BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050H05

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792571.1|  PREDICTED: serine/arginine-rich splicing fac...    123   2e-30   Nicotiana sylvestris
gb|KHN10603.1|  Serine/arginine-rich splicing factor 7                  121   4e-30   Glycine soja [wild soybean]
ref|XP_003532014.1|  PREDICTED: serine/arginine-rich splicing fac...    121   4e-30   Glycine max [soybeans]
ref|XP_009606700.1|  PREDICTED: serine/arginine-rich splicing fac...    120   6e-30   Nicotiana tomentosiformis
ref|XP_009606697.1|  PREDICTED: serine/arginine-rich splicing fac...    121   7e-30   Nicotiana tomentosiformis
ref|XP_006601788.1|  PREDICTED: uncharacterized protein LOC100776...    119   1e-29   Glycine max [soybeans]
ref|XP_006601786.1|  PREDICTED: uncharacterized protein LOC100776...    119   2e-29   Glycine max [soybeans]
ref|NP_001242436.1|  uncharacterized protein LOC100776329               119   2e-29   Glycine max [soybeans]
ref|XP_006601785.1|  PREDICTED: uncharacterized protein LOC100776...    119   2e-29   Glycine max [soybeans]
ref|XP_008793863.1|  PREDICTED: serine/arginine-rich splicing fac...    119   2e-29   Phoenix dactylifera
ref|XP_008793865.1|  PREDICTED: serine/arginine-rich splicing fac...    119   3e-29   Phoenix dactylifera
ref|XP_010928600.1|  PREDICTED: serine/arginine-rich splicing fac...    119   4e-29   Elaeis guineensis
gb|KJB31255.1|  hypothetical protein B456_005G183600                    119   8e-29   Gossypium raimondii
ref|XP_009606699.1|  PREDICTED: serine/arginine-rich splicing fac...    117   1e-28   Nicotiana tomentosiformis
ref|XP_010023818.1|  PREDICTED: serine/arginine-rich splicing fac...    117   2e-28   
ref|XP_010271961.1|  PREDICTED: serine/arginine-rich splicing fac...    117   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_011013271.1|  PREDICTED: serine/arginine-rich splicing fac...    116   3e-28   Populus euphratica
ref|XP_006438430.1|  hypothetical protein CICLE_v10032693mg             117   3e-28   
ref|XP_008793862.1|  PREDICTED: serine/arginine-rich splicing fac...    116   4e-28   Phoenix dactylifera
ref|XP_011013270.1|  PREDICTED: serine/arginine-rich splicing fac...    116   4e-28   Populus euphratica
ref|XP_009606695.1|  PREDICTED: serine/arginine-rich splicing fac...    117   4e-28   Nicotiana tomentosiformis
ref|XP_008793864.1|  PREDICTED: serine/arginine-rich splicing fac...    116   5e-28   Phoenix dactylifera
ref|XP_010551560.1|  PREDICTED: serine/arginine-rich splicing fac...    115   8e-28   Tarenaya hassleriana [spider flower]
gb|KJB31257.1|  hypothetical protein B456_005G183600                    114   8e-28   Gossypium raimondii
gb|KHG11979.1|  Serine/arginine-rich splicing factor 7                  115   8e-28   Gossypium arboreum [tree cotton]
ref|XP_010551557.1|  PREDICTED: serine/arginine-rich splicing fac...    115   9e-28   Tarenaya hassleriana [spider flower]
gb|KJB31256.1|  hypothetical protein B456_005G183600                    115   1e-27   Gossypium raimondii
gb|KJB31251.1|  hypothetical protein B456_005G183600                    115   1e-27   Gossypium raimondii
ref|XP_010100489.1|  Serine/arginine-rich splicing factor 7             116   1e-27   
ref|XP_008340015.1|  PREDICTED: serine/arginine-rich splicing fac...    115   1e-27   Malus domestica [apple tree]
ref|XP_008340014.1|  PREDICTED: serine/arginine-rich splicing fac...    115   1e-27   Malus domestica [apple tree]
ref|XP_010914080.1|  PREDICTED: serine/arginine-rich splicing fac...    114   2e-27   Elaeis guineensis
ref|XP_006438427.1|  hypothetical protein CICLE_v10032693mg             114   2e-27   
ref|XP_010251307.1|  PREDICTED: serine/arginine-rich splicing fac...    114   2e-27   
ref|XP_006438428.1|  hypothetical protein CICLE_v10032693mg             114   2e-27   Citrus clementina [clementine]
ref|XP_008446226.1|  PREDICTED: serine/arginine-rich splicing fac...    114   2e-27   Cucumis melo [Oriental melon]
ref|XP_004509838.1|  PREDICTED: serine/arginine-rich splicing fac...    114   2e-27   Cicer arietinum [garbanzo]
ref|XP_010914079.1|  PREDICTED: serine/arginine-rich splicing fac...    114   2e-27   
ref|XP_008779620.1|  PREDICTED: serine/arginine-rich splicing fac...    114   2e-27   
ref|XP_010929222.1|  PREDICTED: serine/arginine-rich splicing fac...    114   3e-27   Elaeis guineensis
ref|XP_004155352.1|  PREDICTED: serine/arginine-rich splicing fac...    114   3e-27   
ref|XP_008794412.1|  PREDICTED: serine/arginine-rich splicing fac...    114   3e-27   Phoenix dactylifera
emb|CDP00182.1|  unnamed protein product                                114   3e-27   Coffea canephora [robusta coffee]
ref|XP_011013272.1|  PREDICTED: serine/arginine-rich splicing fac...    113   3e-27   Populus euphratica
emb|CDY59084.1|  BnaA09g54590D                                          112   4e-27   Brassica napus [oilseed rape]
ref|XP_010682582.1|  PREDICTED: serine/arginine-rich splicing fac...    113   4e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010929220.1|  PREDICTED: serine/arginine-rich splicing fac...    114   5e-27   Elaeis guineensis
ref|XP_006371254.1|  hypothetical protein POPTR_0019s07730g             113   7e-27   
ref|XP_002534324.1|  arginine/serine-rich splicing factor, putative     113   7e-27   Ricinus communis
gb|KDP26562.1|  hypothetical protein JCGZ_17720                         113   7e-27   Jatropha curcas
ref|XP_006371251.1|  hypothetical protein POPTR_0019s07730g             110   9e-27   
ref|XP_006416049.1|  hypothetical protein EUTSA_v10008869mg             112   9e-27   Eutrema salsugineum [saltwater cress]
ref|XP_007044557.1|  RS-containing zinc finger protein 21 isoform 1     112   1e-26   
gb|KJB15225.1|  hypothetical protein B456_002G165700                    113   1e-26   Gossypium raimondii
emb|CDY47646.1|  BnaC05g19020D                                          112   1e-26   Brassica napus [oilseed rape]
ref|XP_009115492.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Brassica rapa
ref|XP_009115493.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Brassica rapa
ref|XP_008389624.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Malus domestica [apple tree]
ref|XP_009363527.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_008389623.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Malus domestica [apple tree]
ref|XP_011463379.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Fragaria vesca subsp. vesca
ref|XP_009363525.1|  PREDICTED: serine/arginine-rich splicing fac...    112   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_004297645.1|  PREDICTED: serine/arginine-rich splicing fac...    112   2e-26   Fragaria vesca subsp. vesca
gb|AFK40774.1|  unknown                                                 112   2e-26   Lotus japonicus
ref|XP_006371252.1|  hypothetical protein POPTR_0019s07730g             111   2e-26   
ref|XP_006371253.1|  hypothetical protein POPTR_0019s07730g             111   2e-26   
ref|XP_008221783.1|  PREDICTED: serine/arginine-rich splicing fac...    110   5e-26   Prunus mume [ume]
ref|XP_008221782.1|  PREDICTED: serine/arginine-rich splicing fac...    110   5e-26   Prunus mume [ume]
ref|XP_003544651.1|  PREDICTED: serine/arginine-rich splicing fac...    110   7e-26   Glycine max [soybeans]
ref|XP_006596163.1|  PREDICTED: serine/arginine-rich splicing fac...    110   7e-26   Glycine max [soybeans]
ref|XP_006596162.1|  PREDICTED: serine/arginine-rich splicing fac...    110   7e-26   Glycine max [soybeans]
ref|XP_006600176.1|  PREDICTED: uncharacterized protein LOC100790...    110   8e-26   Glycine max [soybeans]
ref|NP_001241113.1|  uncharacterized protein LOC100790689               110   8e-26   Glycine max [soybeans]
ref|XP_006655864.1|  PREDICTED: serine/arginine-rich splicing fac...    110   1e-25   
ref|XP_006845500.1|  hypothetical protein AMTR_s00019p00154210          111   1e-25   
ref|XP_007161329.1|  hypothetical protein PHAVU_001G060500g             109   1e-25   Phaseolus vulgaris [French bean]
ref|XP_007223543.1|  hypothetical protein PRUPE_ppa012111mg             110   1e-25   
ref|XP_007161330.1|  hypothetical protein PHAVU_001G060500g             109   1e-25   Phaseolus vulgaris [French bean]
ref|XP_002264105.1|  PREDICTED: serine/arginine-rich splicing fac...    109   1e-25   Vitis vinifera
ref|XP_010653311.1|  PREDICTED: serine/arginine-rich splicing fac...    109   1e-25   Vitis vinifera
ref|NP_001057018.1|  Os06g0187900                                       109   1e-25   
ref|XP_002436620.1|  hypothetical protein SORBIDRAFT_10g005960          109   2e-25   Sorghum bicolor [broomcorn]
gb|AFW85524.1|  hypothetical protein ZEAMMB73_327204                    108   2e-25   
ref|XP_011077592.1|  PREDICTED: serine/arginine-rich splicing fac...    109   2e-25   
ref|XP_011082043.1|  PREDICTED: serine/arginine-rich splicing fac...    109   2e-25   Sesamum indicum [beniseed]
ref|XP_011077513.1|  PREDICTED: serine/arginine-rich splicing fac...    109   2e-25   
ref|XP_009415507.1|  PREDICTED: serine/arginine-rich splicing fac...    108   2e-25   
gb|ACG35084.1|  splicing factor, arginine/serine-rich 7                 108   2e-25   Zea mays [maize]
ref|NP_001149338.1|  LOC100282961                                       108   2e-25   
ref|XP_009395828.1|  PREDICTED: serine/arginine-rich splicing fac...    108   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942196.1|  PREDICTED: serine/arginine-rich splicing fac...    110   3e-25   Elaeis guineensis
ref|XP_003603553.1|  Splicing factor arginine/serine-rich               109   3e-25   
ref|XP_010942204.1|  PREDICTED: serine/arginine-rich splicing fac...    109   3e-25   Elaeis guineensis
ref|XP_004964637.1|  PREDICTED: serine/arginine-rich splicing fac...    108   3e-25   
ref|XP_010942202.1|  PREDICTED: serine/arginine-rich splicing fac...    110   3e-25   Elaeis guineensis
ref|XP_004964636.1|  PREDICTED: serine/arginine-rich splicing fac...    108   3e-25   
ref|XP_010942203.1|  PREDICTED: serine/arginine-rich splicing fac...    109   3e-25   
ref|XP_002272657.2|  PREDICTED: serine/arginine-rich splicing fac...    108   3e-25   Vitis vinifera
ref|XP_010648839.1|  PREDICTED: serine/arginine-rich splicing fac...    108   3e-25   Vitis vinifera
ref|XP_009386654.1|  PREDICTED: serine/arginine-rich splicing fac...    109   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942211.1|  PREDICTED: serine/arginine-rich splicing fac...    108   4e-25   Elaeis guineensis
ref|XP_010942200.1|  PREDICTED: serine/arginine-rich splicing fac...    110   4e-25   Elaeis guineensis
ref|XP_010942208.1|  PREDICTED: serine/arginine-rich splicing fac...    108   4e-25   Elaeis guineensis
ref|XP_010942194.1|  PREDICTED: serine/arginine-rich splicing fac...    110   4e-25   Elaeis guineensis
ref|XP_010942201.1|  PREDICTED: serine/arginine-rich splicing fac...    109   4e-25   Elaeis guineensis
ref|XP_010942207.1|  PREDICTED: serine/arginine-rich splicing fac...    108   4e-25   Elaeis guineensis
emb|CDP12463.1|  unnamed protein product                                108   4e-25   Coffea canephora [robusta coffee]
ref|XP_004964635.1|  PREDICTED: serine/arginine-rich splicing fac...    108   4e-25   
ref|XP_010942199.1|  PREDICTED: serine/arginine-rich splicing fac...    109   4e-25   Elaeis guineensis
ref|XP_010942209.1|  PREDICTED: serine/arginine-rich splicing fac...    108   4e-25   Elaeis guineensis
ref|XP_010942205.1|  PREDICTED: serine/arginine-rich splicing fac...    108   5e-25   Elaeis guineensis
gb|KJB53760.1|  hypothetical protein B456_009G066600                    106   5e-25   Gossypium raimondii
ref|XP_010942198.1|  PREDICTED: serine/arginine-rich splicing fac...    109   5e-25   Elaeis guineensis
ref|XP_010942197.1|  PREDICTED: serine/arginine-rich splicing fac...    109   5e-25   Elaeis guineensis
ref|XP_010942206.1|  PREDICTED: serine/arginine-rich splicing fac...    108   5e-25   Elaeis guineensis
gb|EEC80152.1|  hypothetical protein OsI_21961                          110   6e-25   Oryza sativa Indica Group [Indian rice]
gb|EEE65232.1|  hypothetical protein OsJ_20394                          109   7e-25   Oryza sativa Japonica Group [Japonica rice]
gb|KJB53756.1|  hypothetical protein B456_009G066600                    107   7e-25   Gossypium raimondii
gb|EMS45589.1|  Serine/arginine-rich splicing factor 7                  107   8e-25   Triticum urartu
gb|KJB53759.1|  hypothetical protein B456_009G066600                    107   8e-25   Gossypium raimondii
ref|XP_010278048.1|  PREDICTED: serine/arginine-rich splicing fac...    107   9e-25   Nelumbo nucifera [Indian lotus]
gb|KDO67328.1|  hypothetical protein CISIN_1g046599mg                   106   9e-25   Citrus sinensis [apfelsine]
gb|KJB53763.1|  hypothetical protein B456_009G066600                    107   9e-25   Gossypium raimondii
ref|XP_009765884.1|  PREDICTED: serine/arginine-rich splicing fac...    108   1e-24   Nicotiana sylvestris
emb|CAN74578.1|  hypothetical protein VITISV_009111                     109   1e-24   Vitis vinifera
ref|XP_004498562.1|  PREDICTED: serine/arginine-rich splicing fac...    107   2e-24   Cicer arietinum [garbanzo]
ref|XP_003564174.1|  PREDICTED: serine/arginine-rich splicing fac...    106   2e-24   Brachypodium distachyon [annual false brome]
gb|EMT27182.1|  Splicing factor, arginine/serine-rich 7                 106   2e-24   
gb|KDP33463.1|  hypothetical protein JCGZ_07034                         106   2e-24   Jatropha curcas
gb|ACX54788.2|  putative arginine/serine-rich splicing factor           106   2e-24   Arachis diogoi
ref|XP_003588649.1|  RNA-binding protein Rsf1                           106   2e-24   
ref|XP_006450201.1|  hypothetical protein CICLE_v10009655mg             106   2e-24   
gb|AAY84872.1|  pre-mRNA processing factor                              105   2e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006647490.1|  PREDICTED: serine/arginine-rich splicing fac...    107   3e-24   Oryza brachyantha
ref|XP_002454683.1|  hypothetical protein SORBIDRAFT_04g035540          105   3e-24   Sorghum bicolor [broomcorn]
ref|XP_006647491.1|  PREDICTED: serine/arginine-rich splicing fac...    106   3e-24   Oryza brachyantha
ref|XP_006305671.1|  hypothetical protein CARUB_v10010388mg             106   3e-24   Capsella rubella
ref|XP_004954180.1|  PREDICTED: serine/arginine-rich splicing fac...    105   3e-24   Setaria italica
dbj|BAJ94659.1|  predicted protein                                      105   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009363631.1|  PREDICTED: serine/arginine-rich splicing fac...    105   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_006357055.1|  PREDICTED: serine/arginine-rich splicing fac...    105   4e-24   Solanum tuberosum [potatoes]
ref|XP_002893311.1|  hypothetical protein ARALYDRAFT_472646             105   4e-24   
ref|XP_009396254.1|  PREDICTED: serine/arginine-rich splicing fac...    107   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGE46109.1|  arginine/serine-rich splicing factor RSZ19 transc...    105   4e-24   Sorghum bicolor [broomcorn]
ref|XP_009396262.1|  PREDICTED: serine/arginine-rich splicing fac...    106   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004244489.1|  PREDICTED: serine/arginine-rich splicing fac...    105   5e-24   Solanum lycopersicum
ref|NP_001132794.1|  hypothetical protein                               105   6e-24   
gb|EPS72339.1|  hypothetical protein M569_02421                         105   6e-24   Genlisea aurea
ref|XP_011459026.1|  PREDICTED: serine/arginine-rich splicing fac...    105   6e-24   Fragaria vesca subsp. vesca
ref|XP_010268362.1|  PREDICTED: serine/arginine-rich splicing fac...    107   6e-24   
gb|EEE57352.1|  hypothetical protein OsJ_07486                          105   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047400.1|  Os02g0610600                                       105   7e-24   
ref|XP_004291288.1|  PREDICTED: serine/arginine-rich splicing fac...    105   7e-24   Fragaria vesca subsp. vesca
ref|XP_007225929.1|  hypothetical protein PRUPE_ppa012147mg             105   8e-24   Prunus persica
ref|XP_009614737.1|  PREDICTED: serine/arginine-rich splicing fac...    104   9e-24   Nicotiana tomentosiformis
ref|XP_009614738.1|  PREDICTED: serine/arginine-rich splicing fac...    104   1e-23   Nicotiana tomentosiformis
ref|XP_009614739.1|  PREDICTED: serine/arginine-rich splicing fac...    104   1e-23   Nicotiana tomentosiformis
ref|XP_010325195.1|  PREDICTED: serine/arginine-rich splicing fac...    104   1e-23   Solanum lycopersicum
ref|XP_010692998.1|  PREDICTED: serine/arginine-rich splicing fac...    104   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004245307.1|  PREDICTED: serine/arginine-rich splicing fac...    104   1e-23   Solanum lycopersicum
ref|XP_007011623.1|  Serine/arginine-rich 22 isoform 1                  104   1e-23   
ref|XP_011031384.1|  PREDICTED: serine/arginine-rich splicing fac...    104   1e-23   Populus euphratica
ref|XP_006382133.1|  splicing factor RSZp22 family protein              104   1e-23   Populus trichocarpa [western balsam poplar]
ref|NP_001117342.1|  serine/arginine-rich splicing factor RSZ21         103   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KJB68433.1|  hypothetical protein B456_010G245400                    104   2e-23   Gossypium raimondii
gb|ABK24519.1|  unknown                                                 103   2e-23   Picea sitchensis
ref|XP_010112118.1|  Serine/arginine-rich splicing factor 7             103   2e-23   Morus notabilis
gb|KHG09265.1|  Serine/arginine-rich splicing factor 7                  103   2e-23   Gossypium arboreum [tree cotton]
ref|XP_006355194.1|  PREDICTED: serine/arginine-rich splicing fac...    103   2e-23   Solanum tuberosum [potatoes]
ref|NP_001140388.1|  uncharacterized protein LOC100272442               102   2e-23   
gb|KJB68434.1|  hypothetical protein B456_010G245400                    105   2e-23   Gossypium raimondii
emb|CAA05351.1|  RSZp21 protein                                         103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564208.1|  serine/arginine-rich splicing factor RSZ21            103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185074.1|  serine/arginine-rich splicing factor RSZ21         103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355197.1|  PREDICTED: serine/arginine-rich splicing fac...    103   3e-23   Solanum tuberosum [potatoes]
gb|AAF87159.1|AC002423_24  T23E23.2                                     103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009630985.1|  PREDICTED: serine/arginine-rich splicing fac...    103   4e-23   
ref|XP_010498892.1|  PREDICTED: serine/arginine-rich splicing fac...    103   4e-23   
ref|XP_010498894.1|  PREDICTED: serine/arginine-rich splicing fac...    103   4e-23   
ref|XP_009630986.1|  PREDICTED: serine/arginine-rich splicing fac...    103   4e-23   Nicotiana tomentosiformis
ref|XP_008466294.1|  PREDICTED: serine/arginine-rich splicing fac...    103   5e-23   Cucumis melo [Oriental melon]
ref|XP_004136307.1|  PREDICTED: serine/arginine-rich splicing fac...    103   5e-23   Cucumis sativus [cucumbers]
ref|XP_009353338.1|  PREDICTED: serine/arginine-rich splicing fac...    102   5e-23   Pyrus x bretschneideri [bai li]
ref|XP_009353337.1|  PREDICTED: serine/arginine-rich splicing fac...    102   6e-23   Pyrus x bretschneideri [bai li]
gb|AGE46162.1|  arginine/serine-rich splicing factor RSZ23 transc...    101   6e-23   Physcomitrella patens
ref|XP_010526263.1|  PREDICTED: serine/arginine-rich splicing fac...    102   6e-23   Tarenaya hassleriana [spider flower]
ref|NP_001147002.1|  LOC100280612                                       102   7e-23   Zea mays [maize]
ref|XP_009353309.1|  PREDICTED: serine/arginine-rich splicing fac...    102   7e-23   Pyrus x bretschneideri [bai li]
gb|KJB65745.1|  hypothetical protein B456_010G121100                    102   7e-23   Gossypium raimondii
ref|XP_001776556.1|  predicted protein                                  102   7e-23   
gb|EYU29179.1|  hypothetical protein MIMGU_mgv1a014305mg                102   7e-23   Erythranthe guttata [common monkey flower]
gb|AGC79943.1|  arginine/serine-rich splicing factor RSZ28VI            102   7e-23   Zea mays [maize]
ref|XP_009779999.1|  PREDICTED: serine/arginine-rich splicing fac...    102   8e-23   Nicotiana sylvestris
ref|XP_009780000.1|  PREDICTED: serine/arginine-rich splicing fac...    102   8e-23   Nicotiana sylvestris
gb|KJB65743.1|  hypothetical protein B456_010G121100                    102   9e-23   Gossypium raimondii
ref|XP_004953059.1|  PREDICTED: serine/arginine-rich splicing fac...    103   9e-23   Setaria italica
gb|KJB65740.1|  hypothetical protein B456_010G121100                    102   9e-23   Gossypium raimondii
gb|AGE46161.1|  arginine/serine-rich splicing factor RSZ23 transc...    102   1e-22   Physcomitrella patens
gb|AGE46163.1|  arginine/serine-rich splicing factor RSZ23 transc...    102   1e-22   Physcomitrella patens
ref|XP_010477689.1|  PREDICTED: serine/arginine-rich splicing fac...    101   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008681365.1|  PREDICTED: uncharacterized protein LOC100272...    102   1e-22   Zea mays [maize]
ref|XP_011044978.1|  PREDICTED: serine/arginine-rich splicing fac...    102   1e-22   Populus euphratica
ref|XP_006284575.1|  hypothetical protein CARUB_v10005800mg             102   1e-22   Capsella rubella
ref|XP_010477687.1|  PREDICTED: serine/arginine-rich splicing fac...    101   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006648032.1|  PREDICTED: serine/arginine-rich splicing fac...    101   1e-22   Oryza brachyantha
ref|XP_006648031.1|  PREDICTED: serine/arginine-rich splicing fac...    101   2e-22   Oryza brachyantha
ref|NP_001048352.1|  Os02g0789400                                       101   2e-22   
ref|XP_008681360.1|  PREDICTED: uncharacterized protein LOC100272...    102   2e-22   
ref|XP_006647492.1|  PREDICTED: serine/arginine-rich splicing fac...    101   2e-22   
ref|XP_008681364.1|  PREDICTED: uncharacterized protein LOC100272...    102   2e-22   
gb|ACG44253.1|  splicing factor, arginine/serine-rich 7                 102   2e-22   Zea mays [maize]
ref|XP_010447518.1|  PREDICTED: serine/arginine-rich splicing fac...    101   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010432845.1|  PREDICTED: serine/arginine-rich splicing fac...    101   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010438021.1|  PREDICTED: serine/arginine-rich splicing fac...    101   2e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001141411.1|  uncharacterized protein LOC100273521               102   2e-22   
ref|XP_008676820.1|  PREDICTED: uncharacterized protein LOC100273...    103   2e-22   
ref|XP_010235900.1|  PREDICTED: serine/arginine-rich splicing fac...    101   2e-22   
ref|XP_001782492.1|  predicted protein                                  102   2e-22   
ref|XP_008357431.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    101   2e-22   
gb|AGE46101.1|  arginine/serine-rich splicing factor RSZ28 transc...    102   3e-22   Sorghum bicolor [broomcorn]
ref|XP_006412579.1|  hypothetical protein EUTSA_v10026315mg             100   4e-22   Eutrema salsugineum [saltwater cress]
