMLGQY  513
            MRPAREG IPVRVKNSYNPKAPGTLIT+ RDM + VLTSIVLK NVTMLDI STRMLGQY
Sbjct  1    MRPAREGDIPVRVKNSYNPKAPGTLITRQRDMDKVVLTSIVLKSNVTMLDIVSTRMLGQY  60

Query  512  GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAV  333
            GFLA+VF+IFEDL ISVD VATSEVS+S++LDPSK+WSR+LIQQ  ELDHVVEELEKIA+
Sbjct  61   GFLARVFAIFEDLCISVDCVATSEVSVSVSLDPSKIWSRELIQQ--ELDHVVEELEKIAI  118

Query  332  VNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQ  153
            V LLQ R+IISLIGNV++SSLILEK   VL  +GVNVQMISQGASKVN+SLIV+DS+A+ 
Sbjct  119  VRLLQQRAIISLIGNVEQSSLILEKTGRVLRKSGVNVQMISQGASKVNMSLIVHDSDAKA  178

Query  152  CVEALHSAFFE  120
             VEALH AFFE
Sbjct  179  LVEALHQAFFE  189



>ref|XP_006844541.1| hypothetical protein AMTR_s00016p00169310 [Amborella trichopoda]
 gb|ERN06216.1| hypothetical protein AMTR_s00016p00169310 [Amborella trichopoda]
Length=464

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 158/168 (94%), Gaps = 2/168 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSY PKAPGTLITK RDMSEAVLTS
Sbjct  289  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYKPKAPGTLITKARDMSEAVLTS  348

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  349  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  408

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF  252
            DLIQQ  ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEK F
Sbjct  409  DLIQQ--ELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKDF  454



>ref|XP_001773420.1| predicted protein [Physcomitrella patens]
 gb|EDQ61793.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 179/219 (82%), Gaps = 7/219 (3%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T DEA+ELAYFGAQVLHPQSMRPAR+  IPVRVKNSYNP+APGTLIT  RDMSEA +T
Sbjct  347  FLTFDEASELAYFGAQVLHPQSMRPARDANIPVRVKNSYNPQAPGTLITGERDMSEAEMT  406

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLK++VTMLDI STRMLGQ GFLAKVF+ FE LGISVDVVATSEVSISLTLDPSKLW 
Sbjct  407  SIVLKKDVTMLDIQSTRMLGQVGFLAKVFTTFEHLGISVDVVATSEVSISLTLDPSKLWE  466

Query  398  RDLIQQAS-------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLL  240
            R+LI+QAS       ELD +  EL KIA V LL+ +SIISLI NV++SS +LEK F V  
Sbjct  467  RELIEQASQCLWLQQELDKMKSELSKIANVQLLKKKSIISLISNVKQSSAVLEKVFRVFK  526

Query  239  TNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             N +NVQMISQGASKVNIS++V+D +A +CV+ LH  F+
Sbjct  527  KNDINVQMISQGASKVNISMVVDDDDAPKCVQELHKVFW  565



>gb|AFW74642.1| hypothetical protein ZEAMMB73_320357 [Zea mays]
Length=487

 Score =   309 bits (792),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 177/198 (89%), Gaps = 2/198 (1%)
 Frame = -1

Query  713  QVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIAS  534
            QVLHPQSMRPAREG IPV VKNSYN KAPGT+IT+ RDM + VLTSIVLK NVTMLDI S
Sbjct  277  QVLHPQSMRPAREGDIPVMVKNSYNAKAPGTIITRQRDMDKVVLTSIVLKSNVTMLDIVS  336

Query  533  TRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVE  354
            TRMLGQYGFLA+VF+IFEDL I VD VATSEVS+S++LDPSK+WSR+LIQQ  ELDHVVE
Sbjct  337  TRMLGQYGFLARVFAIFEDLCIYVDCVATSEVSVSVSLDPSKIWSRELIQQ--ELDHVVE  394

Query  353  ELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIV  174
            ELEKIA+V LLQ R+IISLIGNV++SSLIL+K  HVL  +G+NVQMISQGASKVN+SLIV
Sbjct  395  ELEKIAIVRLLQQRAIISLIGNVEQSSLILQKMGHVLRKSGINVQMISQGASKVNMSLIV  454

Query  173  NDSEAEQCVEALHSAFFE  120
            +DS+A++ VEALH AFF+
Sbjct  455  HDSDAKELVEALHQAFFK  472



>gb|KJB33202.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=511

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/173 (90%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTS
Sbjct  334  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  237
            +LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK  H L++
Sbjct  454  ELIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVLHHLVS  504



>gb|KCW55775.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=525

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+TRDMS+AVLTS
Sbjct  336  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRTRDMSKAVLTS  395

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR
Sbjct  396  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  455

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK  258
            +LIQQ  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEK
Sbjct  456  ELIQQ--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEK  499



>ref|XP_001780779.1| predicted protein [Physcomitrella patens]
 gb|EDQ54418.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 178/212 (84%), Gaps = 3/212 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
              T +EA+ELAYFGAQVLHPQSMRPAR+  IPVRVKNSYNPKAPGTLIT+ RDMS+  +T
Sbjct  306  FLTFNEASELAYFGAQVLHPQSMRPARDANIPVRVKNSYNPKAPGTLITRERDMSQVEMT  365

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLK++VTMLDI STRMLGQ GFLAKVF+ FE+LGISVDVVATSEVSISLTLDP+KLW 
Sbjct  366  SIVLKKDVTMLDIQSTRMLGQVGFLAKVFTTFEELGISVDVVATSEVSISLTLDPAKLWE  425

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
            R LI+QA+++     EL +IA V LL+ ++IISLI NV++SS +LEK F V  +N +NVQ
Sbjct  426  RALIEQANKMKS---ELSRIANVQLLKKKAIISLISNVKQSSAVLEKVFSVFKSNNINVQ  482

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            MISQGASKVNIS++V+D +  +CV+ LH AF+
Sbjct  483  MISQGASKVNISMVVDDDDGPKCVQELHQAFW  514



>gb|ABF99918.1| aspartate kinase family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   294 bits (752),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPA+EG IPVRVKNSYN +APGT+ITKTRD+S+++LTS
Sbjct  328  LTFEEAAELAYFGAQVLHPQSMRPAKEGDIPVRVKNSYNRRAPGTVITKTRDLSKSILTS  387

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R
Sbjct  388  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCR  447

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK  258
            +LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEK
Sbjct  448  ELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEK  491



>gb|ACN41167.1| unknown [Picea sitchensis]
Length=175

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = -1

Query  599  MSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTL  420
            MS+AVLTSIVLKRNVTMLDI STRMLGQ+GFLA+VFSIFE+LGISVDVVATSEVSISLTL
Sbjct  1    MSKAVLTSIVLKRNVTMLDIVSTRMLGQFGFLARVFSIFEELGISVDVVATSEVSISLTL  60

Query  419  DPSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLL  240
            DPSK+W R+LI+Q  ELD +VEELEK+AVV LLQ+RSIISLIGN+Q SSLILEK F V  
Sbjct  61   DPSKMWERELIKQ--ELDRMVEELEKVAVVKLLQNRSIISLIGNIQYSSLILEKVFCVFR  118

Query  239  TNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            T GVNVQMISQGASKVNISLIVN+SEAE CV+ALHS FF+
Sbjct  119  TLGVNVQMISQGASKVNISLIVNESEAESCVKALHSTFFD  158



>ref|XP_008647236.1| PREDICTED: aspartokinase 1, chloroplastic-like, partial [Zea 
mays]
Length=270

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 146/165 (88%), Gaps = 3/165 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI+  +     VLTS
Sbjct  109  LTFEEATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLISYYQTKG-IVLTS  167

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQYGFLA+VF+IFEDL ISVD VATSEVS+S++LDPSK+WSR
Sbjct  168  IVLKSNVTMLDIVSTRMLGQYGFLARVFAIFEDLCISVDCVATSEVSVSVSLDPSKIWSR  227

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILE  261
            +LIQQ  ELDHVVEELEKIA+V LLQ R+IISLIGNV++SSLILE
Sbjct  228  ELIQQ--ELDHVVEELEKIAIVRLLQQRAIISLIGNVEQSSLILE  270



>gb|EMS47783.1| Aspartokinase 1, chloroplastic [Triticum urartu]
Length=534

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 154/219 (70%), Gaps = 49/219 (22%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTS
Sbjct  332  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTS  391

