BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050M04

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787152.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  57.8    2e-06   Nicotiana sylvestris
ref|XP_009628293.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  57.0    3e-06   Nicotiana tomentosiformis
ref|XP_004236847.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    1e-05   Solanum lycopersicum
ref|XP_006359285.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  55.5    1e-05   Solanum tuberosum [potatoes]
ref|XP_010656830.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  50.4    6e-04   Vitis vinifera
ref|XP_010319328.1|  PREDICTED: CD2 antigen cytoplasmic tail-bind...  39.3    6e-04   Solanum lycopersicum



>ref|XP_009787152.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nicotiana 
sylvestris]
Length=390

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = -2

Query  701  DSVLDEDFIPSVAVEGPSSLssvnagpsnpnasaamsnGDDSFDMFAEDDENPPTNPTSS  522
            D+VLDE F+PS +       S  NA  ++ N+  + +  DD++DMF EDDEN P NP S+
Sbjct  269  DNVLDEHFLPSGSTATAGGHSMHNADEASSNSYNSANKSDDAYDMFGEDDENVPANPASN  328

Query  521  EGTLQNdyvydessgyyyssslgyyydpssglYCNAASGQWYSYKEDSGTY  369
             G    DYV+DESSGYYYSSSLG+YYDPSSGLYC+AASGQWYSY ++SG Y
Sbjct  329  GGDQHGDYVFDESSGYYYSSSLGHYYDPSSGLYCHAASGQWYSYNDESGIY  379



>ref|XP_009628293.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 [Nicotiana 
tomentosiformis]
Length=390

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -2

Query  701  DSVLDEDFIPSVAVEGPSSLssvnagpsnpnasaamsnGDDSFDMFAEDDENPPTNPTSS  522
            D+VLDE F+PS +       S  NA  ++ N   + +  DD++DMF EDDEN P NP S+
Sbjct  269  DNVLDEHFLPSGSTATAGGHSMHNADVASSNLYNSANKSDDAYDMFGEDDENIPANPASN  328

Query  521  EGTLQNdyvydessgyyyssslgyyydpssglYCNAASGQWYSYKEDSGTY  369
             G    DYV+DESSGYYYSSSLG+YYDPSSGLYC+AASGQWYSY ++SG Y
Sbjct  329  GGDQHGDYVFDESSGYYYSSSLGHYYDPSSGLYCHAASGQWYSYNDESGIY  379



>ref|XP_004236847.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010319329.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Solanum lycopersicum]
Length=388

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = -2

Query  698  SVLDEDFIPSVAVEGPSSLssvnagpsnpnasaamsnGDDSFDMFAEDDENPPTNPTSSE  519
            S+LDE F+PS +              ++ N+  + S  DD+FDMF EDDEN P NP  + 
Sbjct  268  SILDEGFLPSGSTATAEGHPMHKTDVASSNSYNSASKSDDAFDMFGEDDENTPANPAPNG  327

Query  518  GTLQNdyvydessgyyyssslgyyydpssglYCNAASGQWYSYKEDSGTY  369
            G    DYV+DESSGYYYSSSLGYYYDPSSGLYCNA+SGQWYSY ++SG Y
Sbjct  328  GDQHGDYVFDESSGYYYSSSLGYYYDPSSGLYCNASSGQWYSYNDESGIY  377



>ref|XP_006359285.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2-like 
[Solanum tuberosum]
Length=419

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -2

Query  701  DSVLDEDFIPSVAVEGPSSLssvnagpsnpnasaamsnGDDSFDMFAEDDENPPTNPTSS  522
            DS+LDE F+PS +       S  NA  S+ N+  + S  DD+ DMF EDDEN P NP S+
Sbjct  298  DSILDEGFLPSGSTATAGGHSMHNADMSSSNSYNSASKNDDALDMFGEDDENIPANPASN  357

Query  521  EGTLQNdyvydessgyyyssslgyyydpssglYCNAASGQWYSYKEDSGTY  369
             G    DYV+DESSGYYYSSSLGYYYDPSSGLYC+A+SGQWYSY ++SG Y
Sbjct  358  GGDQHGDYVFDESSGYYYSSSLGYYYDPSSGLYCHASSGQWYSYNDESGIY  408



>ref|XP_010656830.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X2 [Vitis vinifera]
Length=394

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -2

Query  584  DDSFDMFAEDDENPPTNPTS-SEGTLQNdyvydessgyyyssslgyyydpssglYCNAAS  408
            +D+FDMF EDDE  P N +S   G LQNDYVYDESSGYYYSSSLGYYYDPSSGLYC+AAS
Sbjct  311  NDAFDMFGEDDEPAPANLSSDGAGALQNDYVYDESSGYYYSSSLGYYYDPSSGLYCSAAS  370

Query  407  GQWYSYKEDSGTY  369
            GQWYS+ E++GTY
Sbjct  371  GQWYSFNEETGTY  383



>ref|XP_010319328.1| PREDICTED: CD2 antigen cytoplasmic tail-binding protein 2 isoform 
X1 [Solanum lycopersicum]
Length=398

 Score = 39.3 bits (90),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = -2

Query  698  SVLDEDFIPSVAVEGPSSLssvnagpsnpnasaamsnGDDSFDMFAEDDENPPTNP  531
            S+LDE F+PS +              ++ N+  + S  DD+FDMF EDDEN P NP
Sbjct  268  SILDEGFLPSGSTATAEGHPMHKTDVASSNSYNSASKSDDAFDMFGEDDENTPANP  323


 Score = 31.2 bits (69),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = -3

Query  439  HHRDCTATRLQDNGIHIKKILAHTKR  362
            HH DC A   QDNG HI    A+TKR
Sbjct  341  HHLDCIAMHHQDNGTHIMMNRAYTKR  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350