ref|XP_009138024.1|  PREDICTED: serine/arginine-rich splicing fac...    100   4e-22   Brassica rapa
gb|AFW64196.1|  hypothetical protein ZEAMMB73_035767                  99.0    5e-22   
emb|CDY68847.1|  BnaAnng28560D                                          100   5e-22   Brassica napus [oilseed rape]
gb|AFW64191.1|  hypothetical protein ZEAMMB73_035767                    100   7e-22   
emb|CDX72313.1|  BnaC07g43350D                                        99.8    8e-22   
ref|XP_009140565.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    1e-21   Brassica rapa
gb|EMT04120.1|  Splicing factor, arginine/serine-rich 7                 100   1e-21   
ref|XP_010460161.1|  PREDICTED: serine/arginine-rich splicing fac...  99.4    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010460162.1|  PREDICTED: serine/arginine-rich splicing fac...  99.4    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_003575333.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    2e-21   Brachypodium distachyon [annual false brome]
ref|XP_010235684.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    2e-21   Brachypodium distachyon [annual false brome]
gb|AAY84871.1|  pre-mRNA processing factor                            99.0    2e-21   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ98217.1|  predicted protein                                    98.6    2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS62939.1|  Serine/arginine-rich splicing factor 7                99.8    2e-21   Triticum urartu
gb|EMT10866.1|  Splicing factor, arginine/serine-rich 7               99.8    2e-21   
gb|EPS60072.1|  hypothetical protein M569_14729                       98.6    2e-21   Genlisea aurea
ref|XP_006295037.1|  hypothetical protein CARUB_v10024105mg           97.1    3e-21   
ref|XP_010429442.1|  PREDICTED: serine/arginine-rich splicing fac...  98.2    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010417215.1|  PREDICTED: serine/arginine-rich splicing fac...  98.2    4e-21   Camelina sativa [gold-of-pleasure]
gb|EMS58509.1|  Serine/arginine-rich splicing factor 7                  100   4e-21   Triticum urartu
gb|AFW64195.1|  hypothetical protein ZEAMMB73_035767                  97.4    4e-21   
ref|XP_006295038.1|  hypothetical protein CARUB_v10024105mg           97.4    7e-21   
ref|XP_009117114.1|  PREDICTED: serine/arginine-rich splicing fac...  97.4    8e-21   
gb|KJB53757.1|  hypothetical protein B456_009G066600                  97.1    9e-21   Gossypium raimondii
ref|NP_180035.1|  serine/arginine-rich splicing factor RSZ22A         97.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194886.1|  protein serine/arginine-rich 22                     97.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878770.1|  hypothetical protein ARALYDRAFT_481315           96.7    1e-20   
ref|XP_006404997.1|  hypothetical protein EUTSA_v10000328mg           96.7    1e-20   
emb|CDX76804.1|  BnaC08g33900D                                          101   1e-20   
ref|XP_002324943.1|  splicing factor RSZp22 family protein            96.7    1e-20   
ref|XP_002869320.1|  hypothetical protein ARALYDRAFT_491582           96.3    1e-20   
emb|CDY13444.1|  BnaA03g51620D                                        95.9    2e-20   Brassica napus [oilseed rape]
emb|CAA05352.1|  RSZp22 protein                                       95.1    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002963848.1|  hypothetical protein SELMODRAFT_68846            93.2    1e-19   
ref|XP_002971799.1|  hypothetical protein SELMODRAFT_172361           93.6    3e-19   
ref|XP_004135236.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  92.0    3e-19   
ref|XP_002515364.1|  arginine/serine-rich splicing factor, putative   88.6    8e-18   
gb|KGN51817.1|  hypothetical protein Csa_5G602160                     89.7    9e-18   Cucumis sativus [cucumbers]
ref|XP_006836638.1|  hypothetical protein AMTR_s00088p00022360        85.9    2e-17   
ref|XP_010041973.1|  PREDICTED: serine/arginine-rich splicing fac...  83.6    2e-16   
ref|XP_006371787.1|  hypothetical protein POPTR_0018s03390g           82.8    5e-16   
ref|XP_011044979.1|  PREDICTED: serine/arginine-rich splicing fac...  82.4    6e-16   Populus euphratica
gb|KFM73334.1|  Serine/arginine-rich splicing factor 7                82.0    1e-15   Stegodyphus mimosarum
gb|ABK96398.1|  unknown                                               82.0    1e-15   Populus trichocarpa x Populus deltoides
gb|AGE46106.1|  arginine/serine-rich splicing factor RSZ21 transc...  78.6    3e-15   Sorghum bicolor [broomcorn]
ref|XP_002954355.1|  hypothetical protein VOLCADRAFT_121301           81.6    6e-15   Volvox carteri f. nagariensis
ref|XP_011345270.1|  PREDICTED: serine/arginine-rich splicing fac...  77.8    5e-14   
emb|CDQ61352.1|  unnamed protein product                              77.0    5e-14   Oncorhynchus mykiss
ref|XP_011345274.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    5e-14   Ooceraea biroi
gb|ACI34086.1|  Splicing factor, arginine/serine-rich 7               76.3    6e-14   Salmo salar
ref|XP_011345273.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    6e-14   
ref|XP_005646678.1|  P-loop containing nucleoside triphosphate hy...  81.3    6e-14   Coccomyxa subellipsoidea C-169
gb|EFN84192.1|  Splicing factor, arginine/serine-rich 7               75.9    7e-14   Harpegnathos saltator
ref|XP_007261039.1|  PREDICTED: serine/arginine-rich splicing fac...  77.8    8e-14   Astyanax mexicanus [blind cave fish]
emb|CAQ34906.1|  SR family splicing factor 9G8                        77.4    9e-14   Chironomus tentans
emb|CDQ57584.1|  unnamed protein product                              77.4    1e-13   Oncorhynchus mykiss
ref|XP_011139797.1|  PREDICTED: serine/arginine-rich splicing fac...  77.0    1e-13   
ref|XP_007261040.1|  PREDICTED: serine/arginine-rich splicing fac...  77.0    1e-13   Astyanax mexicanus [blind cave fish]
ref|XP_010896865.1|  PREDICTED: serine/arginine-rich splicing fac...  77.0    1e-13   
gb|ACY66497.1|  splicing factor arginine/serine-rich 7                74.7    2e-13   
ref|XP_008299855.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    2e-13   
gb|EFN68328.1|  Splicing factor, arginine/serine-rich 7               75.5    2e-13   
ref|XP_008299854.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    2e-13   
ref|XP_011139799.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    2e-13   
ref|XP_008299853.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    2e-13   
ref|XP_011065218.1|  PREDICTED: serine/arginine-rich splicing fac...  76.3    2e-13   
ref|XP_011256516.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    2e-13   
ref|XP_011256515.1|  PREDICTED: serine/arginine-rich splicing fac...  75.5    3e-13   
gb|ENN79141.1|  hypothetical protein YQE_04326                        75.1    4e-13   
ref|XP_001696769.1|  SR protein factor                                75.1    5e-13   
gb|EFB26062.1|  hypothetical protein PANDA_013342                     73.6    5e-13   
dbj|BAC28058.1|  unnamed protein product                              73.9    6e-13   
gb|AAH27391.1|  Sfrs7 protein                                         73.9    6e-13   
ref|XP_005264543.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    6e-13   
gb|EDL38512.1|  mCG17902, isoform CRA_k                               74.3    6e-13   
ref|XP_007521053.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    6e-13   
ref|XP_007231851.1|  PREDICTED: serine/arginine-rich splicing fac...  75.1    6e-13   
ref|XP_006007835.1|  PREDICTED: serine/arginine-rich splicing fac...  75.1    6e-13   
gb|AAH99175.1|  Splicing factor, arginine/serine-rich 7               73.9    6e-13   
ref|XP_004616150.1|  PREDICTED: serine/arginine-rich splicing fac...  75.5    6e-13   
gb|ACO09302.1|  Splicing factor, arginine/serine-rich 7               74.7    6e-13   
tpg|DAA34137.1|  TPA: alternative splicing factor SRp20/9G8           74.3    6e-13   
ref|XP_002435756.1|  RSZp22 protein, putative                         74.7    7e-13   
gb|EAX00364.1|  splicing factor, arginine/serine-rich 7, 35kDa, i...  73.2    7e-13   
gb|KFM74863.1|  Serine/arginine-rich splicing factor 7                74.3    7e-13   
ref|NP_001007487.1|  serine/arginine-rich splicing factor 7           74.7    7e-13   
ref|XP_007431750.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  74.7    8e-13   
dbj|BAG57113.1|  unnamed protein product                              73.6    9e-13   
ref|XP_002799297.1|  PREDICTED: splicing factor, arginine/serine-...  73.6    9e-13   
ref|XP_007231852.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    9e-13   
ref|XP_006756032.1|  PREDICTED: serine/arginine-rich splicing fac...  75.1    9e-13   
ref|XP_007059045.1|  PREDICTED: serine/arginine-rich splicing fac...  75.5    1e-12   
ref|XP_009697947.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    1e-12   
gb|EFZ13615.1|  hypothetical protein SINV_15244                       72.8    1e-12   
gb|KFP58154.1|  Serine/arginine-rich splicing factor 7                72.4    1e-12   
gb|AGM32477.1|  serine/arginine-rich splicing factor 7-like protein   74.7    1e-12   
ref|XP_009576594.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    1e-12   
ref|XP_317163.4|  AGAP008303-PA                                       74.3    1e-12   
gb|EDL38508.1|  mCG17902, isoform CRA_g                               73.6    1e-12   
ref|XP_001952396.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    1e-12   
ref|XP_008199911.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_001506905.2|  PREDICTED: serine/arginine-rich splicing fac...  75.1    1e-12   
ref|XP_011166842.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    1e-12   
gb|KDR21665.1|  hypothetical protein L798_03790                       72.0    1e-12   
ref|XP_006024998.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_006024996.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    1e-12   
ref|XP_004322276.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    1e-12   
ref|XP_004322277.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_002799299.1|  PREDICTED: splicing factor, arginine/serine-...  73.9    1e-12   
ref|XP_006638601.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    1e-12   
ref|NP_001086618.1|  MGC78845 protein                                 73.9    1e-12   
ref|XP_003216147.2|  PREDICTED: serine/arginine-rich splicing fac...  74.3    1e-12   
ref|NP_991236.1|  splicing factor, arginine/serine-rich 7             74.3    1e-12   
ref|NP_001086749.1|  serine/arginine-rich splicing factor 7           73.9    1e-12   
ref|XP_006083499.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_008100901.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    1e-12   
ref|XP_007477078.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_006266228.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_008160446.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|XP_004369600.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    1e-12   
ref|NP_001026854.1|  serine/arginine-rich splicing factor 7 isofo...  73.9    1e-12   
ref|XP_006024995.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    1e-12   
ref|XP_006083500.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_001623405.1|  predicted protein                                72.4    2e-12   
gb|EGV93510.1|  Splicing factor, arginine/serine-rich 7               73.9    2e-12   
ref|XP_003758396.1|  PREDICTED: uncharacterized protein LOC100934570  73.9    2e-12   
ref|XP_005165347.1|  PREDICTED: splicing factor, arginine/serine-...  73.9    2e-12   
ref|XP_006083501.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_001362853.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_008160447.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_003473085.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|NP_001182415.1|  serine/arginine-rich splicing factor 7 isofo...  73.9    2e-12   
ref|XP_005073675.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_003795721.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_003416134.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
gb|AAP36622.1|  Homo sapiens splicing factor, arginine/serine-ric...  73.9    2e-12   
ref|XP_003216148.2|  PREDICTED: serine/arginine-rich splicing fac...  74.3    2e-12   
ref|XP_005212641.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_005073679.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|NP_001182517.1|  splicing factor, arginine/serine-rich 7          73.9    2e-12   
ref|XP_006909721.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_004686337.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_004466066.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_006239708.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_005073677.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_003795722.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_004711175.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_006083502.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_011314544.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_008165291.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_005264542.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_010594178.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_005073676.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_003473084.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_008252733.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_789638.1|  PREDICTED: serine/arginine-rich splicing factor...  73.6    2e-12   
ref|XP_005073678.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_003473086.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|NP_001182416.1|  serine/arginine-rich splicing factor 7 isofo...  73.6    2e-12   
ref|NP_001182414.1|  serine/arginine-rich splicing factor 7 isofo...  73.9    2e-12   
ref|XP_010139387.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_004369601.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|NP_001182375.1|  serine/arginine-rich splicing factor 7 isofo...  73.6    2e-12   
ref|XP_011166841.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_005264541.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|XP_006909723.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_004686338.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_003125259.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_006239706.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
dbj|BAM18099.1|  hypothetical protein                                 72.4    2e-12   
ref|NP_001029449.1|  serine/arginine-rich splicing factor 7           73.9    2e-12   
ref|XP_006909722.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
ref|NP_666195.1|  serine/arginine-rich splicing factor 7 isoform 1    73.9    2e-12   
gb|EDL38513.1|  mCG17902, isoform CRA_l                               73.9    2e-12   
ref|XP_004466067.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    2e-12   
gb|ABR68245.1|  arginine/serine-rich 7 splicing factor                73.6    2e-12   
ref|XP_004711176.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_004466068.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_008478365.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    2e-12   
ref|XP_011314543.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    2e-12   
ref|XP_005390947.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    2e-12   
ref|XP_006909724.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_004765571.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_011314540.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    2e-12   
gb|EDL38503.1|  mCG17902, isoform CRA_b                               73.2    2e-12   
gb|EDL38510.1|  mCG17902, isoform CRA_i                               73.2    2e-12   
ref|XP_002426207.1|  transformer-2 sex-determining protein, putative  72.8    2e-12   
ref|XP_005987956.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    2e-12   
ref|XP_005525415.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_006139716.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  73.6    2e-12   
gb|EDM02777.1|  rCG61762, isoform CRA_f                               73.2    2e-12   
gb|ETN58909.1|  arginine/serine-rich splicing factor 7                73.2    2e-12   
ref|XP_011314541.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    2e-12   
ref|XP_009697946.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    2e-12   
gb|KFO92806.1|  Serine/arginine-rich splicing factor 7                73.6    2e-12   
ref|XP_007543744.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    2e-12   
gb|AAH14857.1|  Sfrs7 protein                                         73.2    2e-12   
ref|XP_004075259.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    2e-12   
ref|XP_010704946.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   
ref|XP_005987955.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    3e-12   
ref|XP_007543743.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_007543742.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
gb|EDL38504.1|  mCG17902, isoform CRA_c                               73.6    3e-12   
ref|XP_005019191.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_010149335.1|  PREDICTED: serine/arginine-rich splicing fac...  71.6    3e-12   
sp|Q8BL97.1|SRSF7_MOUSE  RecName: Full=Serine/arginine-rich splic...  73.6    3e-12   
ref|XP_008418926.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   
ref|XP_008418934.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   
ref|NP_001091768.1|  arginine/serine-rich splicing factor 7           72.4    3e-12   
ref|XP_005489408.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_006627604.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_009890788.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   
ref|XP_010215487.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    3e-12   
ref|XP_010409393.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_009474081.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    3e-12   
ref|XP_005019190.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_008503195.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   
ref|XP_005525416.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_005436813.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    3e-12   
ref|XP_005019189.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_005155255.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  73.2    3e-12   
ref|XP_006151425.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    3e-12   
ref|XP_006151426.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    3e-12   
ref|XP_005489407.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_009890787.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    3e-12   
ref|XP_005232393.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_009919178.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_007969081.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    3e-12   
ref|XP_005576132.1|  PREDICTED: serine/arginine-rich splicing fac...  74.3    3e-12   
ref|XP_009685242.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    3e-12   
ref|XP_009643084.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
ref|XP_005576134.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    4e-12   
ref|XP_009944004.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
ref|XP_009554837.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
ref|XP_010006960.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
ref|XP_005576135.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    4e-12   
gb|KFQ98515.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
gb|KFW75578.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
gb|EMC83651.1|  Splicing factor, arginine/serine-rich 7               72.8    4e-12   
ref|XP_007969082.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    4e-12   
gb|ACM08812.1|  Splicing factor, arginine/serine-rich 7               73.2    4e-12   
ref|XP_006151423.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    4e-12   
ref|XP_006151424.1|  PREDICTED: serine/arginine-rich splicing fac...  73.6    4e-12   
ref|XP_005436812.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    4e-12   
ref|XP_008503193.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
ref|XP_009331994.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
ref|XP_008503194.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    4e-12   
gb|KFP73133.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
ref|XP_010767444.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    4e-12   
gb|KFU83702.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
ref|XP_008931337.1|  PREDICTED: serine/arginine-rich splicing fac...  73.2    4e-12   
gb|KFQ05617.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
gb|KFP08902.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
gb|KFV61724.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
gb|KGL79003.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
gb|KFO72995.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
ref|XP_005576133.1|  PREDICTED: serine/arginine-rich splicing fac...  73.9    4e-12   
gb|KFO96956.1|  Serine/arginine-rich splicing factor 7                72.8    4e-12   
ref|XP_009876042.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    4e-12   
emb|CDQ76123.1|  unnamed protein product                              73.2    4e-12   
ref|XP_004935327.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    4e-12   
ref|XP_004207769.1|  PREDICTED: serine/arginine-rich splicing fac...  72.0    4e-12   
ref|XP_010739889.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    4e-12   
ref|XP_004935328.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    5e-12   
gb|KFQ35530.1|  Serine/arginine-rich splicing factor 7                72.8    5e-12   
ref|NP_001232123.1|  putative splicing factor arginine/serine-ric...  72.8    5e-12   
ref|XP_003690755.1|  PREDICTED: serine/arginine-rich splicing fac...  72.0    5e-12   
ref|XP_003640982.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    5e-12   
ref|XP_008307133.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    5e-12   
ref|XP_009094420.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    5e-12   
ref|XP_010182626.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    5e-12   
gb|KFO23309.1|  Heterogeneous nuclear ribonucleoprotein L-like        75.1    5e-12   
gb|EHJ66310.1|  arginine/serine-rich splicing factor 7                71.6    5e-12   
ref|XP_001367778.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    5e-12   
ref|XP_009983999.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  72.8    5e-12   
gb|KFV87460.1|  Serine/arginine-rich splicing factor 7                72.4    5e-12   
ref|XP_003768907.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    5e-12   
ref|XP_011190692.1|  PREDICTED: serine/arginine-rich splicing fac...  72.8    6e-12   
ref|XP_005737479.1|  PREDICTED: serine/arginine-rich splicing fac...  72.4    6e-12   