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK NVTMLDI STRMLGQ+GFLAK                                  
Sbjct  392  IVLKSNVTMLDIVSTRMLGQFGFLAK----------------------------------  417

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILE--------KAFHVLL  240
                   ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILE        KAFHVL 
Sbjct  418  -------ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKTNPYSHLKAFHVLR  470

Query  239  TNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
              GVNVQMISQGASKVN+SLIV+DSEA+ CVEALH AFF
Sbjct  471  RIGVNVQMISQGASKVNMSLIVHDSEAKLCVEALHQAFF  509



>ref|XP_011399436.1| Aspartokinase 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26498.1| Aspartokinase 1, chloroplastic [Auxenochlorella protothecoides]
Length=501

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 166/216 (77%), Gaps = 4/216 (2%)
 Frame = -1

Query  761  AIFTXDEAAELAYFGAQVLHPQSMRPARE-GGIPVRVKNSYNPKAPGTLITKTRDMSEAV  585
            A  T +EA ELA+FGA VLHPQ+M+PA+E GG+ VRVKNSYN  APGTLI+  RDM++A+
Sbjct  288  AQLTFEEATELAFFGATVLHPQAMQPAQEVGGMGVRVKNSYNRLAPGTLISAERDMADAL  347

Query  584  LTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK-  408
             T+IVLK NVTM+DI+STRMLGQYGFLA+VF +F    +SVDVVATSE+S+SLTLDP++ 
Sbjct  348  CTAIVLKSNVTMVDISSTRMLGQYGFLARVFDVFARQKLSVDVVATSEISVSLTLDPART  407

Query  407  LWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGV  228
            LW RDLI+   EL+ ++     IA  +  +  SII LI NVQR+S ILE+ F+VL    V
Sbjct  408  LWERDLIED--ELEGLMAAFAGIAKASYRRGMSIICLICNVQRTSTILERVFNVLGREAV  465

Query  227  NVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            NVQM+SQGASK NISLIV D EA + V ALH+ FFE
Sbjct  466  NVQMMSQGASKTNISLIVRDGEAPRAVAALHAEFFE  501



>ref|XP_005846857.1| hypothetical protein CHLNCDRAFT_134660 [Chlorella variabilis]
 gb|EFN54755.1| hypothetical protein CHLNCDRAFT_134660 [Chlorella variabilis]
Length=477

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 163/211 (77%), Gaps = 2/211 (1%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EA ELA+FGA VLHP +M+PA E  + VRVKNSYN +APGTLI++ RDMS +++TS
Sbjct  264  LTFEEATELAFFGATVLHPLAMQPAHECNVGVRVKNSYNRQAPGTLISEVRDMSTSLMTS  323

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IV+K NVT++D+ STRM+GQ+GFLAKVF +F D  ISVDVVATSEVSISLTLDP+K+W R
Sbjct  324  IVMKSNVTLVDVVSTRMMGQFGFLAKVFKVFSDNKISVDVVATSEVSISLTLDPAKIWER  383

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            DLI  A EL+ ++++ E +A  +  +  +IISLI NVQR+S ILE+ F VL    + VQM
Sbjct  384  DLI--AEELEGLMQDFEGVAKAHYRRGMAIISLICNVQRTSQILERTFRVLNRENIRVQM  441

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            +SQGASK NI+LIV DSEA+  +  LH  FF
Sbjct  442  MSQGASKTNIALIVEDSEAKHALRVLHDEFF  472



>ref|XP_003074218.1| putative precursor monofunctional aspartokina (ISS) [Ostreococcus 
tauri]
Length=423

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 159/212 (75%), Gaps = 4/212 (2%)
 Frame = -1

Query  743  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLITKTR--DM-SEAVLTS  576
            EA ELAYFGAQVLHP SMRPA + G + VRVKNSYN +APGT+I   R  D+  + +LTS
Sbjct  212  EATELAYFGAQVLHPHSMRPAMDSGKLAVRVKNSYNIRAPGTVIGHKRAEDLHKDWLLTS  271

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IV K+NVTMLDI STRMLGQYGFLAKVF+I    GISVDVVATSEVS+SLTLDPSKLW R
Sbjct  272  IVRKKNVTMLDITSTRMLGQYGFLAKVFNIMATNGISVDVVATSEVSVSLTLDPSKLWER  331

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            DL ++  E   +  E + IA V +    SIISLIGNV+R++ I+E+AF  L +  + V+M
Sbjct  332  DLAKEELEKLKLDFENDGIANVAVSSGHSIISLIGNVERNNEIMERAFRALGSKDIKVKM  391

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            +SQGASK NISL+VNDS+      A+H+ FFE
Sbjct  392  VSQGASKTNISLLVNDSQGADAARAIHAEFFE  423



>ref|XP_001415789.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94081.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=463

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = -1

Query  743  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLITKTRDMSEA---VLTS  576
            EA ELAYFGAQVLHP SMRPA +   + VRVKNSYN +APGT+I   RD  E    +LTS
Sbjct  251  EATELAYFGAQVLHPHSMRPAMDSSDLCVRVKNSYNIRAPGTVIGHVRDEDEHKNWLLTS  310

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IV K+NVTMLDI STRMLGQYGFLAKVFS+    GISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  311  IVQKKNVTMLDITSTRMLGQYGFLAKVFSVMASNGISVDVVATSEVSVSLTLDPSKLWSR  370

Query  395  DLIQQASELDHVVEELEK--IAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  222
            DL ++  EL+ +V++ E   IA V +    SIISLIGNV+R++ I+E++F  L +  + V
Sbjct  371  DLAKE--ELEKLVQDFENEGIAHVTVSSGHSIISLIGNVERNNEIMERSFRALGSEDIKV  428

Query  221  QMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            +M+SQGASK NISL+V+  +    V A+HS FF
Sbjct  429  KMVSQGASKTNISLLVDQEQGSDAVRAIHSEFF  461



>gb|KJB11755.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=416

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -1

Query  512  GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAV  333
            GFL KVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQQASELDHVVEELEKIAV
Sbjct  278  GFLGKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQQASELDHVVEELEKIAV  337

Query  332  VNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQ  153
            VNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQGASKVNISLIV+D+EAEQ
Sbjct  338  VNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQGASKVNISLIVHDTEAEQ  397

Query  152  CVEALHSAFFE  120
            CV ALHS FFE
Sbjct  398  CVRALHSTFFE  408



>gb|KDD72939.1| amino acid kinase [Helicosporidium sp. ATCC 50920]
Length=499

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 163/213 (77%), Gaps = 4/213 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPARE-GGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
             T +EA ELA+FGA VLHP +M+PA+E GG+ VRVKNSYN  APGT I  +RD+ EA++T
Sbjct  283  LTYEEATELAFFGATVLHPLAMQPAQEVGGMAVRVKNSYNRAAPGTRIAASRDLHEALVT  342

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK-LW  402
            SIVLK+NVT++DI ST+MLG YGFLA+VF +F +  +SVDVVATSEVS+SLTLDP+K LW
Sbjct  343  SIVLKQNVTLVDIVSTKMLGTYGFLARVFGVFAEHKLSVDVVATSEVSVSLTLDPAKTLW  402

Query  401  SRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  222
             RDLI+   EL+ +      IA  +  +  SI+ +I NVQR+S ILE+ F+VL   GVNV
Sbjct  403  ERDLIED--ELEALTAGFAGIARASYRRGMSILGIICNVQRTSTILERVFNVLGREGVNV  460

Query  221  QMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            QM+SQGASK NISLIV+D+E+E+ +  LH  FF
Sbjct  461  QMMSQGASKTNISLIVSDAESERVLTCLHDEFF  493



>emb|CEF96568.1| Aspartate kinase, conserved site [Ostreococcus tauri]
Length=520

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 159/212 (75%), Gaps = 4/212 (2%)
 Frame = -1

Query  743  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLITKTR--DM-SEAVLTS  576
            EA ELAYFGAQVLHP SMRPA + G + VRVKNSYN +APGT+I   R  D+  + +LTS
Sbjct  309  EATELAYFGAQVLHPHSMRPAMDSGKLAVRVKNSYNIRAPGTVIGHKRAEDLHKDWLLTS  368