>ref|XP_009792571.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nicotiana 
sylvestris]
Length=200

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPGYAFIEFDDRRDALDA+R LDGKNGWRVELSHNSSG  GGR   GGDD+
Sbjct  28   LRSVWVARQPPGYAFIEFDDRRDALDAIRELDGKNGWRVELSHNSSGRGGGRGGRGGDDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>gb|KHN10603.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=186

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_003532014.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Glycine max]
 ref|XP_006585955.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Glycine max]
Length=176

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_009606700.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X4 [Nicotiana tomentosiformis]
Length=172

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVARRPPGYAFIEFDDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDT  87

Query  556  KCYECGEPGHFAREC  512
            KCY+CGEPGHFAREC
Sbjct  88   KCYQCGEPGHFAREC  102



>ref|XP_009606697.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009606698.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Nicotiana tomentosiformis]
Length=200

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVARRPPGYAFIEFDDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDT  87

Query  556  KCYECGEPGHFAREC  512
            KCY+CGEPGHFAREC
Sbjct  88   KCYQCGEPGHFAREC  102



>ref|XP_006601788.1| PREDICTED: uncharacterized protein LOC100776329 isoform X4 [Glycine 
max]
Length=161

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            L SVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+
Sbjct  28   LMSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_006601786.1| PREDICTED: uncharacterized protein LOC100776329 isoform X2 [Glycine 
max]
 ref|XP_006601787.1| PREDICTED: uncharacterized protein LOC100776329 isoform X3 [Glycine 
max]
Length=173

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            L SVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+
Sbjct  28   LMSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|NP_001242436.1| uncharacterized protein LOC100776329 [Glycine max]
 gb|ACU20711.1| unknown [Glycine max]
Length=177

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            L SVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+
Sbjct  28   LMSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_006601785.1| PREDICTED: uncharacterized protein LOC100776329 isoform X1 [Glycine 
max]
Length=177

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            L SVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS GG  G    GG+D+
Sbjct  28   LMSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGRGGRGRGGEDT  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_008793863.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X2 [Phoenix dactylifera]
Length=179

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGYAF+EFDDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGD
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGD  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DMKCYECGEPGHFAREC  104



>ref|XP_008793865.1| PREDICTED: serine/arginine-rich splicing factor RSZ23 isoform 
X4 [Phoenix dactylifera]
Length=176

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGYAF+EFDDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGD
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGD  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DMKCYECGEPGHFAREC  104



>ref|XP_010928600.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Elaeis 
guineensis]
Length=182

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrg  572
            LRSVWVARRPPGYAF+EFDDRRDALDA+RGLDGKNGWRVELSHNS      GG  G  RG
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDALDAIRGLDGKNGWRVELSHNSKGGGGGGGGRGGRRG  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GGDD KCYECGEPGHFAREC
Sbjct  88   GGDDMKCYECGEPGHFAREC  107



>gb|KJB31255.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=209

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_009606699.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Nicotiana tomentosiformis]
Length=177

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  730  SVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKC  551
            SVWVARRPPGYAFIEFDDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+KC
Sbjct  7    SVWVARRPPGYAFIEFDDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKC  66

Query  550  YECGEPGHFAREC  512
            Y+CGEPGHFAREC
Sbjct  67   YQCGEPGHFAREC  79



>ref|XP_010023818.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 ref|XP_010023819.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 ref|XP_010023820.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 gb|KCW60183.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60184.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60185.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60186.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
Length=188

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNs-----sggrggrsrg  572
            LRSVWVARRPPGYAFIEFDDRRDALDA+R LDGKNGWRVE+SHN       GGRGGR  G
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIRSLDGKNGWRVEVSHNKGGGGRGGGRGGRGFG  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG+DSKCYECGEPGHFAREC
Sbjct  88   GGEDSKCYECGEPGHFAREC  107



>ref|XP_010271961.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Nelumbo 
nucifera]
Length=184

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LRSVWVAR+PPGYAF+EFDDRRDALDA+RGLDGKNGWRVELSHNS     G  GGR RGG
Sbjct  28   LRSVWVARKPPGYAFVEFDDRRDALDAIRGLDGKNGWRVELSHNSKGGGGGRGGGRGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+D KCYECGEPGHFAREC
Sbjct  88   GEDLKCYECGEPGHFAREC  106



>ref|XP_011013271.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Populus euphratica]
Length=176

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGG
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+DSKCYECGEPGHFAREC
Sbjct  88   GEDSKCYECGEPGHFAREC  106



>ref|XP_006438430.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|ESR51670.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|KDO82501.1| hypothetical protein CISIN_1g041602mg [Citrus sinensis]
Length=223

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS   GGRGGR RGGG+
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGE  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DLKCYECGEPGHFAREC  104



>ref|XP_008793862.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X1 [Phoenix dactylifera]
Length=182

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = -2

Query  730  SVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDS  557
            SVWVARRPPGYAF+EFDDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGDD 
Sbjct  33   SVWVARRPPGYAFVEFDDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGDDM  92

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  93   KCYECGEPGHFAREC  107



>ref|XP_011013270.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Populus euphratica]
Length=180

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGG
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+DSKCYECGEPGHFAREC
Sbjct  88   GEDSKCYECGEPGHFAREC  106



>ref|XP_009606695.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009606696.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Nicotiana tomentosiformis]
Length=204

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCY  548
            VWVARRPPGYAFIEFDDRRDALDA+  LDGKNGWRVELSHNSSG  GGR   GGDD+KCY
Sbjct  35   VWVARRPPGYAFIEFDDRRDALDAIHELDGKNGWRVELSHNSSGRGGGRGGRGGDDTKCY  94

Query  547  ECGEPGHFAREC  512
            +CGEPGHFAREC
Sbjct  95   QCGEPGHFAREC  106



>ref|XP_008793864.1| PREDICTED: serine/arginine-rich splicing factor RSZ23 isoform 
X3 [Phoenix dactylifera]
Length=179

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = -2

Query  730  SVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGDDS  557
            SVWVARRPPGYAF+EFDDRRDALDA+RGLDG+NGWRVELSHNS   GG  G  R GGDD 
Sbjct  33   SVWVARRPPGYAFVEFDDRRDALDAIRGLDGRNGWRVELSHNSKGGGGGRGGRRSGGDDM  92

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  93   KCYECGEPGHFAREC  107



>ref|XP_010551560.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Tarenaya hassleriana]
Length=183

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAF+EFDD RDA+DA+R LDGKNGWRVELSHN+  G  GG  RGGGDD
Sbjct  28   LRSVWVARRPPGYAFLEFDDERDAMDAIRALDGKNGWRVELSHNNKGGRGGGGRRGGGDD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   MKCYECGEPGHFAREC  103



>gb|KJB31257.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=137

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>gb|KHG11979.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=177

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_010551557.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010551558.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010551559.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
Length=184

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAF+EFDD RDA+DA+R LDGKNGWRVELSHN+  G  GG  RGGGDD
Sbjct  28   LRSVWVARRPPGYAFLEFDDERDAMDAIRALDGKNGWRVELSHNNKGGRGGGGRRGGGDD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   MKCYECGEPGHFAREC  103



>gb|KJB31256.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=172

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>gb|KJB31251.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31252.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31253.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31254.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=175

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDDRRDA+DA+R LDGKNGWRVELSHNS  GG  G  RGGG+D
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDAIDAIRELDGKNGWRVELSHNSKGGGGRGGRRGGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_010100489.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXB82623.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=244

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 69/79 (87%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LRSVWVARRPPGYAF+EFDDRRDALDA++ LDGKNGWRVELSHNS      G GGR RGG
Sbjct  28   LRSVWVARRPPGYAFLEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGGRGGGGRGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            GDD KCYECGEPGHFAREC
Sbjct  88   GDDLKCYECGEPGHFAREC  106



>ref|XP_008340015.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Malus domestica]
Length=181

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggG  566
            LR+VWVARRPPGYAFIEFDDRRDALDAV+ LDGKNGWRVELSHNS    G  GGR RGGG
Sbjct  28   LRNVWVARRPPGYAFIEFDDRRDALDAVQALDGKNGWRVELSHNSKGSGGRGGGRGRGGG  87

Query  565  DDSKCYECGEPGHFAREC  512
            DD KCYECGEPGHFAREC
Sbjct  88   DDLKCYECGEPGHFAREC  105



>ref|XP_008340014.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Malus domestica]
Length=182

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggG  566
            LR+VWVARRPPGYAFIEFDDRRDALDAV+ LDGKNGWRVELSHNS    G  GGR RGGG
Sbjct  28   LRNVWVARRPPGYAFIEFDDRRDALDAVQALDGKNGWRVELSHNSKGSGGRGGGRGRGGG  87

Query  565  DDSKCYECGEPGHFAREC  512
            DD KCYECGEPGHFAREC
Sbjct  88   DDLKCYECGEPGHFAREC  105



>ref|XP_010914080.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X2 [Elaeis guineensis]
Length=183

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_006438427.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006483824.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Citrus sinensis]
 gb|ESR51667.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
Length=176

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS   GGRGGR RGGG+
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGE  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DLKCYECGEPGHFAREC  104



>ref|XP_010251307.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nelumbo 
nucifera]
 ref|XP_010251308.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nelumbo 
nucifera]
Length=184

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrg  572
            LRSVWVAR+PPGYAF+EFDDRRDALDA+R LDGKNGWRVELSHNS       G GGR RG
Sbjct  28   LRSVWVARKPPGYAFVEFDDRRDALDAIRALDGKNGWRVELSHNSKGGGGGRGGGGRGRG  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG+D KCYECGEPGHFAREC
Sbjct  88   GGEDLKCYECGEPGHFAREC  107



>ref|XP_006438428.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006438429.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006483823.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Citrus sinensis]
 gb|ESR51668.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|ESR51669.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
Length=180

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS   GGRGGR RGGG+
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGRGRGGGE  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DLKCYECGEPGHFAREC  104



>ref|XP_008446226.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Cucumis 
melo]
 ref|XP_008446227.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Cucumis 
melo]
Length=187

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 66/84 (79%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---------ggrgg  584
            LRSVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS          G   G
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGGGGGRRGRGAG  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
               GGGDD KCYECGEPGHFAREC
Sbjct  88   GGGGGGDDLKCYECGEPGHFAREC  111



>ref|XP_004509838.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Cicer arietinum]
Length=181

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggG  566
            LRSVWVARRPPGYAFIEFDDRRDALDA+  LDGKNGWRVELSHNS    G  GGR   G 
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIHALDGKNGWRVELSHNSKDGGGRGGGRGGRGS  87

Query  565  DDSKCYECGEPGHFAREC  512
             D KCYECGEPGHFAREC
Sbjct  88   SDLKCYECGEPGHFAREC  105



>ref|XP_010914079.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X1 [Elaeis guineensis]
Length=197

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D 
Sbjct  42   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDM  101

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  102  KCYECGEPGHFAREC  116



>ref|XP_008779620.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Phoenix 
dactylifera]
Length=183

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_010929222.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Elaeis guineensis]
Length=183

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_004155352.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
Length=188

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 67/85 (79%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----------ggrg  587
            LRSVWVARRPPGYAFIEFDDRRDALDA++ LDGKNGWRVELSHNS            G G
Sbjct  28   LRSVWVARRPPGYAFIEFDDRRDALDAIQALDGKNGWRVELSHNSKGGGGGGGRRGRGGG  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            G   GGGDD KCYECGEPGHFAREC
Sbjct  88   GGGGGGGDDLKCYECGEPGHFAREC  112



>ref|XP_008794412.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Phoenix 
dactylifera]
Length=183

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRHGGSDM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>emb|CDP00182.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGYAF+EFDDRRDA DA+R LDGKNGWRVELSHNS   GG  G    GGD
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAEDAIRALDGKNGWRVELSHNSKGGGGGRGGRGRGGD  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DLKCYECGEPGHFAREC  104



>ref|XP_011013272.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X3 [Populus euphratica]
Length=153

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 66/79 (84%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            + SVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGG
Sbjct  1    MASVWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGG  60

Query  568  GDDSKCYECGEPGHFAREC  512
            G+DSKCYECGEPGHFAREC
Sbjct  61   GEDSKCYECGEPGHFAREC  79



>emb|CDY59084.1| BnaA09g54590D [Brassica napus]
Length=130

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            LR+VWVARRPPGYAF+EFDD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +D
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIED  87

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  88   SKCYECGEPGHFAREC  103



>ref|XP_010682582.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682583.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682584.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDD+RDALDA+  LDG+NGWRVELSHN+  GG  G    GG+D
Sbjct  28   LRSVWVARRPPGYAFIEFDDKRDALDAIHALDGRNGWRVELSHNAKGGGGRGGRGRGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   MKCYECGEPGHFAREC  103



>ref|XP_010929220.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010929221.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
Length=202

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELSHNSSGG  GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSSGGSRGRDRYGGSDM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  88   KCYECGEPGHFAREC  102



>ref|XP_006371254.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49051.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=193

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 64/76 (84%), Gaps = 4/76 (5%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDD  560
            VWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+D
Sbjct  9    VWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGED  68

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  69   SKCYECGEPGHFAREC  84



>ref|XP_002534324.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
 gb|EEF28060.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
Length=184

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 66/82 (80%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-------ggrggrs  578
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS        G  GG  
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAVDAIRALDGKNGWRVELSHNSKGGGGRGGGSGGGGR  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
              GG+D KCYECGEPGHFAREC
Sbjct  88   GRGGEDMKCYECGEPGHFAREC  109



>gb|KDP26562.1| hypothetical protein JCGZ_17720 [Jatropha curcas]
Length=184

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 67/83 (81%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--------ggrggr  581
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         GG GG 
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAMDAIRALDGKNGWRVELSHNSKGGGGRGGGGGGGGG  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
               GG+D KCYECGEPGHFAREC
Sbjct  88   RGRGGEDLKCYECGEPGHFAREC  110



>ref|XP_006371251.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49048.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=118

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 64/76 (84%), Gaps = 4/76 (5%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDD  560
            VWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+D
Sbjct  9    VWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGED  68

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  69   SKCYECGEPGHFAREC  84



>ref|XP_006416049.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 ref|XP_006416050.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 gb|ESQ34402.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 gb|ESQ34403.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
Length=187

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            LR+VWVARRPPGYAF+EFDD RDALDA+R LDGKNGWRVELSH +  G  G   RGG +D
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRALDGKNGWRVELSHKDKGGRGGVGRRGGIED  87

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  88   SKCYECGEPGHFAREC  103



>ref|XP_007044557.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 ref|XP_007044558.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 gb|EOY00389.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 gb|EOY00390.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
Length=177

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAF+EFDDRRDA+DA+R LDGK+GWRVELSHNS  GG  G  RGGG+D
Sbjct  28   LRSVWVARRPPGYAFVEFDDRRDAIDAIRELDGKSGWRVELSHNSKGGGGRGGRRGGGED  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>gb|KJB15225.1| hypothetical protein B456_002G165700 [Gossypium raimondii]
 gb|KJB15226.1| hypothetical protein B456_002G165700 [Gossypium raimondii]
Length=204

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-ggrggrsrggGDD  560
            LRSVWVARRPPGYAFIEFDDRRDA+DA+R LDGKNGWRVELSHNS   G  G  RGGG+D
Sbjct  55   LRSVWVARRPPGYAFIEFDDRRDAMDAIRELDGKNGWRVELSHNSKGVGGRGGRRGGGED  114

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHF REC
Sbjct  115  LKCYECGEPGHFVREC  130



>emb|CDY47646.1| BnaC05g19020D [Brassica napus]
Length=185

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            LR+VWVARRPPGYAF+EFDD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +D
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIED  87

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  88   SKCYECGEPGHFAREC  103



>ref|XP_009115492.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Brassica rapa]
Length=186

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            LR+VWVARRPPGYAF+EFDD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +D
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIED  87

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  88   SKCYECGEPGHFAREC  103



>ref|XP_009115493.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Brassica rapa]
Length=185

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            LR+VWVARRPPGYAF+EFDD RDALDA+R LDGKNGWRVELSH +  G  GG  RGG +D
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRALDGKNGWRVELSHKDKGGRGGGGRRGGIED  87

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  88   SKCYECGEPGHFAREC  103



>ref|XP_008389624.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Malus domestica]
Length=182

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 70/79 (89%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LR+VWVARRPPGYAFIEFDDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR RGG
Sbjct  28   LRNVWVARRPPGYAFIEFDDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+D KCYECGEPGHFAREC
Sbjct  88   GEDLKCYECGEPGHFAREC  106



>ref|XP_009363527.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Pyrus x bretschneideri]
Length=182

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LR+VWVARRPPGYAFIEFDDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR  GG
Sbjct  28   LRNVWVARRPPGYAFIEFDDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGHGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+D KCYECGEPGHFAREC
Sbjct  88   GEDLKCYECGEPGHFAREC  106



>ref|XP_008389623.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Malus domestica]
Length=183

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 70/79 (89%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LR+VWVARRPPGYAFIEFDDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR RGG
Sbjct  28   LRNVWVARRPPGYAFIEFDDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+D KCYECGEPGHFAREC
Sbjct  88   GEDLKCYECGEPGHFAREC  106



>ref|XP_011463379.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=186

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LRSVWVARRPPGYAFIEFDD RDALDA++ LDGKNGWRVELSHNS     GG G   RGG
Sbjct  28   LRSVWVARRPPGYAFIEFDDHRDALDAIQRLDGKNGWRVELSHNSKGGGGGGGGRGGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            GDD KCYECGEPGHFAREC
Sbjct  88   GDDLKCYECGEPGHFAREC  106



>ref|XP_009363525.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009363526.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Pyrus x bretschneideri]
Length=183

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LR+VWVARRPPGYAFIEFDDRRDALDAV+ L+GKNGWRVELSHNS+     G GGR  GG
Sbjct  28   LRNVWVARRPPGYAFIEFDDRRDALDAVQALNGKNGWRVELSHNSTGSGGRGGGGRGHGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G+D KCYECGEPGHFAREC
Sbjct  88   GEDLKCYECGEPGHFAREC  106



>ref|XP_004297645.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=187

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrgg  569
            LRSVWVARRPPGYAFIEFDD RDALDA++ LDGKNGWRVELSHNS     GG G   RGG
Sbjct  28   LRSVWVARRPPGYAFIEFDDHRDALDAIQRLDGKNGWRVELSHNSKGGGGGGGGRGGRGG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            GDD KCYECGEPGHFAREC
Sbjct  88   GDDLKCYECGEPGHFAREC  106



>gb|AFK40774.1| unknown [Lotus japonicus]
Length=181

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggG  566
            LRSVWVARRPPGYAF+EFDD+RDALDA+  LDGKNGWRVELSHNS    GGRGG    GG
Sbjct  28   LRSVWVARRPPGYAFLEFDDKRDALDAIHALDGKNGWRVELSHNSKGGGGGRGGGRGRGG  87

Query  565  DDSKCYECGEPGHFAREC  512
            +D KCYECGEPGHFAREC
Sbjct  88   EDLKCYECGEPGHFAREC  105



>ref|XP_006371252.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49049.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=154

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 64/76 (84%), Gaps = 4/76 (5%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDD  560
            VWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+D
Sbjct  9    VWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGED  68

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  69   SKCYECGEPGHFAREC  84



>ref|XP_006371253.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
 gb|ERP49050.1| hypothetical protein POPTR_0019s07730g [Populus trichocarpa]
Length=158

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 64/76 (84%), Gaps = 4/76 (5%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss----ggrggrsrggGDD  560
            VWVARRPPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHNS         G  RGGG+D
Sbjct  9    VWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGED  68

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGEPGHFAREC
Sbjct  69   SKCYECGEPGHFAREC  84



>ref|XP_008221783.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Prunus mume]
Length=183

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrg  572
            LR VWVARRPPGYAFIEFDDRRDALDA++ +DGKNGWRVELSHNS      GG GGR RG
Sbjct  28   LRGVWVARRPPGYAFIEFDDRRDALDAIQAVDGKNGWRVELSHNSKGGGGRGGGGGRGRG  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG+D KCYECGEPGHFAREC
Sbjct  88   GGEDLKCYECGEPGHFAREC  107