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IV K+NVTMLDI STRMLGQYGFLAKVF+I    GISVDVVATSEVS+SLTLDPSKLW R
Sbjct  369  IVRKKNVTMLDITSTRMLGQYGFLAKVFNIMATNGISVDVVATSEVSVSLTLDPSKLWER  428

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            DL ++  E   +  E + IA V +    SIISLIGNV+R++ I+E+AF  L +  + V+M
Sbjct  429  DLAKEELEKLKLDFENDGIANVAVSSGHSIISLIGNVERNNEIMERAFRALGSKDIKVKM  488

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            +SQGASK NISL+VNDS+      A+H+ FFE
Sbjct  489  VSQGASKTNISLLVNDSQGADAARAIHAEFFE  520



>ref|XP_002507216.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68474.1| predicted protein [Micromonas sp. RCC299]
Length=498

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 166/213 (78%), Gaps = 9/213 (4%)
 Frame = -1

Query  743  EAAELAYFGAQVLHPQSMRPAREG-GIPVRVKNSYNPKAPGTLI---TKTRDMSEAVLTS  576
            EA ELAYFGAQVLHPQSMRPA +   + VRVKNSYN +APGTLI     TRD S+ +LT+
Sbjct  276  EATELAYFGAQVLHPQSMRPAMDSDSLCVRVKNSYNIEAPGTLIGHVRSTRD-SDWILTA  334

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IV K+NVT+LD+ STRMLGQYGFLA+VF++ E   ISVD +ATSEVS+SLTLDP+KLWSR
Sbjct  335  IVRKKNVTLLDVVSTRMLGQYGFLARVFAVMEKARISVDCIATSEVSVSLTLDPAKLWSR  394

Query  395  DLIQQASELDHVVEELEK--IAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  222
            DL+++  EL+ +V + E   IA V+     S++SLIGNV+R++ I+E++F  L + G+ V
Sbjct  395  DLVKE--ELEALVRDFENNGIARVSYTTGNSLVSLIGNVERNNEIMERSFRALGSAGIRV  452

Query  221  QMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            +M+SQGASK NISL+V++S+  Q V A+H+ FF
Sbjct  453  KMVSQGASKTNISLLVSESQGAQAVRAIHAEFF  485



>ref|XP_007515683.1| aspartate kinase [Bathycoccus prasinos]
 emb|CCO14562.1| aspartate kinase [Bathycoccus prasinos]
Length=576

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 168/228 (74%), Gaps = 18/228 (8%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLIT---------K  609
              + DEA ELAYFGAQVLHPQ+MRPA + G + VRVKNSYN +APGT+I          K
Sbjct  337  FLSFDEAQELAYFGAQVLHPQAMRPAMDNGSLRVRVKNSYNIRAPGTVIGHIDYNSSDGK  396

Query  608  TRD----MSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSE  441
            + D    M + +LTSIV K+NVTMLDI STRMLGQYGFLA+VF++ +  GISVDVVATSE
Sbjct  397  SGDEGERMDDWLLTSIVRKKNVTMLDIVSTRMLGQYGFLAEVFAVLQHNGISVDVVATSE  456

Query  440  VSISLTLDPSKLWSRDLIQQASELDHVVEELEKI--AVVNLLQHRSIISLIGNVQRSSLI  267
            VS+SLTLDP+K+WSRDL Q+  EL+ V  ELE +  A V +    SIISLIGN++R++ I
Sbjct  457  VSVSLTLDPAKIWSRDLAQE--ELEKVQRELEDVGTARVAVSNGHSIISLIGNLERNNEI  514

Query  266  LEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            +E+AF  L    V+V+M+SQGASK NISL+V+D+E ++   A+H  FF
Sbjct  515  MERAFKALKEAKVHVKMVSQGASKCNISLLVDDAEGQKAASAIHEEFF  562



>gb|KDO43561.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=456

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTS
Sbjct  329  LTFDEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTS  388

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  389  IVLKRNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSR  448

Query  395  DLIQQAS  375
            +LIQQAS
Sbjct  449  ELIQQAS  455



>gb|KJB11757.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=474

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTS
Sbjct  339  LTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTS  398

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLKRNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR
Sbjct  399  IVLKRNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSR  458

Query  395  DLIQQAS  375
            +LIQQAS
Sbjct  459  ELIQQAS  465



>ref|XP_005650639.1| aspartate kinase [Coccomyxa subellipsoidea C-169]
 gb|EIE26095.1| aspartate kinase [Coccomyxa subellipsoidea C-169]
Length=458

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 157/213 (74%), Gaps = 3/213 (1%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPA-REGGIPVRVKNSYNPKAPGTLITKTRDMSEAVL  582
            + T +EA+ELA+FGA VLHP +M+PA +   + VRVKNSYN  A GTLI + RDM+  ++
Sbjct  246  LLTYEEASELAFFGATVLHPSAMQPALQTSNLDVRVKNSYNRMAAGTLICRERDMTNVLM  305

Query  581  TSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLW  402
            TSIVLK NVT+LDI STRMLGQYGFL+KVF +F D  +SVDVVATSE+S+SLTLDPSK+W
Sbjct  306  TSIVLKTNVTLLDIVSTRMLGQYGFLSKVFDVFRDNEVSVDVVATSEISVSLTLDPSKIW  365

Query  401  SRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  222
             R       E++ ++      A V+   + SIISLI NV R+S ILE+ F VL    VNV
Sbjct  366  DR--ELIEEEIEALMSAFSGFAKVSCTHNVSIISLICNVARTSNILERVFRVLGRQDVNV  423

Query  221  QMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            +M+SQGASK NISLIV+DSEA+Q V ALH  FF
Sbjct  424  KMMSQGASKTNISLIVSDSEAKQVVRALHDEFF  456



>gb|EKD81471.1| hypothetical protein ACD_39C01793G0002, partial [uncultured bacterium]
Length=438

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 154/209 (74%), Gaps = 10/209 (5%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  567
            +EA+ELAYFGA+VLHP+S+ PA    IPVRVKNSYNP  PGTLI    D S+ +L  +  
Sbjct  238  EEASELAYFGAKVLHPRSIIPAMCKKIPVRVKNSYNPTHPGTLILSMIDDSDEMLRVLTF  297

Query  566  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  387
            K+ VT++DI STRMLGQYGFLAKVF IF++  +SVD++ATSEVSIS+TLD          
Sbjct  298  KKKVTVVDIVSTRMLGQYGFLAKVFQIFDEQKVSVDMLATSEVSISVTLD----------  347

Query  386  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  207
             + + +D +  ELEKIA V +   ++I++++GNV+RSS ILE+ F VL  + +NVQMISQ
Sbjct  348  NRENGIDGLKTELEKIANVTIKTGKTIVTMVGNVKRSSEILERTFEVLNASAINVQMISQ  407

Query  206  GASKVNISLIVNDSEAEQCVEALHSAFFE  120
            GASKVNIS IV+D EA+ C+  LH AFFE
Sbjct  408  GASKVNISFIVDDKEADTCIRELHRAFFE  436



>gb|AFW74641.1| hypothetical protein ZEAMMB73_320357 [Zea mays]
Length=448

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 141/198 (71%), Gaps = 41/198 (21%)
 Frame = -1

Query  713  QVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIAS  534
            QVLHPQSMRPAREG IPV VKNSYN KAPGT+IT+ RDM + VLTSIVLK NVTMLDI S
Sbjct  277  QVLHPQSMRPAREGDIPVMVKNSYNAKAPGTIITRQRDMDKVVLTSIVLKSNVTMLDIVS  336

Query  533  TRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVE  354
            TRMLGQYGFLA+                                         ELDHVVE
Sbjct  337  TRMLGQYGFLAR-----------------------------------------ELDHVVE  355

Query  353  ELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIV  174
            ELEKIA+V LLQ R+IISLIGNV++SSLIL+K  HVL  +G+NVQMISQGASKVN+SLIV
Sbjct  356  ELEKIAIVRLLQQRAIISLIGNVEQSSLILQKMGHVLRKSGINVQMISQGASKVNMSLIV  415

Query  173  NDSEAEQCVEALHSAFFE  120
            +DS+A++ VEALH AFF+
Sbjct  416  HDSDAKELVEALHQAFFK  433



>ref|XP_009388316.1| PREDICTED: aspartokinase 2, chloroplastic-like, partial [Musa 
acuminata subsp. malaccensis]
Length=458

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T +EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP+APGT+ITK RDMS+AVLTS
Sbjct  334  LTFEEAAELAYFGAQVLHPLSMRPAREGDIPVRVKNSYNPQAPGTVITKERDMSKAVLTS  393

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVF+IFEDLGISVD VATSEVSISLTLDPSKLWSR
Sbjct  394  IVLKSNITMLDIVSTRMLGQYGFLAKVFAIFEDLGISVDCVATSEVSISLTLDPSKLWSR  453

Query  395  DLIQQ  381
            +LIQQ
Sbjct  454  ELIQQ  458



>ref|WP_013968408.1| aspartate kinase [Treponema caldaria]
 gb|AEJ19097.1| aspartate kinase [Treponema caldaria DSM 7334]
Length=443

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 152/213 (71%), Gaps = 11/213 (5%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
            + T +EAAELAYFGAQVLHP+SM+P    G  VRVKNSYNP+A GT I    D +   + 
Sbjct  241  MVTYEEAAELAYFGAQVLHPRSMQPCIATGTTVRVKNSYNPQAKGTRIVAKLDGNAGPVR  300

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            +I  K+NVT++DI S+RMLGQYGFLA VF  F    ISVD+VATSEVSISLTLD      
Sbjct  301  AITSKKNVTLVDIVSSRMLGQYGFLAGVFQAFSVHKISVDMVATSEVSISLTLDA-----  355

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                  A +L  +  +LEKIA V + + ++II++IG+++RSS ILE+AF V  + G+ VQ
Sbjct  356  ------AHDLLALKGDLEKIANVTIKEKKAIITIIGDIRRSSEILERAFGVCSSLGIQVQ  409

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            MISQGASKVNIS IVND+EA Q V+ LH AFFE
Sbjct  410  MISQGASKVNISFIVNDTEASQVVQGLHKAFFE  442



>ref|XP_001698576.1| aspartate kinase [Chlamydomonas reinhardtii]
 gb|EDP08069.1| aspartate kinase [Chlamydomonas reinhardtii]
Length=545

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 154/213 (72%), Gaps = 5/213 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPA-REGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
             T +EA ELAYFGAQVLHPQ+M+PA R G + VRVKNSYN  APGT+I+ TR M   V+T
Sbjct  310  LTFEEATELAYFGAQVLHPQAMQPAIRSGKMNVRVKNSYNRTAPGTIISATRPMDCTVVT  369

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLK NVT++DI STRM+GQYGFL+ VF  F    ISVDVVATSEVS+SLTLDP K+  
Sbjct  370  SIVLKSNVTLVDIISTRMMGQYGFLSTVFDAFRRHKISVDVVATSEVSVSLTLDPKKVAG  429

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                    EL  + +ELEKIA V+  ++ +I+SLI NV+++S IL +AF V     +NV 
Sbjct  430  ----AVEDELTQLSQELEKIAAVSFRKNLAILSLICNVEKTSEILMRAFSVFQRENINVL  485

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            M+SQGASK NISL+V+ +   + V+ALH  FF+
Sbjct  486  MMSQGASKTNISLVVDGARGVEAVQALHREFFD  518



>gb|ABC46704.1| aspartokinase [Arachis hypogaea]
Length=129

 Score =   215 bits (547),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 2/126 (2%)
 Frame = -1

Query  512  GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAV  333
            GFLAKVFSIFEDLGI VDVVAT+EVSISLTLDPSKLWSR+LIQ+  ELD+VVEELEKIAV
Sbjct  6    GFLAKVFSIFEDLGIYVDVVATTEVSISLTLDPSKLWSRELIQE--ELDYVVEELEKIAV  63

Query  332  VNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQ  153
            VNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GVNVQMIS+GASKVNISLIVNDSEAEQ
Sbjct  64   VNLLQNRSIISLIGNVQKSSLILEKAFRVLRTLGVNVQMISKGASKVNISLIVNDSEAEQ  123

Query  152  CVEALH  135
            CV ALH
Sbjct  124  CVRALH  129



>ref|XP_002947347.1| hypothetical protein VOLCADRAFT_87637 [Volvox carteri f. nagariensis]
 gb|EFJ51395.1| hypothetical protein VOLCADRAFT_87637 [Volvox carteri f. nagariensis]
Length=557

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 152/213 (71%), Gaps = 5/213 (2%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPA-REGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
             T +EA ELAYFGAQVLHPQ+M+PA R G + VRVKNSYN +A GT+I+  RDM   V+T
Sbjct  316  LTFEEATELAYFGAQVLHPQAMQPAIRSGKMNVRVKNSYNREAAGTIISAARDMKCTVVT  375

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            SIVLK NVT++DI STRM+GQYGFLA VF  F    ISVDVVATSEVS+SLTLDP K+  
Sbjct  376  SIVLKSNVTLVDIISTRMMGQYGFLATVFDTFRRHKISVDVVATSEVSVSLTLDPKKIAG  435

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                    EL  V  EL+++A V+  +  +IISLI NV+++S IL +AF V    G+NV 
Sbjct  436  ----APDDELSQVQTELDRMAAVSFRKGLAIISLICNVEKTSEILMRAFSVFQREGINVL  491

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            M+SQGASK NISL+V+ +   + V ALH  FF+
Sbjct  492  MMSQGASKTNISLVVDGARGTEAVLALHREFFD  524



>ref|WP_010253784.1| aspartate kinase [Treponema primitia]
Length=449

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 153/211 (73%), Gaps = 11/211 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EAAELAYFGAQVLHP++M+P  + G PVRVKNSYNP APGT I +T D     + +I
Sbjct  244  TYEEAAELAYFGAQVLHPRAMQPCIKTGTPVRVKNSYNPSAPGTRIIETIDKKTGPVRAI  303

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
              ++NVT++DI STRM+GQYGFLA VF+ F +  +SVD+VATSEVS+SLTLD        
Sbjct  304  TSRKNVTLVDIVSTRMVGQYGFLAGVFATFAEHKLSVDMVATSEVSVSLTLD--------  355

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
                A +L  +  +L KI+ V +   ++I+++IG+V+RSS IL++AF V +  G+ VQM+
Sbjct  356  ---AAHDLGKLKHDLSKISSVEIKAGKAIVTIIGDVRRSSEILQRAFGVCVLLGIQVQMV  412

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            SQGASKVNIS IV+D++A + V ALH  FFE
Sbjct  413  SQGASKVNISFIVDDTQAGEVVTALHRCFFE  443



>ref|XP_003059042.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57497.1| predicted protein [Micromonas pusilla CCMP1545]
Length=575

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 159/235 (68%), Gaps = 25/235 (11%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPARE-GGI---------P-------VRVKNSYNPKA  630
              T +EA ELAYFGAQVLHPQSMRPA +  G+         P       VRVKNSYN  A
Sbjct  342  FLTFEEATELAYFGAQVLHPQSMRPAMDKDGLRRVCISHTGPHTTAFACVRVKNSYNVTA  401

Query  629  PGTLITKTR----DMSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISV  462
            PGTLI   R    D    +LTSIV K+++TMLDI STRMLGQYGFLA VF + E   ISV
Sbjct  402  PGTLIGHARPRGDDDPNWMLTSIVQKKSITMLDIVSTRMLGQYGFLATVFEVMERNKISV  461

Query  461  DVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEK--IAVVNLLQHRSIISLIGN  288
            D VATSEVS+SLTLDP+K+WSRDL+++  EL+ +V + E+  IA V      S+ISLIGN
Sbjct  462  DCVATSEVSVSLTLDPAKMWSRDLVEE--ELEALVRDFEENGIARVTCQTGHSLISLIGN  519

Query  287  VQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            V+R+  I++++F  L    V V+MISQGASK NISL+VN  E  + V A+H+ FF
Sbjct  520  VRRNKEIVQRSFAALERADVTVKMISQGASKTNISLLVNGDEGTEAVRAIHAEFF  574



>ref|XP_002459732.1| hypothetical protein SORBIDRAFT_02g009570 [Sorghum bicolor]
 gb|EER96253.1| hypothetical protein SORBIDRAFT_02g009570 [Sorghum bicolor]
Length=458

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  755  FTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTS  576
             T DEAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYN +APGTLITK RDMS+ VLTS
Sbjct  323  LTFDEAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNRRAPGTLITKARDMSKTVLTS  382