>ref|XP_008221782.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Prunus mume]
Length=184

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrg  572
            LR VWVARRPPGYAFIEFDDRRDALDA++ +DGKNGWRVELSHNS      GG GGR RG
Sbjct  28   LRGVWVARRPPGYAFIEFDDRRDALDAIQAVDGKNGWRVELSHNSKGGGGRGGGGGRGRG  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG+D KCYECGEPGHFAREC
Sbjct  88   GGEDLKCYECGEPGHFAREC  107



>ref|XP_003544651.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Glycine max]
 gb|KHN14571.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=178

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDD  560
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_006596163.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Glycine max]
Length=175

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDD  560
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_006596162.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Glycine max]
Length=177

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDD  560
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_006600176.1| PREDICTED: uncharacterized protein LOC100790689 isoform X1 [Glycine 
max]
Length=175

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDD  560
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|NP_001241113.1| uncharacterized protein LOC100790689 [Glycine max]
 gb|ACU13222.1| unknown [Glycine max]
 gb|ACU18210.1| unknown [Glycine max]
 gb|KHN30783.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=178

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDD  560
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN   GG G   R GG D
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_006655864.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Oryza 
brachyantha]
Length=185

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA D++R LDGKNGWRVELS N+S GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDSIRDLDGKNGWRVELSRNASSGRGGRDRYGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_006845500.1| hypothetical protein AMTR_s00019p00154210 [Amborella trichopoda]
 gb|ERN07175.1| hypothetical protein AMTR_s00019p00154210 [Amborella trichopoda]
Length=262

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            LRSVWVAR+PPGYAF+EFDDRRDA+DA+R LDGKNGWRVELSHN         GG G   
Sbjct  87   LRSVWVARKPPGYAFVEFDDRRDAIDAIRELDGKNGWRVELSHNSRGGGGGRGGGGGRSR  146

Query  577  rggGDDSKCYECGEPGHFAREC  512
             G G D KCYECGEPGHFAREC
Sbjct  147  SGSGSDMKCYECGEPGHFAREC  168



>ref|XP_007161329.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
 gb|ESW33323.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
Length=176

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN--ssggrggrsrggGD  563
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN    GG  G   GGG 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGGS  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DLKCYECGEPGHFAREC  104



>ref|XP_007223543.1| hypothetical protein PRUPE_ppa012111mg [Prunus persica]
 gb|EMJ24742.1| hypothetical protein PRUPE_ppa012111mg [Prunus persica]
Length=183

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-----ggrggrsrg  572
            LR VWVARRPPGYAFIEFDDRRDALDA++ +DGKNGWRVELSHNS      GG GGR RG
Sbjct  28   LRGVWVARRPPGYAFIEFDDRRDALDAIQAVDGKNGWRVELSHNSKGGGGRGGGGGRGRG  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG+D +CYECGEPGHFAREC
Sbjct  88   GGEDLRCYECGEPGHFAREC  107



>ref|XP_007161330.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
 gb|ESW33324.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
Length=179

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN--ssggrggrsrggGD  563
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN    GG  G   GGG 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGRSGGGS  87

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  88   DLKCYECGEPGHFAREC  104



>ref|XP_002264105.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Vitis vinifera]
 emb|CBI32129.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 68/83 (82%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--------ggrggr  581
            +RSVWVARRPPGYAF+EF DRRDA+DA+RGLDGK+GWRVELSHNS         GG   R
Sbjct  28   IRSVWVARRPPGYAFVEFADRRDAVDAIRGLDGKSGWRVELSHNSKGGGGGGGGGGGRDR  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
             RGGG+D KCYECGEPGHFAREC
Sbjct  88   GRGGGEDLKCYECGEPGHFAREC  110



>ref|XP_010653311.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Vitis vinifera]
Length=179

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 68/83 (82%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--------ggrggr  581
            +RSVWVARRPPGYAF+EF DRRDA+DA+RGLDGK+GWRVELSHNS         GG   R
Sbjct  28   IRSVWVARRPPGYAFVEFADRRDAVDAIRGLDGKSGWRVELSHNSKGGGGGGGGGGGRDR  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
             RGGG+D KCYECGEPGHFAREC
Sbjct  88   GRGGGEDLKCYECGEPGHFAREC  110



>ref|NP_001057018.1| Os06g0187900 [Oryza sativa Japonica Group]
 sp|Q69KL9.1|RZ21A_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ21A; AltName: 
Full=RS-containing zinc finger protein 21A; Short=Os-RSZ21a; 
Short=Os-RSZp21a [Oryza sativa Japonica Group]
 dbj|BAD36521.1| putative splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAD72462.1| putative splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAF18932.1| Os06g0187900 [Oryza sativa Japonica Group]
 dbj|BAG88899.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92681.1| unnamed protein product [Oryza sativa Japonica Group]
Length=185

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R +DGKNGWRVELS N+S GRGGR R G  +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRYGSSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_002436620.1| hypothetical protein SORBIDRAFT_10g005960 [Sorghum bicolor]
 gb|EER87987.1| hypothetical protein SORBIDRAFT_10g005960 [Sorghum bicolor]
 gb|AGE46105.1| arginine/serine-rich splicing factor RSZ21 transcript I [Sorghum 
bicolor]
 gb|AGE46107.1| arginine/serine-rich splicing factor RSZ21 transcript III [Sorghum 
bicolor]
Length=186

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N+S GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVELSRNASSGRGGRDRYGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>gb|AFW85524.1| hypothetical protein ZEAMMB73_327204 [Zea mays]
Length=138

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N+SGGRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVELSRNASGGRGGRDRHGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_011077592.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Sesamum indicum]
Length=177

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN      GGRGG     
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_011082043.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Sesamum 
indicum]
Length=181

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN      GGRGG     
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_011077513.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Sesamum indicum]
Length=180

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN      GGRGG     
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_009415507.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=182

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGK+GWRVELSHNSS  RG    GG  D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDGKHGWRVELSHNSSSSRGRDRHGGS-DM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>gb|ACG35084.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=184

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N+SGGRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVELSRNASGGRGGRDRHGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|NP_001149338.1| LOC100282961 [Zea mays]
 ref|XP_008658629.1| PREDICTED: LOC100282961 isoform X1 [Zea mays]
 ref|XP_008658630.1| PREDICTED: LOC100282961 isoform X1 [Zea mays]
 gb|ACG25623.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACG27710.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACN25174.1| unknown [Zea mays]
 gb|ACN27371.1| unknown [Zea mays]
 gb|AFW85525.1| Splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW85526.1| Splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AFW85527.1| Splicing factor, arginine/serine-rich 7 isoform 3 [Zea mays]
 gb|AFW85528.1| Splicing factor, arginine/serine-rich 7 isoform 4 [Zea mays]
 gb|AGE46036.1| arginine/serine-rich splicing factor RSZ21 transcript I [Zea 
mays]
 gb|AGE46037.1| arginine/serine-rich splicing factor RSZ21 transcript II [Zea 
mays]
Length=184

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N+SGGRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVELSRNASGGRGGRDRHGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_009395828.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395829.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395830.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395831.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=180

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGK+GWRVELSHN S    GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDGKHGWRVELSHN-SSSSRGRDRHGGSDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_010942196.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Elaeis guineensis]
Length=247

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_003603553.1| Splicing factor arginine/serine-rich [Medicago truncatula]
Length=199

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 67/88 (76%), Gaps = 13/88 (15%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssg-------------  596
            +RSVWVARRPPGYAFI+FDDRRDALDA+R LDGKNGWRVELSHNS               
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDALDAIRELDGKNGWRVELSHNSKTGGGGGGRGGGGGG  87

Query  595  grggrsrggGDDSKCYECGEPGHFAREC  512
            G  GRS GGG D KCYECGEPGHFAREC
Sbjct  88   GGRGRSGGGGSDLKCYECGEPGHFAREC  115



>ref|XP_010942204.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X10 [Elaeis guineensis]
Length=208

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_004964637.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Setaria italica]
Length=186

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVE+S NSS GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVEISRNSSSGRGGRDRQGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_010942202.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X8 [Elaeis guineensis]
Length=235

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_004964636.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Setaria italica]
Length=193

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVE+S NSS GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVEISRNSSSGRGGRDRQGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_010942203.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X9 [Elaeis guineensis]
Length=211

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_002272657.2| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Vitis vinifera]
 ref|XP_010648841.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Vitis vinifera]
 emb|CBI24003.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_010648839.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Vitis vinifera]
 ref|XP_010648840.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Vitis vinifera]
Length=182

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_009386654.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LRSVWVARRPPGY F+EFDDRRDALDA+R LDGK+GWRVELSHNS   GG  G    GG 
Sbjct  28   LRSVWVARRPPGYGFVEFDDRRDALDAIRDLDGKHGWRVELSHNSKGGGGGRGGYGRGGG  87

Query  562  DSKCYECGEPGHFAREC  512
            D  CYECGEPGHFAREC
Sbjct  88   DMNCYECGEPGHFAREC  104



>ref|XP_010942211.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X16 [Elaeis guineensis]
Length=196

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942200.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X6 [Elaeis guineensis]
Length=239

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942208.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X14 [Elaeis guineensis]
Length=200

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942194.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
Length=250

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942201.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X7 [Elaeis guineensis]
Length=238

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942207.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X13 [Elaeis guineensis]
Length=202

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>emb|CDP12463.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_004964635.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Setaria italica]
Length=209

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVE+S NSS GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDGKNGWRVEISRNSSSGRGGRDRQGGSES  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGETGHFAREC  102



>ref|XP_010942199.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X5 [Elaeis guineensis]
Length=241

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942209.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X15 [Elaeis guineensis]
Length=199

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942205.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X11 [Elaeis guineensis]
Length=206

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>gb|KJB53760.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=131

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggG  566
            +RSVWVARRPPGYAFI+F+DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG
Sbjct  28   IRSVWVARRPPGYAFIDFEDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGG  87

Query  565  DDSKCYECGEPGHFAREC  512
             D KCYECGEPGHFAREC
Sbjct  88   SDLKCYECGEPGHFAREC  105



>ref|XP_010942198.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X4 [Elaeis guineensis]
Length=242

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942197.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Elaeis guineensis]
Length=245

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>ref|XP_010942206.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X12 [Elaeis guineensis]
Length=203

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD-D  560
            LRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG++GWRVELS+NS+GG G R   G D D
Sbjct  28   LRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDGRHGWRVELSYNSAGGGGSRGGRGRDQD  87

Query  559  SKCYECGEPGHFAREC  512
             KCY+CG+PGHFAREC
Sbjct  88   MKCYQCGKPGHFAREC  103



>gb|EEC80152.1| hypothetical protein OsI_21961 [Oryza sativa Indica Group]
Length=264

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R +DGKNGWRVELS N+S GRGGR R G  +S
Sbjct  107  LRSVWVARKPPGFAFIDFDDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRYGSSES  166

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  167  KCYECGETGHFAREC  181



>gb|EEE65232.1| hypothetical protein OsJ_20394 [Oryza sativa Japonica Group]
Length=264

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R +DGKNGWRVELS N+S GRGGR R G  +S
Sbjct  107  LRSVWVARKPPGFAFIDFDDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRYGSSES  166

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  167  KCYECGETGHFAREC  181



>gb|KJB53756.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53758.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53761.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53762.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=180

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggG  566
            +RSVWVARRPPGYAFI+F+DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG
Sbjct  28   IRSVWVARRPPGYAFIDFEDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGG  87

Query  565  DDSKCYECGEPGHFAREC  512
             D KCYECGEPGHFAREC
Sbjct  88   SDLKCYECGEPGHFAREC  105



>gb|EMS45589.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=191

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AF++FDDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGESGHFAREC  102



>gb|KJB53759.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=177

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggG  566
            +RSVWVARRPPGYAFI+F+DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG
Sbjct  28   IRSVWVARRPPGYAFIDFEDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGG  87

Query  565  DDSKCYECGEPGHFAREC  512
             D KCYECGEPGHFAREC
Sbjct  88   SDLKCYECGEPGHFAREC  105



>ref|XP_010278048.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
 ref|XP_010278049.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
 ref|XP_010278050.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
Length=182

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHNS G  GGR    G   
Sbjct  28   LRSVWVARKPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRGRGGGRGGDRGRSG  87

Query  556  ----KCYECGEPGHFAREC  512
                KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>gb|KDO67328.1| hypothetical protein CISIN_1g046599mg [Citrus sinensis]
Length=131

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN      G  GGR R G
Sbjct  28   IRSVWVARRPPGYAFIDFDDYRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>gb|KJB53763.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=169

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---ssggrggrsrggG  566
            +RSVWVARRPPGYAFI+F+DRRDA DA+R LDGKNGWRVELSHN     G  GG+   GG
Sbjct  28   IRSVWVARRPPGYAFIDFEDRRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGQGCSGG  87

Query  565  DDSKCYECGEPGHFAREC  512
             D KCYECGEPGHFAREC
Sbjct  88   SDLKCYECGEPGHFAREC  105



>ref|XP_009765884.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Nicotiana 
sylvestris]
Length=229

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 65/79 (82%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD+RDA DA+R LDGKNGWRVELSHN      G  GGR R G
Sbjct  77   IRSVWVARRPPGYAFIDFDDKRDAQDAIRELDGKNGWRVELSHNSREGRGGRGGGRGRSG  136

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  137  GSDLKCYECGEPGHFAREC  155



>emb|CAN74578.1| hypothetical protein VITISV_009111 [Vitis vinifera]
Length=318

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 67/83 (81%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--------ggrggr  581
            L SVWVARRPPGYAF+EF DRRDA+DA+RGLDGK+GWRVELSHNS         GG   R
Sbjct  143  LASVWVARRPPGYAFVEFADRRDAVDAIRGLDGKSGWRVELSHNSKGGGGGGGGGGGRDR  202

Query  580  srggGDDSKCYECGEPGHFAREC  512
             RGGG+D KCYECGEPGHFAREC
Sbjct  203  GRGGGEDLKCYECGEPGHFAREC  225



>ref|XP_004498562.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cicer 
arietinum]
Length=188

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 63/85 (74%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN            G   
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGKNGWRVELSHNSRSGGGGGGGGGGRGR  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            G   GGG D KCYECGEPGHFAREC
Sbjct  88   GGGGGGGSDLKCYECGEPGHFAREC  112



>ref|XP_003564174.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Brachypodium 
distachyon]
Length=185

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R +DGKNGWRVELS N+S GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRDIDGKNGWRVELSRNASSGRGGRDRSGGSEM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGESGHFAREC  102



>gb|EMT27182.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=187

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AF++FDDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGESGHFAREC  102



>gb|KDP33463.1| hypothetical protein JCGZ_07034 [Jatropha curcas]
Length=179

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNs---sggrggrsrggG  566
            +RSVWVARRPPGYAFI+FDD+RDA DA+  LDGKNGWRVELSHNS    G  GGR R GG
Sbjct  28   IRSVWVARRPPGYAFIDFDDKRDAEDAIHELDGKNGWRVELSHNSRGGGGRGGGRGRFGG  87

Query  565  DDSKCYECGEPGHFAREC  512
             D KCYECGEPGHFAREC
Sbjct  88   SDLKCYECGEPGHFAREC  105



>gb|ACX54788.2| putative arginine/serine-rich splicing factor [Arachis diogoi]
 gb|AET50931.1| SR-protein [Arachis diogoi]
 gb|AFW97328.1| SR protein [Arachis diogoi]
Length=181

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN      G  GGR R G
Sbjct  28   IRSVWVARRPPGYAFIDFDDSRDARDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_003588649.1| RNA-binding protein Rsf1 [Medicago truncatula]
Length=190