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            IVLK N+TMLDI STRMLGQYGFLAKVFSIFED G+SVD VATSEVSISLTLDPSKLWS 
Sbjct  383  IVLKSNITMLDIVSTRMLGQYGFLAKVFSIFEDSGMSVDCVATSEVSISLTLDPSKLWSC  442

Query  395  DLIQQ  381
            +L+Q 
Sbjct  443  ELVQH  447



>tpg|DAA39409.1| TPA: hypothetical protein ZEAMMB73_358951, partial [Zea mays]
Length=178

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  500  KVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAVVNLL  321
            +VFSIFEDLGISVD VATSEVSISLTLDPSKLWS +L+Q  +ELD V+EELEKIAVV+LL
Sbjct  24   QVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSCELVQHKNELDDVIEELEKIAVVHLL  83

Query  320  QHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEA  141
            Q+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQGASKVNISL+V+DSEA+QCV+A
Sbjct  84   QNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQGASKVNISLVVHDSEAKQCVQA  143

Query  140  LHSAFFE  120
            LHSAFFE
Sbjct  144  LHSAFFE  150



>ref|WP_015707281.1| aspartate kinase [Treponema primitia]
 gb|AEF84490.1| lysine-sensitive aspartokinase 3 (Lysine-sensitiveaspartokinase 
III) (Aspartate kinase III) [Treponema primitia ZAS-2]
Length=451

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 152/211 (72%), Gaps = 11/211 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EAAELAYFGAQVLHP++M+P  + G PVRVKNSYNP APGT I  + D     + +I
Sbjct  244  TYEEAAELAYFGAQVLHPRAMQPCIKTGTPVRVKNSYNPDAPGTRIVGSLDKKAGPVRAI  303

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
              ++NVT++DI STRM+GQ+GFLA+VF+ F +  +SVD+VATSEVS+SLTLD        
Sbjct  304  TSRKNVTLVDIVSTRMVGQHGFLAEVFTTFAEHKLSVDMVATSEVSVSLTLDADH-----  358

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
                  EL  + ++L +IA V +   ++I++++G+V+RSS IL++AF   +  G+ VQMI
Sbjct  359  ------ELGALKQDLSRIASVEIRTGKAIVTIVGDVRRSSEILQRAFGTCVLLGIQVQMI  412

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            SQGASKVNIS IV+D++A + V ALH  FFE
Sbjct  413  SQGASKVNISFIVDDTQAGEVVIALHKCFFE  443



>gb|EWM28259.1| aspartate kinase [Nannochloropsis gaditana]
Length=572

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 147/208 (71%), Gaps = 8/208 (4%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  567
            +EA+ELAYFGA++LHP SM PA    I VRVKNSYNP  PGT+I   +D ++ V T+I  
Sbjct  364  EEASELAYFGAEILHPISMVPAMRYNIQVRVKNSYNPDHPGTVILADKDYTQLV-TAITS  422

Query  566  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  387
            KRNV +LDI ST MLGQYGFL++VFSIFE+  +SVD VATSEVSISLTLD  K       
Sbjct  423  KRNVELLDIVSTWMLGQYGFLSRVFSIFEEQKVSVDCVATSEVSISLTLDTKK-------  475

Query  386  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  207
            Q     D +V+ L +IA V + + R+IISLI NV RSS +L   F+ L   G+ V+M+SQ
Sbjct  476  QDDHAEDRLVKALSEIAAVTVHRDRAIISLIANVARSSEVLSIVFNALKEAGIQVEMLSQ  535

Query  206  GASKVNISLIVNDSEAEQCVEALHSAFF  123
            GASKVNISLIV D +AE+C + LH  FF
Sbjct  536  GASKVNISLIVKDEDAERCTQILHDRFF  563



>ref|WP_015710697.1| aspartate kinase [Treponema azotonutricium]
 gb|AEF82415.1| lysine-sensitive aspartokinase 3 (Lysine-sensitiveaspartokinase 
III) (Aspartate kinase III) [Treponema azotonutricium ZAS-9]
Length=446

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 150/213 (70%), Gaps = 11/213 (5%)
 Frame = -1

Query  758  IFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLT  579
            + T + AAELAYFGAQVLHP++M+P  + G PV VKNSYNP APGT I  T     + + 
Sbjct  242  MVTYEAAAELAYFGAQVLHPRAMQPCIKTGTPVLVKNSYNPSAPGTRIVSTLGKKVSPIQ  301

Query  578  SIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  399
            +I  ++NVT++DI STRMLGQYGFLA+VFS F    +SVD+VATSEVS+SLTLD      
Sbjct  302  AITSRKNVTLVDIVSTRMLGQYGFLAEVFSCFAKHNLSVDMVATSEVSVSLTLD------  355

Query  398  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  219
                    +L  + +++ +IA +++   ++I+++IGNVQRSS IL ++F      GV VQ
Sbjct  356  -----AVHDLTVLKKDIARIASIDIKTGKAIVTIIGNVQRSSEILARSFRTCELLGVRVQ  410

Query  218  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            M+SQGASKVNIS IV+DSEA + V+ALH  FFE
Sbjct  411  MVSQGASKVNISFIVDDSEAAEVVKALHGDFFE  443



>ref|XP_005707902.1| aspartate kinase [Galdieria sulphuraria]
 gb|EME31382.1| aspartate kinase [Galdieria sulphuraria]
Length=522

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 145/211 (69%), Gaps = 8/211 (4%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDM-SEAVLTS  576
            T  EA E+AYFGA+VLHP +M+PA    IP+RVKNSYNP+ PGT+I   R+  SE  +T+
Sbjct  316  TFQEAFEMAYFGAKVLHPIAMQPAMRHNIPIRVKNSYNPEHPGTVIKSRREHPSENPVTA  375

Query  575  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  396
            I LKR   ++DI STRMLG +GFLA++F +F +  +S+DV+ATSEVS+SLTLDP    +R
Sbjct  376  ISLKRKCHLVDIESTRMLGAHGFLAELFKVFGERRVSIDVIATSEVSVSLTLDPKAFDTR  435

Query  395  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  216
            D      EL+    EL KIA V     ++IISL+ NV RS+ IL +A  VL    ++V+M
Sbjct  436  D----KEELE---VELSKIASVQFSGEKAIISLVSNVSRSTEILARAMQVLWKENIDVEM  488

Query  215  ISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            ISQGASK NIS IV D+ A+  V ALH  FF
Sbjct  489  ISQGASKFNISFIVEDTHADAAVRALHGEFF  519



>ref|XP_002182416.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46317.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=541

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 147/211 (70%), Gaps = 9/211 (4%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            + +EA+ELAYFGAQVLHP +M+PA +  +PVRVKNSYNP A GT+I + R  +E ++T+I
Sbjct  319  SYEEASELAYFGAQVLHPIAMQPAMKHNVPVRVKNSYNPSAVGTII-RNRKETERLVTAI  377

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
              KR++ ++DI ST+MLG YGFLA+VF  FE   +SVDV+A+SEVS+SLTLD        
Sbjct  378  TYKRDIKLMDIESTQMLGAYGFLARVFGEFEKHKLSVDVLASSEVSVSLTLDKK------  431

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
              Q+ +E+D ++ +L   A V   + RSI++LI +V RSS +L   F V  T G+ V+M+
Sbjct  432  --QKDAEIDGLMRDLGSCAKVTCHKDRSILTLITDVGRSSEVLATVFRVFSTCGIKVEMM  489

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            SQGASKVNIS IV D   E+ +  LH  FFE
Sbjct  490  SQGASKVNISFIVKDESLERAILELHKCFFE  520



>ref|XP_005534774.1| aspartate kinase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80167.1| aspartate kinase [Cyanidioschyzon merolae strain 10D]
Length=609

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 150/209 (72%), Gaps = 8/209 (4%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMS-EAVLTSIV  570
            +EAAELAYFGA+VLHP +M+PA    IPVRVKNSYNP+APGT+I +    + +  +T++ 
Sbjct  373  EEAAELAYFGAKVLHPVAMQPALRFNIPVRVKNSYNPEAPGTVILRRESATMDRPVTALS  432

Query  569  LKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDL  390
            +KR V ++DI STRM+G YGFLA+VF+ F    +SVDV+ATSEVS+SLTLD +     D+
Sbjct  433  VKRGVQLVDIVSTRMVGAYGFLARVFACFATHQLSVDVIATSEVSLSLTLDANAC---DM  489