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 63/85 (74%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN            G   
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRDLDGKNGWRVELSHNSRSGGGGGGGGGGRGR  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            G   GGG D KCYECGEPGHFAREC
Sbjct  88   GGGGGGGSDLKCYECGEPGHFAREC  112



>ref|XP_006450201.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006450202.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006450203.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006483489.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Citrus sinensis]
 gb|ESR63441.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 gb|ESR63442.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 gb|ESR63443.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
Length=180

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 64/79 (81%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN      G  GGR R G
Sbjct  28   IRSVWVARRPPGYAFIDFDDYRDAQDAIRELDGKNGWRVELSHNSRGGGGGRGGGRGRSG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>gb|AAY84872.1| pre-mRNA processing factor [Triticum aestivum]
Length=167

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AF++FDDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGESGHFAREC  102



>ref|XP_006647490.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Oryza brachyantha]
Length=206

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS   +G   GR R  G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDGKNGWRVELS-TKAGSGRGRDRSSGSDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_002454683.1| hypothetical protein SORBIDRAFT_04g035540 [Sorghum bicolor]
 gb|EES07659.1| hypothetical protein SORBIDRAFT_04g035540 [Sorghum bicolor]
 gb|AGE46110.1| arginine/serine-rich splicing factor RSZ19 transcript II [Sorghum 
bicolor]
Length=163

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSES  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>ref|XP_006647491.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Oryza brachyantha]
Length=203

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS   +G   GR R  G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDGKNGWRVELS-TKAGSGRGRDRSSGSDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_006305671.1| hypothetical protein CARUB_v10010388mg [Capsella rubella]
 gb|EOA38569.1| hypothetical protein CARUB_v10010388mg [Capsella rubella]
Length=186

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            LR+VWVARRPPGYAF+EFDD RDALDA+R LD KNGWRVELSH +  G   G  RGG +D
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRTLDRKNGWRVELSHKDKGGRGAGGRRGGIED  87

Query  559  SKCYECGEPGHFAREC  512
            SKCYECGE GHFAREC
Sbjct  88   SKCYECGELGHFAREC  103



>ref|XP_004954180.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Setaria italica]
Length=169

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSES  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>dbj|BAJ94659.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AF++FDDRRDA DA++ LDGKNGWRVELS N+S GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDGKNGWRVELSRNASSGRGGRDRSGGSEM  87

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  88   KCYECGESGHFAREC  102



>ref|XP_009363631.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Pyrus 
x bretschneideri]
 ref|XP_009367985.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Pyrus 
x bretschneideri]
Length=186

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAF++FDD RDA DA+RGLDGKN WRVELSHN        G GGR R 
Sbjct  28   IRSVWVARRPPGYAFVDFDDIRDAEDAIRGLDGKNNWRVELSHNSRGGGGGRGGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_006357055.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Solanum tuberosum]
Length=183

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRDLDGKNGWRVELSHNSRGERGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGESGHFAREC  107



>ref|XP_002893311.1| hypothetical protein ARALYDRAFT_472646 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69570.1| hypothetical protein ARALYDRAFT_472646 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDALDA+R LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAIRALDRKNGWRVELSHKDKGGRGGGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|XP_009396254.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=222

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 63/84 (75%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssg---------grgg  584
            LRSVWVARRPPGY F+EFDDRRDALDA+R +DGK+GWRVELSHNS             GG
Sbjct  28   LRSVWVARRPPGYGFVEFDDRRDALDAIRDIDGKHGWRVELSHNSKAGGGGRGGRGRGGG  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
               GGG D  CYECGEPGHFAREC
Sbjct  88   GGGGGGGDMNCYECGEPGHFAREC  111



>gb|AGE46109.1| arginine/serine-rich splicing factor RSZ19 transcript I [Sorghum 
bicolor]
Length=163

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSES  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>ref|XP_009396262.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 63/84 (75%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssg---------grgg  584
            LRSVWVARRPPGY F+EFDDRRDALDA+R +DGK+GWRVELSHNS             GG
Sbjct  28   LRSVWVARRPPGYGFVEFDDRRDALDAIRDIDGKHGWRVELSHNSKAGGGGRGGRGRGGG  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
               GGG D  CYECGEPGHFAREC
Sbjct  88   GGGGGGGDMNCYECGEPGHFAREC  111



>ref|XP_004244489.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Solanum 
lycopersicum]
Length=183

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRDLDGKNGWRVELSHNSRGERGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGESGHFAREC  107



>ref|NP_001132794.1| hypothetical protein [Zea mays]
 ref|XP_008681240.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81790.1| unknown [Zea mays]
 gb|ACN36863.1| unknown [Zea mays]
 gb|AFW73822.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AFW73823.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AFW73824.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AGE46038.1| arginine/serine-rich splicing factor RSZ20 transcript I [Zea 
mays]
 gb|AGE46039.1| arginine/serine-rich splicing factor RSZ20 transcript II [Zea 
mays]
 gb|AGE46040.1| arginine/serine-rich splicing factor RSZ20 transcript III [Zea 
mays]
 gb|AGE46041.1| arginine/serine-rich splicing factor RSZ20 transcript IV [Zea 
mays]
Length=173

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVW+AR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS N S GRGGR R GG +S
Sbjct  28   LRSVWIARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWRVELSRN-SSGRGGRDRYGGSES  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>gb|EPS72339.1| hypothetical protein M569_02421, partial [Genlisea aurea]
Length=181

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSH-NssggrggrsrggGDD  560
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LDG+ GWRVELSH  S  G G      G D
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGRRGWRVELSHGGSGRGGGRGGGRSGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGEPGHFAREC
Sbjct  88   LKCYECGEPGHFAREC  103



>ref|XP_011459026.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=177

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 64/81 (79%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +RSVWVARRPPGYAF++FDD RDA DA+R LDGKNGWRVELSHN         G GGR R
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIRELDGKNGWRVELSHNSRGGGGGGRGGGGRGR  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   SGGSDLKCYECGEPGHFAREC  108



>ref|XP_010268362.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Nelumbo 
nucifera]
 ref|XP_010268363.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Nelumbo 
nucifera]
Length=289

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 62/80 (78%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGD--  563
            LRSVWVAR+PPGYAFI+F+DRRDA DA+  LDGKNGWRVELSHNS G  GG   G     
Sbjct  28   LRSVWVARKPPGYAFIDFEDRRDAQDAIHELDGKNGWRVELSHNSRGRGGGGRGGDRGRS  87

Query  562  ---DSKCYECGEPGHFAREC  512
               D KCYECGEPGHFAREC
Sbjct  88   GGYDMKCYECGEPGHFAREC  107



>gb|EEE57352.1| hypothetical protein OsJ_07486 [Oryza sativa Japonica Group]
Length=203

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS   +G   GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWRVELS-TKAGSGRGRDRSGGSDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|NP_001047400.1| Os02g0610600 [Oryza sativa Japonica Group]
 sp|Q6K9C3.1|RZP23_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ23; AltName: 
Full=RS-containing zinc finger protein 23; Short=Os-RSZ23; 
Short=Os-RSZp23 [Oryza sativa Japonica Group]
 dbj|BAD19227.1| putative splicing factor RSZp22 (RSZP22) [Oryza sativa Japonica 
Group]
 dbj|BAF09314.1| Os02g0610600 [Oryza sativa Japonica Group]
 dbj|BAG94201.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96908.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS   +G   GR R GG D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWRVELS-TKAGSGRGRDRSGGSDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_004291288.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=187

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 64/81 (79%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +RSVWVARRPPGYAF++FDD RDA DA+R LDGKNGWRVELSHN         G GGR R
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIRELDGKNGWRVELSHNSRGGGGGGRGGGGRGR  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   SGGSDLKCYECGEPGHFAREC  108



>ref|XP_007225929.1| hypothetical protein PRUPE_ppa012147mg [Prunus persica]
 ref|XP_008219954.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Prunus 
mume]
 gb|EMJ27128.1| hypothetical protein PRUPE_ppa012147mg [Prunus persica]
Length=182

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAF++FDD RDA DA+R +DGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIREIDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_009614737.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Nicotiana tomentosiformis]
Length=181

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGK GWRVELSHN      G  GGR R G
Sbjct  28   IRSVWVARRPPGYAFIDFDDLRDAQDAIRELDGKTGWRVELSHNSREGRGGRGGGRGRSG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_009614738.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Nicotiana tomentosiformis]
Length=180

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGK GWRVELSHN      G  GGR R G
Sbjct  28   IRSVWVARRPPGYAFIDFDDLRDAQDAIRELDGKTGWRVELSHNSREGRGGRGGGRGRSG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_009614739.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Nicotiana tomentosiformis]
Length=179

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 63/79 (80%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGK GWRVELSHN      G  GGR R G
Sbjct  28   IRSVWVARRPPGYAFIDFDDLRDAQDAIRELDGKTGWRVELSHNSREGRGGRGGGRGRSG  87

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGEPGHFAREC
Sbjct  88   GSDLKCYECGEPGHFAREC  106



>ref|XP_010325195.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Solanum lycopersicum]
 ref|XP_010325196.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Solanum lycopersicum]
Length=184

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA++ LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGESGHFAREC  107



>ref|XP_010692998.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Beta 
vulgaris subsp. vulgaris]
Length=192

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 63/83 (76%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNs--------sggrggr  581
            +RSVWVARRPPGYAFI+FDD RDA DA+  LDGKNGWRVELSHNS         GG GG 
Sbjct  28   IRSVWVARRPPGYAFIDFDDTRDAKDAIHALDGKNGWRVELSHNSRGGGGGRGGGGGGGG  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
               GG D KCYECGEPGHFAREC
Sbjct  88   RGRGGSDLKCYECGEPGHFAREC  110



>ref|XP_004245307.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Solanum lycopersicum]
 ref|XP_010325197.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Solanum lycopersicum]
Length=183

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDDRRDA DA++ LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGESGHFAREC  107



>ref|XP_007011623.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 ref|XP_007011624.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 gb|EOY29242.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 gb|EOY29243.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
Length=181

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 65/80 (81%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD RDA DA+R +DGKNGWRVELSHN       GG GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDHRDAEDAIREVDGKNGWRVELSHNSRGRGGRGGGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_011031384.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Populus 
euphratica]
Length=188

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 64/83 (77%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggr  581
            +RSVWVARRPPGYAFI+FDD+RDA DA+  LDGKNGWRVELSHN          G  GGR
Sbjct  28   IRSVWVARRPPGYAFIDFDDKRDAQDAIHELDGKNGWRVELSHNSRGGGGGGGGGRGGGR  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
             R GG D KCYECGEPGHFAREC
Sbjct  88   GRSGGSDLKCYECGEPGHFAREC  110



>ref|XP_006382133.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 ref|XP_006382134.1| hypothetical protein POPTR_0006s28720g [Populus trichocarpa]
 gb|ERP59930.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 gb|ERP59931.1| hypothetical protein POPTR_0006s28720g [Populus trichocarpa]
Length=187

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 64/83 (77%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggr  581
            +RSVWVARRPPGYAFI+FDD+RDA DA+  LDGKNGWRVELSHN          G  GGR
Sbjct  28   IRSVWVARRPPGYAFIDFDDKRDAQDAIHELDGKNGWRVELSHNSRGGGGGGGGGRGGGR  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
             R GG D KCYECGEPGHFAREC
Sbjct  88   GRSGGSDLKCYECGEPGHFAREC  110



>ref|NP_001117342.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 gb|AEE30442.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=164

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDALDA+  LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>gb|KJB68433.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
Length=185

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 65/85 (76%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN            GG G
Sbjct  28   IRSVWVARRPPGYAFIDFDDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGGG  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            GR R GG D KCYECGEPGHFAREC
Sbjct  88   GRGRSGGSDLKCYECGEPGHFAREC  112



>gb|ABK24519.1| unknown [Picea sitchensis]
Length=169

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFIEF+DRRDA DAVR L+GKN WRVELS NS GG  G    GGDD 
Sbjct  28   LRSVWVARKPPGFAFIEFEDRRDAGDAVRALNGKNDWRVELSRNSGGGGRGGRGRGGDDM  87

Query  556  KCYECGEPGHFAREC  512
             CY+CGE GHFAREC
Sbjct  88   SCYKCGESGHFAREC  102



>ref|XP_010112118.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXC32743.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=187

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 64/85 (75%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN            G  G
Sbjct  28   IRSVWVARRPPGYAFIDFDDARDAEDAIRELDGKNGWRVELSHNSRGGGGGGGGGGGRGG  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            GR R GG D KCYECGEPGHFAREC
Sbjct  88   GRGRSGGSDLKCYECGEPGHFAREC  112



>gb|KHG09265.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
 gb|KHG19345.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=187

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 65/86 (76%), Gaps = 11/86 (13%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----------ssggr  590
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN             GG 
Sbjct  28   IRSVWVARRPPGYAFIDFDDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGGG  87

Query  589  ggrsrggGDDSKCYECGEPGHFAREC  512
            GGR R GG D KCYECGEPGHFAREC
Sbjct  88   GGRGRSGGSDLKCYECGEPGHFAREC  113



>ref|XP_006355194.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006355195.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006355196.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Solanum tuberosum]
Length=184

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD+RDA DA++ LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDQRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGESGHFAREC  107



>ref|NP_001140388.1| uncharacterized protein LOC100272442 [Zea mays]
 gb|ACF83722.1| unknown [Zea mays]
 gb|AFW72279.1| hypothetical protein ZEAMMB73_339392 [Zea mays]
 gb|AGC79941.1| arginine/serine-rich splicing factor RSZ28IV [Zea mays]
Length=141

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEAGHFAREC  100



>gb|KJB68434.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
 gb|KJB68435.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
Length=240

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 65/85 (76%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN            GG G
Sbjct  82   IRSVWVARRPPGYAFIDFDDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGGG  141

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            GR R GG D KCYECGEPGHFAREC
Sbjct  142  GRGRSGGSDLKCYECGEPGHFAREC  166



>emb|CAA05351.1| RSZp21 protein [Arabidopsis thaliana]
Length=184

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDALDA+  LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|NP_564208.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 ref|NP_973901.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 sp|O81127.1|RSZ21_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ21; AltName: 
Full=RS-containing zinc finger protein 21; Short=At-RSZ21; 
Short=At-RSZp21; Short=AtRSZ21 [Arabidopsis thaliana]
 gb|AAD12770.1| SRZ21 [Arabidopsis thaliana]
 dbj|BAH20240.1| AT1G23860 [Arabidopsis thaliana]
 gb|AEE30440.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
 gb|AEE30441.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=187

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDALDA+  LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|NP_001185074.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 gb|AEE30443.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=183

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDALDA+  LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|XP_006355197.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X4 [Solanum tuberosum]
Length=183

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD+RDA DA++ LDGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDQRDAQDAIKELDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGESGHFAREC  107



>gb|AAF87159.1|AC002423_24 T23E23.2 [Arabidopsis thaliana]
Length=183

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDALDA+  LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|XP_009630985.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Nicotiana tomentosiformis]
Length=196

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD+RDA DA+R +DGKNGWRVELSHN       G  GGR R 
Sbjct  43   IRSVWVARRPPGYAFIDFDDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGRGGGRGRS  102

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  103  GGSDLKCYECGEAGHFAREC  122



>ref|XP_010498892.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Camelina sativa]
 ref|XP_010498893.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Camelina sativa]
Length=187

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDA DA+R LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|XP_010498894.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Camelina sativa]
Length=186

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDA DA+R LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCYECGE GHFAREC
Sbjct  88   DSKCYECGELGHFAREC  104



>ref|XP_009630986.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Nicotiana tomentosiformis]
Length=181

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 64/80 (80%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD+RDA DA+R +DGKNGWRVELSHN       G  GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGRGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGE GHFAREC
Sbjct  88   GGSDLKCYECGEAGHFAREC  107



>ref|XP_008466294.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Cucumis 
melo]
 ref|XP_008466295.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Cucumis 
melo]
Length=186