Query  389  IQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMIS  210
             +Q      +++EL++IA V+    R+IIS+I NV+RSS IL +A  VL    + VQMIS
Sbjct  490  TRQ----QRIIKELQQIAQVSFSSGRAIISIISNVRRSSEILARAMKVLHEQNIEVQMIS  545

Query  209  QGASKVNISLIVNDSEAEQCVEALHSAFF  123
            QGASK NISL+V++ EA   V ALH  FF
Sbjct  546  QGASKFNISLVVHNDEAITAVRALHDEFF  574



>ref|XP_009388108.1| PREDICTED: aspartokinase 3, chloroplastic-like, partial [Musa 
acuminata subsp. malaccensis]
Length=137

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 107/112 (96%), Gaps = 2/112 (2%)
 Frame = -1

Query  455  VATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRS  276
            VATSEVSISLTLDPSKLWSR+LIQQ  ELDHVVEELEKIAVV+LLQHRSIISL+GNVQRS
Sbjct  2    VATSEVSISLTLDPSKLWSRELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLVGNVQRS  59

Query  275  SLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            SLILEKAF+VL  NGVNVQMISQGASKVNISLIVND EA+QCV+ALHSAFFE
Sbjct  60   SLILEKAFNVLRKNGVNVQMISQGASKVNISLIVNDDEAKQCVKALHSAFFE  111



>ref|XP_009035261.1| hypothetical protein AURANDRAFT_52842 [Aureococcus anophagefferens]
 gb|EGB10467.1| hypothetical protein AURANDRAFT_52842 [Aureococcus anophagefferens]
Length=528

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 155/220 (70%), Gaps = 20/220 (9%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLI--------TKTRDM  597
            T +EAAELAYFGAQVLHP SM PA +  +PVRVKNSYNP   GTLI         + +  
Sbjct  302  TYEEAAELAYFGAQVLHPISMLPASKACVPVRVKNSYNPAHEGTLIGDEATIAAARRKAG  361

Query  596  SEA-VLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTL  420
            +EA +LT++  KR+VT++D++STRMLGQ GFL ++F +FE  G+SVDVVATSEVS+SLTL
Sbjct  362  AEAPLLTALTSKRSVTLVDVSSTRMLGQAGFLKRIFDVFEADGVSVDVVATSEVSVSLTL  421

Query  419  D-PSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL  243
            +      SRD   Q          LE+IA V++ + R+I+S I +V RS+ +L K F VL
Sbjct  422  ERKGGDLSRDGRAQ----------LEEIAYVDVKRDRAIVSFIADVTRSTELLAKVFMVL  471

Query  242  LTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             +NG+ V+M+SQGASKVNISL++ D++A++ ++ +H  FF
Sbjct  472  FSNGIAVEMLSQGASKVNISLVLLDADADRALKLIHDCFF  511



>ref|WP_013702193.1| aspartate kinase [Treponema succinifaciens]
 gb|AEB14939.1| aspartate kinase [Treponema succinifaciens DSM 2489]
Length=441

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 149/210 (71%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA FG+QVLHP+SM P R+   PVRVKNSYN K+ GTLI +    +  ++T+I
Sbjct  242  TYEEAQELAMFGSQVLHPRSMIPCRKTRTPVRVKNSYNIKSHGTLIVEEHTGTRPLVTAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               +NVT++DI S+RMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT+D        
Sbjct  302  TKVKNVTLIDIQSSRMLGAAGFLAHIFNQFLKWNISIDVIATSEVSVSLTVDGK------  355

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
                 ++L  ++E+L+++A VN+   ++I+++I +  RSS+I+ KAF  L   G+NVQMI
Sbjct  356  -----ADLTGLIEDLKRVADVNVKTGKAIVTIICDASRSSVIIAKAFDGLSKEGINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS++V+ ++A++ VEA+HS  F
Sbjct  411  SQGASKVNISILVDTNQADKTVEAIHSVLF  440



>ref|WP_016525852.1| aspartate kinase [Treponema maltophilum]
 gb|EPF31241.1| aspartate kinase [Treponema maltophilum ATCC 51939]
Length=444

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 142/211 (67%), Gaps = 11/211 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EAAELAYFGAQ+LHP+SM P R+ G+PVRVKNSYN ++ G+LIT+      + + ++
Sbjct  245  TYEEAAELAYFGAQILHPRSMAPCRKAGVPVRVKNSYNIQSEGSLITEKHRKKPSPVRAL  304

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               +N T++DI STRMLG  GFLA +F++F   GIS+DV+ATSEVS+SLT          
Sbjct  305  TAVKNSTLIDIVSTRMLGASGFLAHIFNVFLKYGISIDVIATSEVSVSLT----------  354

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ EL  IA   +   +SII++I +   SS IL  AF  L    +N +MI
Sbjct  355  -VHTDADLSGLLHELNGIAETKIKTGKSIIAIICDAAHSSSILASAFGALAKENINPEMI  413

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            SQGASKVNIS I +D+ A++ V+ LH+AFFE
Sbjct  414  SQGASKVNISFICDDAVADKTVKTLHAAFFE  444



>ref|XP_002292078.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90929.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=619

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 141/209 (67%), Gaps = 9/209 (4%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  567
            DEA+ELAYFGAQVLHP +M+PA +  IPVRVKNSYNP APG++I K  +  E ++T+I  
Sbjct  403  DEASELAYFGAQVLHPIAMQPALKANIPVRVKNSYNPSAPGSVIDKIGN-PERMVTAITC  461

Query  566  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  387
            KRNV +LDI S  MLG YGFL  VF+ FE    SVDV+A+SEVS+S+TLD          
Sbjct  462  KRNVKLLDIHSLNMLGAYGFLGAVFADFEKHKCSVDVLASSEVSVSVTLDKK--------  513

Query  386  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  207
            Q   ++  +  +L K A V L + R+I++LI +V+RSS +L   F     +GV V+M+SQ
Sbjct  514  QHEEDITELCNDLSKFAEVELHRDRAILTLIADVKRSSDVLATVFRSFSAHGVQVEMMSQ  573

Query  206  GASKVNISLIVNDSEAEQCVEALHSAFFE  120
            GASKVNIS IV + + +  +  LHS FFE
Sbjct  574  GASKVNISFIVREDQIDDAILNLHSCFFE  602



>ref|WP_027728545.1| aspartate kinase [Treponema sp. C6A8]
Length=441

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 143/210 (68%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA FGAQVLHP+SM P R+ G PVRVKNSYN ++PG++I +        + +I
Sbjct  242  TYEEAQELAMFGAQVLHPRSMVPCRKTGTPVRVKNSYNIQSPGSIIVEKHTGKVPPVCAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               +++T++DI S+RMLG  GFLA VF+ F    +S+DV+ATSEVS+SLT          
Sbjct  302  TTVKHITLIDIVSSRMLGAAGFLAHVFNNFLKWNVSIDVIATSEVSVSLT----------  351

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   S+L  +V++LE+ + V++   +SI++++ +   SS IL   F VL   G+NVQMI
Sbjct  352  -VNTKSDLSGLVKDLEEASEVSVHTGKSIVTIVCDAAHSSAILASGFAVLADEGINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS+IV+D EA++ V+ LH AFF
Sbjct  411  SQGASKVNISMIVDDDEADKTVQILHGAFF  440



>ref|WP_013758817.1| aspartate kinase [Treponema brennaborense]
 gb|AEE17112.1| aspartate kinase [Treponema brennaborense DSM 12168]
Length=448

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 140/210 (67%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EAAELAYFGAQVLHP+SM P R+ G PVRVKNSYN  +PG++I +      A + +I
Sbjct  242  TYEEAAELAYFGAQVLHPRSMMPCRKSGTPVRVKNSYNMTSPGSIIVENHAGPVAAVRAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               ++VT++DI STRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT          
Sbjct  302  TAVKHVTLIDIVSTRMLGASGFLAHIFNQFLKWNISIDVIATSEVSVSLT----------  351

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ +++K+A       ++I+++I +  R+S I+   F  L    +NVQMI
Sbjct  352  -VNTKADLSGLLADVQKVAATECKTGKAIVTVICDTARASSIIADGFAALARERINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            S+GASKVNIS+I +DSEA+  V  LH+A+F
Sbjct  411  SKGASKVNISMICDDSEADTVVRTLHAAYF  440



>gb|ERF61453.1| amino acid kinase family protein [Treponema socranskii subsp. 
socranskii VPI DR56BR1116 = ATCC 35536]
 gb|ERJ98210.1| amino acid kinase family protein [Treponema socranskii subsp. 
socranskii VPI DR56BR1116 = ATCC 35536]
Length=456

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 139/210 (66%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA+FGAQVLHP+SM P R    PVRVKNSYN ++PG++I +T +   + + +I
Sbjct  257  TYEEAQELAFFGAQVLHPRSMLPCRRTATPVRVKNSYNIESPGSIIVETHNGKASPVCAI  316

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               ++VT++DIASTRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT          
Sbjct  317  TGVKHVTLIDIASTRMLGAVGFLAHIFNQFLKWNISIDVIATSEVSVSLT----------  366

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ +L  +A V     ++I+S+I +   SS IL   F  L    +NVQMI
Sbjct  367  -VNTKTDLSGLIRDLSDVAEVRTRSGKAIVSIICDALHSSAILAAGFKALSDENINVQMI  425

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS+IV+D EA++ V  LH A+F
Sbjct  426  SQGASKVNISMIVDDEEADKTVRVLHKAYF  455



>ref|WP_038080481.1| aspartate kinase [Treponema socranskii]
Length=441

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 139/210 (66%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA+FGAQVLHP+SM P R    PVRVKNSYN ++PG++I +T +   + + +I
Sbjct  242  TYEEAQELAFFGAQVLHPRSMLPCRRTATPVRVKNSYNIESPGSIIVETHNGKASPVCAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               ++VT++DIASTRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT          
Sbjct  302  TGVKHVTLIDIASTRMLGAVGFLAHIFNQFLKWNISIDVIATSEVSVSLT----------  351

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ +L  +A V     ++I+S+I +   SS IL   F  L    +NVQMI
Sbjct  352  -VNTKTDLSGLIRDLSDVAEVRTRSGKAIVSIICDALHSSAILAAGFKALSDENINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS+IV+D EA++ V  LH A+F
Sbjct  411  SQGASKVNISMIVDDEEADKTVRVLHKAYF  440



>ref|WP_016521831.1| aspartate kinase [Treponema socranskii]
 gb|EPF25671.1| aspartate kinase [Treponema socranskii subsp. paredis ATCC 35535]
Length=441

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 139/210 (66%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA+FGAQVLHP+SM P R    PVRVKNSYN ++PG++I +T +   + + +I
Sbjct  242  TYEEAQELAFFGAQVLHPRSMLPCRRTATPVRVKNSYNIESPGSIIVETHNGKASPVCAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               ++VT++DIASTRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT          
Sbjct  302  TGVKHVTLIDIASTRMLGAVGFLAHIFNQFLKWNISIDVIATSEVSVSLT----------  351

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ +L  +A V     ++I+S+I +   SS IL   F  L    +NVQMI
Sbjct  352  -VNTKTDLSGLIRDLSDVAEVRTRSGKAIVSIICDALHSSAILAAGFKALSDENINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS+IV+D EA++ V  LH A+F
Sbjct  411  SQGASKVNISMIVDDEEADKTVRVLHKAYF  440



>ref|WP_009104632.1| aspartate kinase [Treponema sp. JC4]
 gb|EID85312.1| aspartate kinase [Treponema sp. JC4]
Length=441

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 141/210 (67%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA FGAQVLHP+SM P R+ G PVRVKNSYN ++PG++I +        + +I
Sbjct  242  TYEEAQELAMFGAQVLHPRSMVPCRKTGTPVRVKNSYNIQSPGSIIVEKHTGKVPPVCAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               +++T++DI S+RMLG  GFLA VF+ F    +S+DV+ATSEVS+SLT          
Sbjct  302  TTVKHITLIDIVSSRMLGAAGFLAHVFNNFLKWNVSIDVIATSEVSVSLT----------  351

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ +LE+ + V++   +SI+++I +   SS IL   F  L   G+NVQMI
Sbjct  352  -VNTKADLSGLISDLEQASEVSVHTGKSIVTIICDAAHSSAILASGFAALSDEGINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS+IV+D EAE+ V+ LH AFF
Sbjct  411  SQGASKVNISMIVDDDEAEKTVKILHKAFF  440



>ref|WP_022933427.1| aspartate kinase [Treponema bryantii]
Length=441

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 143/210 (68%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA FGAQVLHP+SM P R+ G PVRVKNSYN  +PG++I +  +     + +I
Sbjct  242  TYEEAQELAMFGAQVLHPRSMLPVRKTGTPVRVKNSYNITSPGSIIVEKHNGKVPPVCAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               +++T++DI S+RMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT          
Sbjct  302  TTVKHITLIDIVSSRMLGAAGFLAHIFNNFLKWNISIDVIATSEVSVSLT----------  351

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
             +   ++L  ++ +LE+ + V++ + ++I+++I +   SS IL   F  L   G+NVQMI
Sbjct  352  -VNTKADLTGLIADLEQASQVSVRKDKAIVTIICDAAHSSAILASGFDALADEGINVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS+IV+D EA++ V+ LH+A+F
Sbjct  411  SQGASKVNISMIVDDDEADRTVQILHNAYF  440



>gb|EMS60633.1| hypothetical protein TRIUR3_25086 [Triticum urartu]
Length=291

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  692  MRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDI--ASTRMLG  519
            M+ A EGGI V VKNSYNP+A GT+ITKTRDMS+++LTSI LK N+T+LDI   ST  L 
Sbjct  1    MQIAVEGGIKVTVKNSYNPQARGTVITKTRDMSKSILTSIALKSNITILDIERTSTLDLD  60

Query  518  QYGFLAKVFSIFED---LGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEEL  348
            Q  F+ K  SIF++   L ISVD +ATSE  +S TL PSKL SR+LIQ A  LD  V+EL
Sbjct  61   QNAFVEKAISIFQNFEYLSISVDWIATSEGKVSFTLVPSKLLSRELIQPA--LDMSVQEL  118

Query  347  EKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKV-NISLIVN  171
            + IA V+ L   S+ISLIG   RS  IL K   +L +  V V+ +SQG SKV  +SL+V+
Sbjct  119  QTIADVHRLHDMSVISLIGKPGRSIDILGKVLSILQSRDVAVEKVSQGVSKVTKVSLVVH  178

Query  170  DSEAEQCVEALHSAFFE  120
            D+ A  CV+ALHSAFFE
Sbjct  179  DTVANHCVQALHSAFFE  195



>ref|WP_004266577.1| aspartate kinase [Treponema saccharophilum]
 gb|EIC03081.1| aspartate kinase [Treponema saccharophilum DSM 2985]
Length=441

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 140/210 (67%), Gaps = 11/210 (5%)
 Frame = -1

Query  752  TXDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSI  573
            T +EA ELA FG+QVLHP+SM P R  G PVRVKNSYN K+PG++I +        +T+I
Sbjct  242  TYEEAQELAMFGSQVLHPRSMIPCRRTGTPVRVKNSYNIKSPGSVIVEKHSGETPRVTAI  301

Query  572  VLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  393
               + VT++DI S+RMLG  GFLA +F+ F    +S+DV+ATSEVS+SLT++  K     
Sbjct  302  TSVKGVTLIDIESSRMLGAAGFLAHIFNQFLKWELSIDVIATSEVSVSLTVNTKK-----  356

Query  392  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
                  +L  +V +LEK + V + + ++I+++I +  RSS IL   F  L   GVNVQMI
Sbjct  357  ------DLSGLVADLEKASKVVVKKDKAIVTIICDATRSSSILSDVFTALGREGVNVQMI  410

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            SQGASKVNIS++V+ SEA + V+ LH A F
Sbjct  411  SQGASKVNISMLVDASEANRVVQILHGALF  440



>ref|XP_005713499.1| unnamed protein product [Chondrus crispus]
 emb|CDF33680.1| unnamed protein product [Chondrus crispus]
Length=608

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 144/211 (68%), Gaps = 9/211 (4%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDM-SEAVLTSIV  570
            +EAAE+A+FGA+VLHP +M PA  G IPVRVKNSYNP  PGT+I ++R+  +E  +T++ 
Sbjct  405  EEAAEMAFFGAKVLHPIAMLPAMRGNIPVRVKNSYNPDHPGTVILRSREFDNENPVTAVS  464