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD RDA DA+  LDGKNGWRVELSHN        G GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDPRDARDAIHELDGKNGWRVELSHNSRGGGGGRGGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_004136307.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
 ref|XP_004164814.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
 gb|KGN60178.1| hypothetical protein Csa_3G881900 [Cucumis sativus]
Length=192

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 63/80 (79%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            +RSVWVARRPPGYAFI+FDD RDA DA+  LDGKNGWRVELSHN        G GGR R 
Sbjct  28   IRSVWVARRPPGYAFIDFDDPRDARDAIHELDGKNGWRVELSHNSRGGGGGRGGGGRGRS  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>ref|XP_009353338.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Pyrus x bretschneideri]
Length=187

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 63/81 (78%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +RSVWVARRPPGYAF++FDD RDA DA+R +DGKN WRVELSHN         G GGR R
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIREIDGKNNWRVELSHNSRGGGGGGRGGGGRGR  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   SGGSDLKCYECGEPGHFAREC  108



>ref|XP_009353337.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Pyrus x bretschneideri]
Length=188

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 63/81 (78%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +RSVWVARRPPGYAF++FDD RDA DA+R +DGKN WRVELSHN         G GGR R
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIREIDGKNNWRVELSHNSRGGGGGGRGGGGRGR  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   SGGSDLKCYECGEPGHFAREC  108



>gb|AGE46162.1| arginine/serine-rich splicing factor RSZ23 transcript II [Physcomitrella 
patens]
Length=137

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWV R+PPG+AFIEF+DRRDA DA+R L+GKNGWRVELS + SGG GG    GGDD 
Sbjct  28   LRSVWVGRKPPGFAFIEFEDRRDADDAIRALNGKNGWRVELSRS-SGGGGGPRGRGGDDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_010526263.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Tarenaya 
hassleriana]
Length=181

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 62/81 (77%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +R+VWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVE SHN        GG GG   
Sbjct  28   IRNVWVARRPPGYAFIDFDDPRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGGGGGGRG  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   RGGSDLKCYECGEPGHFAREC  108



>ref|NP_001147002.1| LOC100280612 [Zea mays]
 ref|XP_008677172.1| PREDICTED: LOC100280612 isoform X1 [Zea mays]
 gb|ACG25020.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACG29912.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|AFW64193.1| splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW64194.1| splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
Length=163

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +S
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSES  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>ref|XP_009353309.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Pyrus 
x bretschneideri]
Length=192

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 63/81 (78%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +RSVWVARRPPGYAF++FDD RDA DA+R +DGKN WRVELSHN         G GGR R
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIREIDGKNNWRVELSHNSRGGGGGGRGGGGRGR  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   SGGSDLKCYECGEPGHFAREC  108



>gb|KJB65745.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=182

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN         GG GGR 
Sbjct  28   IRSVWVARRPPGYAFIDFDDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGRG  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
            R GG D KCYECGE GHFAREC
Sbjct  88   RSGGSDLKCYECGEAGHFAREC  109



>ref|XP_001776556.1| predicted protein [Physcomitrella patens]
 gb|EDQ58689.1| predicted protein [Physcomitrella patens]
Length=174

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWV R+PPG+AFIEF+DRRDA DA+R L+GKNGWRVELS + SGG GG    GGDD 
Sbjct  28   LRSVWVGRKPPGFAFIEFEDRRDADDAIRALNGKNGWRVELSRS-SGGGGGPRGRGGDDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>gb|EYU29179.1| hypothetical protein MIMGU_mgv1a014305mg [Erythranthe guttata]
 gb|EYU29180.1| hypothetical protein MIMGU_mgv1a014305mg [Erythranthe guttata]
Length=194

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 63/86 (73%), Gaps = 11/86 (13%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----------ssggr  590
            +RSVWVARRPPGYAFI+FDDRRDA DA+R +DGKNGWRVELSHN             GG 
Sbjct  28   IRSVWVARRPPGYAFIDFDDRRDAQDAIRDIDGKNGWRVELSHNSRGGSGGGGGGRGGGG  87

Query  589  ggrsrggGDDSKCYECGEPGHFAREC  512
            GGR    G D KCYECGE GHFAREC
Sbjct  88   GGRGGRSGSDLKCYECGEAGHFAREC  113



>gb|AGC79943.1| arginine/serine-rich splicing factor RSZ28VI [Zea mays]
Length=185

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEAGHFAREC  100



>ref|XP_009779999.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Nicotiana sylvestris]
Length=198

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            +RSVWVARRPPGYAFI+FDD+RDA DA+R +DGKNGWRVELSHN         G  GGR 
Sbjct  43   IRSVWVARRPPGYAFIDFDDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGGGRGGGRG  102

Query  577  rggGDDSKCYECGEPGHFAREC  512
            R GG D KCYECGE GHFAREC
Sbjct  103  RSGGSDLKCYECGEAGHFAREC  124



>ref|XP_009780000.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Nicotiana sylvestris]
Length=183

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            +RSVWVARRPPGYAFI+FDD+RDA DA+R +DGKNGWRVELSHN         G  GGR 
Sbjct  28   IRSVWVARRPPGYAFIDFDDQRDARDAIREIDGKNGWRVELSHNSRGGGGGGGGRGGGRG  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
            R GG D KCYECGE GHFAREC
Sbjct  88   RSGGSDLKCYECGEAGHFAREC  109



>gb|KJB65743.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=172

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN         GG GGR 
Sbjct  28   IRSVWVARRPPGYAFIDFDDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGRG  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
            R GG D KCYECGE GHFAREC
Sbjct  88   RSGGSDLKCYECGEAGHFAREC  109



>ref|XP_004953059.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like [Setaria 
italica]
Length=237

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--AGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGETGHFAREC  100



>gb|KJB65740.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65741.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65742.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65744.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65746.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65747.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=183

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            +RSVWVARRPPGYAFI+FDD RDA DA+R LDGKNGWRVELSHN         GG GGR 
Sbjct  28   IRSVWVARRPPGYAFIDFDDHRDAEDAIRELDGKNGWRVELSHNSRGRGGRGGGGGGGRG  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
            R GG D KCYECGE GHFAREC
Sbjct  88   RSGGSDLKCYECGEAGHFAREC  109



>gb|AGE46161.1| arginine/serine-rich splicing factor RSZ23 transcript I [Physcomitrella 
patens]
Length=210

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWV R+PPG+AFIEF+DRRDA DA+R L+GKNGWRVELS + SGG GG    GGDD 
Sbjct  28   LRSVWVGRKPPGFAFIEFEDRRDADDAIRALNGKNGWRVELSRS-SGGGGGPRGRGGDDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>gb|AGE46163.1| arginine/serine-rich splicing factor RSZ23 transcript III [Physcomitrella 
patens]
Length=209

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWV R+PPG+AFIEF+DRRDA DA+R L+GKNGWRVELS + SGG GG    GGDD 
Sbjct  28   LRSVWVGRKPPGFAFIEFEDRRDADDAIRALNGKNGWRVELSRS-SGGGGGPRGRGGDDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_010477689.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Camelina sativa]
Length=178

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDA DA+R LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCY+CGE GHFAREC
Sbjct  88   DSKCYDCGELGHFAREC  104



>ref|XP_008681365.1| PREDICTED: uncharacterized protein LOC100272442 isoform X3 [Zea 
mays]
 gb|ACL54220.1| unknown [Zea mays]
 gb|AFW72285.1| hypothetical protein ZEAMMB73_339392 [Zea mays]
 gb|AGC79942.1| arginine/serine-rich splicing factor RSZ28V [Zea mays]
Length=231

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEAGHFAREC  100



>ref|XP_011044978.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Populus euphratica]
Length=189

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 63/83 (76%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggr  581
            +RSVWVARRPPGYAFI+FDD+RDA DA+  LDGKNGWRVELSHN          G  GGR
Sbjct  28   IRSVWVARRPPGYAFIDFDDKRDAQDAIHELDGKNGWRVELSHNSRGGGGGGGGGRGGGR  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
             R GG D KCYECGE GHFAREC
Sbjct  88   GRSGGSDLKCYECGEAGHFAREC  110



>ref|XP_006284575.1| hypothetical protein CARUB_v10005800mg [Capsella rubella]
 gb|EOA17473.1| hypothetical protein CARUB_v10005800mg [Capsella rubella]
Length=193

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------ssggrggrsr  575
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN         G      
Sbjct  28   IRSVWVARRPPGYAFLDFEDPRDARDAIRALDGKNGWRVEQSHNRGERGGGGRGGDRGGG  87

Query  574  ggGDDSKCYECGEPGHFAREC  512
             GG D KCYECGEPGHFAREC
Sbjct  88   RGGSDLKCYECGEPGHFAREC  108



>ref|XP_010477687.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
 ref|XP_010477688.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
Length=179

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss--ggrggrsrggGD  563
            LR+VWVARRPPGYAF+EFDD RDA DA+R LD KNGWRVELSH      G GG  RGG +
Sbjct  28   LRNVWVARRPPGYAFLEFDDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGRRGGIE  87

Query  562  DSKCYECGEPGHFAREC  512
            DSKCY+CGE GHFAREC
Sbjct  88   DSKCYDCGELGHFAREC  104



>ref|XP_006648032.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Oryza brachyantha]
Length=186

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N + GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRN-TSGRGGRDRHGGSEM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>ref|XP_006648031.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Oryza brachyantha]
Length=187

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N + GRGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRN-TSGRGGRDRHGGSEM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>ref|NP_001048352.1| Os02g0789400 [Oryza sativa Japonica Group]
 sp|Q6K4N0.1|RSZ21_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ21; AltName: 
Full=RS-containing zinc finger protein 21; Short=Os-RSZ21; 
Short=Os-RSZp21 [Oryza sativa Japonica Group]
 dbj|BAD19103.1| putative Splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19873.1| putative Splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAF10266.1| Os02g0789400 [Oryza sativa Japonica Group]
 dbj|BAG93345.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93415.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74149.1| hypothetical protein OsI_09229 [Oryza sativa Indica Group]
 gb|EEE57947.1| hypothetical protein OsJ_08668 [Oryza sativa Japonica Group]
Length=185

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N S  RGGR R GG + 
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRN-SSSRGGRDRHGGSEM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  87   KCYECGETGHFAREC  101



>ref|XP_008681360.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681361.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681362.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681363.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 gb|ACF78238.1| unknown [Zea mays]
 gb|ACF84789.1| unknown [Zea mays]
 gb|ACL53509.1| unknown [Zea mays]
 gb|ACN25660.1| unknown [Zea mays]
 gb|ACN33377.1| unknown [Zea mays]
 gb|ACR36653.1| unknown [Zea mays]
 gb|AFW72280.1| splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW72281.1| splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AFW72282.1| splicing factor, arginine/serine-rich 7 isoform 3 [Zea mays]
 gb|AFW72283.1| splicing factor, arginine/serine-rich 7 isoform 4 [Zea mays]
 gb|AFW72284.1| splicing factor, arginine/serine-rich 7 isoform 5 [Zea mays]
 gb|AGC79938.1| arginine/serine-rich splicing factor RSZ28I [Zea mays]
 gb|AGC79939.1| arginine/serine-rich splicing factor RSZ28II [Zea mays]
 gb|AGC79940.1| arginine/serine-rich splicing factor RSZ28III [Zea mays]
Length=253

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEAGHFAREC  100



>ref|XP_006647492.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X3 [Oryza brachyantha]
Length=189

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKCY  548
            VWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS   +G   GR R  G D KCY
Sbjct  14   VWVARKPPGFAFIDFDDRRDAQDAIRDLDGKNGWRVELS-TKAGSGRGRDRSSGSDMKCY  72

Query  547  ECGEPGHFAREC  512
            ECGEPGHFAREC
Sbjct  73   ECGEPGHFAREC  84



>ref|XP_008681364.1| PREDICTED: uncharacterized protein LOC100272442 isoform X2 [Zea 
mays]
Length=243

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEAGHFAREC  100



>gb|ACG44253.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=255

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWRVELSTK--VGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEAGHFAREC  100



>ref|XP_010447518.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Camelina 
sativa]
Length=199

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 61/84 (73%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---------ssggrgg  584
            +RSVWVARRPPGYAF++F+D RDA DA+RG+DGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDPRDARDAIRGVDGKNGWRVEQSHNRGERGGGGRGGDRGGD  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
            R   GG D KCYECGEPGHFAREC
Sbjct  88   RGGRGGSDLKCYECGEPGHFAREC  111



>ref|XP_010432845.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Camelina 
sativa]
Length=196

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---------ssggrgg  584
            +RSVWVARRPPGYAF++F+D RDA DA+RG+DGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDPRDARDAIRGVDGKNGWRVEQSHNRGERGGGGRGGDRGGD  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
                GG D KCYECGEPGHFAREC
Sbjct  88   CGGRGGSDLKCYECGEPGHFAREC  111



>ref|XP_010438021.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Camelina 
sativa]
Length=196

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---------ssggrgg  584
            +RSVWVARRPPGYAF++F+D RDA DA+RG+DGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDPRDARDAIRGVDGKNGWRVEQSHNRGERGGGGRGGDRGGD  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
                GG D KCYECGEPGHFAREC
Sbjct  88   CGGRGGSDLKCYECGEPGHFAREC  111



>ref|NP_001141411.1| uncharacterized protein LOC100273521 [Zea mays]
 gb|ACF86335.1| unknown [Zea mays]
Length=222

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            L+SVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS  +  G G      G D 
Sbjct  28   LKSVWVARKPPGFAFIDFDDRRDAQDAIRDLDGKNGWRVELS--TKDGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEVGHFAREC  100



>ref|XP_008676820.1| PREDICTED: uncharacterized protein LOC100273521 isoform X1 [Zea 
mays]
 ref|XP_008676821.1| PREDICTED: uncharacterized protein LOC100273521 isoform X1 [Zea 
mays]
 gb|ACG37174.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|AFW62914.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=277

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            L+SVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGWRVELS  +  G G      G D 
Sbjct  28   LKSVWVARKPPGFAFIDFDDRRDAQDAIRDLDGKNGWRVELS--TKDGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGEVGHFAREC  100



>ref|XP_010235900.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Brachypodium 
distachyon]
Length=194

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 67/82 (82%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss-------ggrggrs  578
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS NSS       GG GGR 
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRNSSGRGGGRDGGGGGRD  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
            R GG +SKCYECGE GHFAREC
Sbjct  88   RHGGSESKCYECGESGHFAREC  109



>ref|XP_001782492.1| predicted protein [Physcomitrella patens]
 gb|EDQ52711.1| predicted protein [Physcomitrella patens]
Length=224

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWV R+PPG+AFIEF+DRRDA DA+R L+GKNGWRVELS + SGG GG    GGDD 
Sbjct  28   LRSVWVGRKPPGFAFIEFEDRRDADDAIRALNGKNGWRVELSRS-SGGGGGPRGRGGDDM  86

Query  556  KCYECGEPGHFAREC  512
            KCYECGEPGHFAREC
Sbjct  87   KCYECGEPGHFAREC  101



>ref|XP_008357431.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine-rich splicing 
factor RSZ22A-like [Malus domestica]
Length=194

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 64/87 (74%), Gaps = 12/87 (14%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------------ssgg  593
            +RSVWVARRPPGYAF++FDD RDA DA+R LDGKN WRVELSHN              GG
Sbjct  28   IRSVWVARRPPGYAFVDFDDSRDAEDAIRELDGKNNWRVELSHNXRGGGGGGGGGGGGGG  87

Query  592  rggrsrggGDDSKCYECGEPGHFAREC  512
             GGR R GG D KCYECGEPGHFAREC
Sbjct  88   GGGRGRSGGSDLKCYECGEPGHFAREC  114



>gb|AGE46101.1| arginine/serine-rich splicing factor RSZ28 transcript I [Sorghum 
bicolor]
 gb|AGE46102.1| arginine/serine-rich splicing factor RSZ28 transcript II [Sorghum 
bicolor]
 gb|AGE46103.1| arginine/serine-rich splicing factor RSZ28 transcript III [Sorghum 
bicolor]
 gb|AGE46104.1| arginine/serine-rich splicing factor RSZ28 transcript IV [Sorghum 
bicolor]
Length=246