Query  569  LKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDL  390
            +K+NV ++D+ STRMLG  GFLA+VF  F    ISVD++ATSEVSIS+TLD S       
Sbjct  465  VKKNVQIVDVVSTRMLGASGFLAEVFKAFAYHKISVDMIATSEVSISMTLDNS-------  517

Query  389  IQQASELDHVVEELEKIAVVNLLQ-HRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  213
            +   + L  +  +L  IA V+  + +++IISL+ +  RSS ++ +A   L    + V MI
Sbjct  518  VCDDTILHQLTADLSTIATVSFSENNKAIISLVSDSARSSEVVGRAVTALDRERIKVLMI  577

Query  212  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            SQGASK N+S+ ++ ++A++ V A+H  FF 
Sbjct  578  SQGASKFNVSVTIDGTDAKKAVRAVHKEFFH  608



>ref|XP_003884193.1| Aspartokinase/homoserine dehydrogenase, related [Neospora caninum 
Liverpool]
 emb|CBZ54162.1| Aspartokinase/homoserine dehydrogenase, related [Neospora caninum 
Liverpool]
Length=476

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 146/216 (68%), Gaps = 16/216 (7%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTR----DMSEAVL-  582
            D+A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP+ PGTL+ +      D S A + 
Sbjct  252  DQASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPEHPGTLVVQAEPSGGDASLAAVP  311

Query  581  ---TSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPS  411
               T++  +R++T++D+ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+  
Sbjct  312  DGVTAVTYQRDITVVDVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE--  369

Query  410  KLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNG  231
            K  S D I++  E       L   +  ++ + ++++S++GN++  + I+ +    L   G
Sbjct  370  KDTSEDKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLENCNEIVARTCIALTKIG  423

Query  230  VNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
            V +Q+IS G SKVN++  V D+E  + V+A+H A F
Sbjct  424  VTMQLISCGTSKVNLTFCVEDAEVHRVVQAVHDALF  459



>gb|KFH09919.1| aspartokinase, partial [Toxoplasma gondii MAS]
Length=347

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 19/218 (9%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDM  597
            D+A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              
Sbjct  122  DQASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAHPTAA  181

Query  596  SEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLD  417
            S+ V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+
Sbjct  182  SDGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE  240

Query  416  PSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  237
              K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L  
Sbjct  241  --KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTK  292

Query  236  NGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  293  IGVTVQLISCGTSKVNFTFCVEDTDVYRVVQAVHDALF  330



>gb|KFG51953.1| aspartokinase, partial [Toxoplasma gondii FOU]
 gb|KFG60988.1| aspartokinase, partial [Toxoplasma gondii RUB]
 gb|KFH12996.1| aspartokinase, partial [Toxoplasma gondii VAND]
Length=347

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 19/218 (9%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDM  597
            D+A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              
Sbjct  122  DQASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAHPTAA  181

Query  596  SEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLD  417
            S+ V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+
Sbjct  182  SDGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE  240

Query  416  PSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  237
              K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L  
Sbjct  241  --KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTK  292

Query  236  NGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  293  IGVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  330



>ref|XP_008882085.1| aspartokinase [Hammondia hammondi]
 gb|KEP67650.1| aspartokinase [Hammondia hammondi]
Length=477

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 145/218 (67%), Gaps = 19/218 (9%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRD----------M  597
            D+A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP+ PGT I +T            +
Sbjct  252  DQASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPEHPGTRIVQTVSSAGVPAHPTVV  311

Query  596  SEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLD  417
            S+ V T++  +R++T++D+ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+
Sbjct  312  SDGV-TAVTYQRDITVIDVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE  370

Query  416  PSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  237
              K  S + I++  E       L   +  ++ + ++++S++GN++  + I+ +    L  
Sbjct  371  --KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLESCNEIVARTCIALTK  422

Query  236  NGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             GV +Q+IS G SKVN +  V D++  + V+A+H A F
Sbjct  423  IGVTMQLISCGTSKVNFTFCVEDADVHRVVQAVHDALF  460



>ref|XP_005773177.1| hypothetical protein EMIHUDRAFT_75153 [Emiliania huxleyi CCMP1516]
 gb|EOD20748.1| hypothetical protein EMIHUDRAFT_75153 [Emiliania huxleyi CCMP1516]
Length=523

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 136/230 (59%), Gaps = 19/230 (8%)
 Frame = -1

Query  761  AIFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVR-----VKNSYNPKAPGTLITKTRD-  600
            A  T DEAAELAYFGAQVLHP +M+P R  G+P R     VKNSYNP A GTLI+     
Sbjct  288  ARVTFDEAAELAYFGAQVLHPLAMQPCRRAGVPFRAASSLVKNSYNPAAEGTLISADGSA  347

Query  599  MSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTL  420
             SE  L S +  +N   L        G YGFLA+VF+ F+   IS+DV+A+SEVS+SLTL
Sbjct  348  CSETRLVSAITSKNGARL---RGEEQGAYGFLARVFAAFDRWRISIDVIASSEVSVSLTL  404

Query  419  DPSKLWSRDLIQQASELDHVVE----------ELEKIAVVNLLQHRSIISLIGNVQRSSL  270
            + ++L  R  I     L   VE          +LE++A V +    SI++LI NV  SS 
Sbjct  405  NKNQLLERRSISALEHLPAGVERSEALVGLMADLEQVANVRVSGGHSIVTLIANVGCSSA  464

Query  269  ILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ++      +   G+ VQMISQGASKVNIS++V +  A + V+ LH  FFE
Sbjct  465  VVSAVCAAMDRLGIPVQMISQGASKVNISIVVPEERAVEAVQELHRHFFE  514



>ref|XP_005786070.1| hypothetical protein EMIHUDRAFT_71644 [Emiliania huxleyi CCMP1516]
 gb|EOD33641.1| hypothetical protein EMIHUDRAFT_71644 [Emiliania huxleyi CCMP1516]
Length=521

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 136/230 (59%), Gaps = 19/230 (8%)
 Frame = -1

Query  761  AIFTXDEAAELAYFGAQVLHPQSMRPAREGGIPVR-----VKNSYNPKAPGTLITKTRD-  600
            A  T DEAAELAYFGAQVLHP +M+P R  G+P R     VKNSYNP A GTLI+     
Sbjct  286  ARVTFDEAAELAYFGAQVLHPLAMQPCRRAGVPFRAASSLVKNSYNPAAEGTLISADGSA  345

Query  599  MSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTL  420
             SE  L S +  +N   L        G YGFLA+VF+ F+   IS+DV+A+SEVS+SLTL
Sbjct  346  CSETRLVSAITSKNGARL---RGEEQGAYGFLARVFAAFDRWRISIDVIASSEVSVSLTL  402

Query  419  DPSKLWSRDLIQQASELDHVVE----------ELEKIAVVNLLQHRSIISLIGNVQRSSL  270
            + ++L  R  I     L   VE          +LE++A V +    SI++LI NV  SS 
Sbjct  403  NKNQLLERRSISALEHLPAGVERSEALVGLMADLEQVANVRVSGGHSIVTLIANVGCSSA  462

Query  269  ILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  120
            ++      +   G+ VQMISQGASKVNIS++V +  A + V+ LH  FFE
Sbjct  463  VVSAVCAAMDRLGIPVQMISQGASKVNISIVVPEERAVEAVQELHRHFFE  512



>gb|EPT27208.1| aspartokinase [Toxoplasma gondii ME49]
Length=479

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 19/218 (9%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDM  597
            D+A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              
Sbjct  254  DQASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAQPTAA  313

Query  596  SEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLD  417
            S+ V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+
Sbjct  314  SDGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE  372

Query  416  PSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  237
              K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L  
Sbjct  373  --KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTK  424

Query  236  NGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  425  IGVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  462



>ref|XP_002366362.1| aspartate kinase, putative [Toxoplasma gondii ME49]
Length=477

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 143/218 (66%), Gaps = 19/218 (9%)
 Frame = -1

Query  746  DEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDM  597
            D+A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              
Sbjct  252  DQASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAQPTAA  311

Query  596  SEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLD  417
            S+ V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+
Sbjct  312  SDGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE  370

Query  416  PSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  237
              K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L  
Sbjct  371  --KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTK  422

Query  236  NGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  123
             GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  423  IGVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680