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            LRSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGW+VELS     G G      G D 
Sbjct  28   LRSVWVARKPPGFAFIDFDDRRDAQDAIRELDGKNGWKVELSTK--AGGGRGRDRNGSDM  85

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  86   KCYECGESGHFAREC  100



>ref|XP_006412579.1| hypothetical protein EUTSA_v10026315mg [Eutrema salsugineum]
 gb|ESQ54032.1| hypothetical protein EUTSA_v10026315mg [Eutrema salsugineum]
Length=192

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 60/82 (73%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN            G R 
Sbjct  28   IRSVWVARRPPGYAFLDFEDPRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGDRGGDRG  87

Query  577  rggGDDSKCYECGEPGHFAREC  512
              GG D KCYECGEPGHFAREC
Sbjct  88   GRGGSDLKCYECGEPGHFAREC  109



>ref|XP_009138024.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Brassica 
rapa]
Length=194

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 59/80 (74%), Gaps = 5/80 (6%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrg  572
            ++SVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN        G       
Sbjct  28   IKSVWVARRPPGYAFLDFEDPRDASDAIRDLDGKNGWRVEQSHNRGDRGGGRGGDRGGDR  87

Query  571  gGDDSKCYECGEPGHFAREC  512
            GG D KCYECGEPGHFAREC
Sbjct  88   GGSDLKCYECGEPGHFAREC  107



>gb|AFW64196.1| hypothetical protein ZEAMMB73_035767 [Zea mays]
Length=136

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDS  557
            + SVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +S
Sbjct  1    MESVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSES  59

Query  556  KCYECGEPGHFAREC  512
            KCYECGE GHFAREC
Sbjct  60   KCYECGETGHFAREC  74



>emb|CDY68847.1| BnaAnng28560D [Brassica napus]
Length=194

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-ssggrggrsrggGDD  560
            ++SVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN   G   G    GG D
Sbjct  28   IKSVWVARRPPGYAFLDFEDSRDARDAIRDLDGKNGWRVEQSHNRGGGRGDGGRGRGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGE GHFAREC
Sbjct  88   LKCYECGESGHFAREC  103



>gb|AFW64191.1| hypothetical protein ZEAMMB73_035767, partial [Zea mays]
Length=191

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = -2

Query  733  RSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSK  554
            RSVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +SK
Sbjct  57   RSVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSESK  115

Query  553  CYECGEPGHFAREC  512
            CYECGE GHFAREC
Sbjct  116  CYECGETGHFAREC  129



>emb|CDX72313.1| BnaC07g43350D [Brassica napus]
Length=197

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 57/77 (74%), Gaps = 5/77 (6%)
 Frame = -2

Query  727  VWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----ssggrggrsrggGD  563
            VWVARRPPGYAF++F+D RDA DA+RGLDGKNGWRVE SHN        G       GG 
Sbjct  34   VWVARRPPGYAFLDFEDPRDARDAIRGLDGKNGWRVEQSHNRGDRGGGRGGDRGGDRGGS  93

Query  562  DSKCYECGEPGHFAREC  512
            D KCYECGEPGHFAREC
Sbjct  94   DLKCYECGEPGHFAREC  110



>ref|XP_009140565.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Brassica 
rapa]
 emb|CDY45585.1| BnaA04g14520D [Brassica napus]
 emb|CDY20328.1| BnaC04g36280D [Brassica napus]
Length=196

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 61/83 (73%), Gaps = 8/83 (10%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN--------ssggrggr  581
            ++SVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN          GG  G 
Sbjct  28   IKSVWVARRPPGYAFLDFEDSRDARDAIRDLDGKNGWRVEESHNRGGGGGRGGRGGGDGG  87

Query  580  srggGDDSKCYECGEPGHFAREC  512
               GG D KCYECGEPGHFAREC
Sbjct  88   RGRGGSDLKCYECGEPGHFAREC  110



>gb|EMT04120.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=224

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 63/85 (74%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N           +GG G
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGAGGGG  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            G    GG D KCYECGE GHFAREC
Sbjct  88   GGRDRGGSDMKCYECGESGHFAREC  112



>ref|XP_010460161.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
Length=188

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggG  566
            L +VWVARRPPGYAF+EFDD RDA DA+R LD KNGWRVELSH      G  GG  RGG 
Sbjct  28   LCNVWVARRPPGYAFLEFDDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGGRRGGI  87

Query  565  DDSKCYECGEPGHFAREC  512
            +DSKCYECGE GHFAREC
Sbjct  88   EDSKCYECGELGHFAREC  105



>ref|XP_010460162.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Camelina sativa]
Length=187

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNss---ggrggrsrggG  566
            L +VWVARRPPGYAF+EFDD RDA DA+R LD KNGWRVELSH      G  GG  RGG 
Sbjct  28   LCNVWVARRPPGYAFLEFDDERDASDAIRALDRKNGWRVELSHKDKGGRGAGGGGRRGGI  87

Query  565  DDSKCYECGEPGHFAREC  512
            +DSKCYECGE GHFAREC
Sbjct  88   EDSKCYECGELGHFAREC  105



>ref|XP_003575333.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Brachypodium distachyon]
 ref|XP_010235686.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Brachypodium distachyon]
Length=231

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELS-HNssggrggrsrggGDD  560
            LRSVWVAR+PPG+AFI+FD+ RDA DA+R LDGKNGWRVELS  + SG    R R GG D
Sbjct  28   LRSVWVARKPPGFAFIDFDESRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERPGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGE GHFAREC
Sbjct  88   MKCYECGESGHFAREC  103



>ref|XP_010235684.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010235685.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Brachypodium distachyon]
Length=234

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELS-HNssggrggrsrggGDD  560
            LRSVWVAR+PPG+AFI+FD+ RDA DA+R LDGKNGWRVELS  + SG    R R GG D
Sbjct  28   LRSVWVARKPPGFAFIDFDESRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERPGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGE GHFAREC
Sbjct  88   MKCYECGESGHFAREC  103



>gb|AAY84871.1| pre-mRNA processing factor [Triticum aestivum]
Length=194

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 62/85 (73%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N            GG G
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGGGGGG  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            G    GG D KCYECGE GHFAREC
Sbjct  88   GGRGRGGSDMKCYECGESGHFAREC  112



>dbj|BAJ98217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 62/85 (73%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----------ssggrg  587
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N            GG G
Sbjct  28   LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGGGGGG  87

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
            G    GG D KCYECGE GHFAREC
Sbjct  88   GGRDRGGSDMKCYECGESGHFAREC  112



>gb|EMS62939.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=250

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNs-sggrggrsrggGDD  560
            L+SVWVAR+PPG+AFI+FD+ RDA DA+R LDGKNGWRVELS  S SG    R R GG D
Sbjct  28   LKSVWVARKPPGFAFIDFDETRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGE GHFAREC
Sbjct  88   MKCYECGESGHFAREC  103



>gb|EMT10866.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=249

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELS-HNssggrggrsrggGDD  560
            L+SVWVAR+PPG+AFI+FD+ RDA DA+R LDGKNGWRVELS  + SG    R R GG D
Sbjct  28   LKSVWVARKPPGFAFIDFDETRDAKDAIRELDGKNGWRVELSTKSGSGRGRERERSGGSD  87

Query  559  SKCYECGEPGHFAREC  512
             KCYECGE GHFAREC
Sbjct  88   MKCYECGESGHFAREC  103



>gb|EPS60072.1| hypothetical protein M569_14729, partial [Genlisea aurea]
Length=197

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 61/85 (72%), Gaps = 10/85 (12%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLD---------GKNGWRVELSH-Nssggrg  587
            +RSVWVARRPPGYAFI+FDDRRDA DA+R LD         GK+GWRVELSH  S  G G
Sbjct  30   IRSVWVARRPPGYAFIDFDDRRDAQDAIRELDGCIISFSLTGKHGWRVELSHGGSGRGGG  89

Query  586  grsrggGDDSKCYECGEPGHFAREC  512
                  G D KCYECGEPGHFAREC
Sbjct  90   RGGGRSGSDLKCYECGEPGHFAREC  114



>ref|XP_006295037.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
 gb|EOA27935.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
Length=155

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 59/86 (69%), Gaps = 11/86 (13%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----------ssggr  590
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIRELDGKNGWRVEQSHNRGGGGGRGGGGGGRGG  87

Query  589  ggrsrggGDDSKCYECGEPGHFAREC  512
             G    GG D KCYECGE GHFAREC
Sbjct  88   DGGRGRGGSDLKCYECGESGHFAREC  113



>ref|XP_010429442.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Camelina 
sativa]
Length=197

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 59/86 (69%), Gaps = 11/86 (13%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----------ssggr  590
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIRALDGKNGWRVEQSHNRGGGGGRGGGGGGRGG  87

Query  589  ggrsrggGDDSKCYECGEPGHFAREC  512
             G    GG D KCYECGE GHFAREC
Sbjct  88   DGGRGRGGSDLKCYECGESGHFAREC  113



>ref|XP_010417215.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Camelina 
sativa]
 ref|XP_010472468.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Camelina 
sativa]
Length=197

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 59/86 (69%), Gaps = 11/86 (13%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----------ssggr  590
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIRALDGKNGWRVEQSHNRGGGGGRGGGGGGRGG  87

Query  589  ggrsrggGDDSKCYECGEPGHFAREC  512
             G    GG D KCYECGE GHFAREC
Sbjct  88   DGGRGRGGSDLKCYECGESGHFAREC  113



>gb|EMS58509.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=375

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 62/82 (76%), Gaps = 7/82 (9%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-------ssggrggrs  578
            LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDGKNGWRVELS N         GG GG  
Sbjct  121  LRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGKNGWRVELSRNDRGDRGGRGGGGGGGR  180

Query  577  rggGDDSKCYECGEPGHFAREC  512
              GG D KCYECGE GHFAREC
Sbjct  181  DRGGSDMKCYECGESGHFAREC  202



>gb|AFW64195.1| hypothetical protein ZEAMMB73_035767 [Zea mays]
Length=178

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -2

Query  730  SVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHNssggrggrsrggGDDSKC  551
            SVWVAR+PPG+AFI+FDDRRDA DA+R LDGKNGW+VELS + + GRG R R GG +SKC
Sbjct  45   SVWVARKPPGFAFIDFDDRRDAEDAIRDLDGKNGWKVELSRS-TNGRGSRDRHGGSESKC  103

Query  550  YECGEPGHFAREC  512
            YECGE GHFAREC
Sbjct  104  YECGETGHFAREC  116



>ref|XP_006295038.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
 gb|EOA27936.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
Length=196

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 59/86 (69%), Gaps = 11/86 (13%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN-----------ssggr  590
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              G 
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIRELDGKNGWRVEQSHNRGGGGGRGGGGGGRGG  87

Query  589  ggrsrggGDDSKCYECGEPGHFAREC  512
             G    GG D KCYECGE GHFAREC
Sbjct  88   DGGRGRGGSDLKCYECGESGHFAREC  113



>ref|XP_009117114.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Brassica 
rapa]
 ref|XP_009117115.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Brassica 
rapa]
Length=205

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 59/84 (70%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---------ssggrgg  584
            ++SVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN           G   G
Sbjct  28   IKSVWVARRPPGYAFLDFEDSRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGGGGRGDG  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
                GG D KCYECGE GHFAREC
Sbjct  88   GRGRGGSDLKCYECGESGHFAREC  111



>gb|KJB53757.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=199

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 64/97 (66%), Gaps = 22/97 (23%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLD-------------------GKNGWRVEL  614
            +RSVWVARRPPGYAFI+F+DRRDA DA+R LD                   GKNGWRVEL
Sbjct  28   IRSVWVARRPPGYAFIDFEDRRDAEDAIRELDAYHLRSTSFTSFMNHVFGSGKNGWRVEL  87

Query  613  SHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  512
            SHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  88   SHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  124



>ref|NP_180035.1| serine/arginine-rich splicing factor RSZ22A [Arabidopsis thaliana]
 sp|Q9SJA6.1|RZ22A_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ22A; AltName: 
Full=RS-containing zinc finger protein 22A; Short=At-RSZ22a; 
Short=At-RSZp22a; Short=AtRSZ22a [Arabidopsis thaliana]
 gb|AAD23894.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 dbj|BAC42523.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAO63280.1| At2g24590 [Arabidopsis thaliana]
 gb|AEC07595.1| serine/arginine-rich splicing factor RSZ22A [Arabidopsis thaliana]
Length=196

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 9/84 (11%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN---------ssggrgg  584
            +RSVWVARRPPGYAF++F+D RDA DA+R +DGKNGWRVE SHN           GG  G
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIREVDGKNGWRVEQSHNRGGGGGRGGGRGGGDG  87

Query  583  rsrggGDDSKCYECGEPGHFAREC  512
                GG D KCYECGE GHFAREC
Sbjct  88   GRGRGGSDLKCYECGESGHFAREC  111



>ref|NP_194886.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 ref|NP_001078474.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 sp|O81126.1|RSZ22_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ22; AltName: 
Full=RS-containing zinc finger protein 22; Short=At-RSZ22; 
Short=At-RSZp22; Short=AtRSZ22 [Arabidopsis thaliana]
 emb|CAA19765.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAD12769.1| 9G8-like SR protein [Arabidopsis thaliana]
 emb|CAB79876.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAL38828.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAM51281.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAM63524.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AEE85931.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 gb|AEE85932.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
Length=200

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 62/87 (71%), Gaps = 12/87 (14%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------------ssgg  593
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              GG
Sbjct  28   VRSVWVARRPPGYAFLDFEDPRDARDAIRALDGKNGWRVEQSHNRGERGGGGRGGDRGGG  87

Query  592  rggrsrggGDDSKCYECGEPGHFAREC  512
             GGR   GG D KCYECGE GHFAREC
Sbjct  88   GGGRGGRGGSDLKCYECGETGHFAREC  114



>ref|XP_002878770.1| hypothetical protein ARALYDRAFT_481315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55029.1| hypothetical protein ARALYDRAFT_481315 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 60/87 (69%), Gaps = 12/87 (14%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------------ssgg  593
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              GG
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIRELDGKNGWRVEQSHNRGGGGGRGGGGGGRGG  87

Query  592  rggrsrggGDDSKCYECGEPGHFAREC  512
              G    GG D KCYECGE GHFAREC
Sbjct  88   GDGGRGRGGSDLKCYECGESGHFAREC  114



>ref|XP_006404997.1| hypothetical protein EUTSA_v10000328mg [Eutrema salsugineum]
 gb|ESQ46450.1| hypothetical protein EUTSA_v10000328mg [Eutrema salsugineum]
Length=202

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 60/87 (69%), Gaps = 12/87 (14%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN------------ssgg  593
            +RSVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN              GG
Sbjct  28   IRSVWVARRPPGYAFLDFEDSRDARDAIRDLDGKNGWRVEQSHNRGGGGGRGGGGGGRGG  87

Query  592  rggrsrggGDDSKCYECGEPGHFAREC  512
              G    GG D KCYECGE GHFAREC
Sbjct  88   GDGGRGRGGSDLKCYECGESGHFAREC  114



>emb|CDX76804.1| BnaC08g33900D [Brassica napus]
Length=813

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = -2

Query  736  LRSVWVARRPPGYAFIEFDDRRDALDAVRGLDGKNGWRVELSHN----ssggrggrsrgg  569
            ++SVWVARRPPGYAF++F+D RDA DA+R LDGKNGWRVE SHN      G   G    G
Sbjct  644  IKSVWVARRPPGYAFLDFEDSRDARDAIRDLDGKNGWRVEQSHNRGGGGGGRGDGGRGRG  703

Query  568  GDDSKCYECGEPGHFAREC  512
            G D KCYECGE GHFAREC
Sbjct  704  GSDLKCYECGESGHFAREC  722



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500