BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050G23

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587659.1|  PREDICTED: protein trichome birefringence-li...    290   5e-93   Nicotiana tomentosiformis
ref|XP_009803690.1|  PREDICTED: protein trichome birefringence-li...    288   2e-92   Nicotiana sylvestris
ref|XP_004249967.1|  PREDICTED: protein trichome birefringence-li...    286   8e-92   Solanum lycopersicum
ref|XP_006361471.1|  PREDICTED: uncharacterized protein LOC102605360    286   1e-91   Solanum tuberosum [potatoes]
emb|CDO99906.1|  unnamed protein product                                286   2e-91   Coffea canephora [robusta coffee]
ref|XP_004308558.2|  PREDICTED: protein trichome birefringence-li...    286   2e-91   Fragaria vesca subsp. vesca
ref|XP_008375566.1|  PREDICTED: protein trichome birefringence-li...    279   6e-89   
ref|XP_009356126.1|  PREDICTED: protein trichome birefringence-li...    279   8e-89   
ref|XP_007211438.1|  hypothetical protein PRUPE_ppa007187mg             275   2e-87   Prunus persica
ref|XP_008231948.1|  PREDICTED: protein trichome birefringence-li...    275   2e-87   Prunus mume [ume]
gb|KDO44402.1|  hypothetical protein CISIN_1g017027mg                   275   2e-87   Citrus sinensis [apfelsine]
ref|XP_006445722.1|  hypothetical protein CICLE_v10015623mg             275   2e-87   Citrus clementina [clementine]
gb|KDP35804.1|  hypothetical protein JCGZ_10440                         272   3e-86   Jatropha curcas
gb|ABK92623.1|  unknown                                                 267   3e-86   Populus trichocarpa [western balsam poplar]
gb|KJB78678.1|  hypothetical protein B456_013G011800                    270   2e-85   Gossypium raimondii
ref|XP_010032073.1|  PREDICTED: protein trichome birefringence-li...    270   2e-85   Eucalyptus grandis [rose gum]
gb|KHG28346.1|  Saccharopine dehydrogenase [NADP(+), L-glutamate-...    269   3e-85   Gossypium arboreum [tree cotton]
ref|XP_002521177.1|  conserved hypothetical protein                     270   3e-85   Ricinus communis
ref|XP_007010436.1|  Trichome birefringence-like 36                     269   6e-85   
ref|XP_010088792.1|  hypothetical protein L484_018353                   268   1e-84   Morus notabilis
ref|XP_011076935.1|  PREDICTED: protein trichome birefringence-li...    266   1e-83   Sesamum indicum [beniseed]
ref|XP_004135033.1|  PREDICTED: uncharacterized protein LOC101204429    265   2e-83   Cucumis sativus [cucumbers]
ref|XP_002311947.1|  hypothetical protein POPTR_0008s02180g             265   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008446761.1|  PREDICTED: protein trichome birefringence-li...    264   4e-83   Cucumis melo [Oriental melon]
ref|XP_007142840.1|  hypothetical protein PHAVU_007G021300g             262   2e-82   Phaseolus vulgaris [French bean]
gb|KHN09736.1|  hypothetical protein glysoja_049465                     259   9e-82   Glycine soja [wild soybean]
gb|KEH44322.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    259   2e-81   Medicago truncatula
gb|KEH44323.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    259   4e-81   Medicago truncatula
ref|XP_003535878.1|  PREDICTED: protein YLS7                            259   4e-81   Glycine max [soybeans]
gb|EYU19805.1|  hypothetical protein MIMGU_mgv1a008074mg                259   5e-81   Erythranthe guttata [common monkey flower]
ref|XP_011032863.1|  PREDICTED: protein trichome birefringence-li...    259   1e-80   Populus euphratica
ref|XP_002269148.1|  PREDICTED: protein trichome birefringence-li...    258   1e-80   Vitis vinifera
emb|CAN74465.1|  hypothetical protein VITISV_004134                     257   5e-80   Vitis vinifera
ref|XP_010536307.1|  PREDICTED: protein trichome birefringence-li...    256   1e-79   Tarenaya hassleriana [spider flower]
gb|KHN11469.1|  hypothetical protein glysoja_015364                     255   2e-79   Glycine soja [wild soybean]
ref|XP_003555875.1|  PREDICTED: protein YLS7-like                       254   6e-79   Glycine max [soybeans]
ref|XP_010271679.1|  PREDICTED: protein trichome birefringence-li...    253   9e-79   Nelumbo nucifera [Indian lotus]
gb|ACU24162.1|  unknown                                                 252   2e-78   Glycine max [soybeans]
ref|XP_007145481.1|  hypothetical protein PHAVU_007G242600g             252   3e-78   Phaseolus vulgaris [French bean]
ref|XP_006589717.1|  PREDICTED: uncharacterized protein LOC102660356    247   4e-78   
gb|KEH41400.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    250   2e-77   Medicago truncatula
ref|XP_004514721.1|  PREDICTED: uncharacterized protein LOC101494450    250   2e-77   Cicer arietinum [garbanzo]
gb|KHN37414.1|  Diphosphomevalonate decarboxylase                       251   6e-75   Glycine soja [wild soybean]
ref|XP_008790903.1|  PREDICTED: protein trichome birefringence-li...    239   2e-72   
ref|XP_010912275.1|  PREDICTED: protein trichome birefringence-li...    236   8e-72   Elaeis guineensis
ref|XP_010907119.1|  PREDICTED: protein trichome birefringence-li...    233   1e-70   Elaeis guineensis
ref|XP_009404370.1|  PREDICTED: protein trichome birefringence-li...    231   2e-70   
ref|XP_006391872.1|  hypothetical protein EUTSA_v10023527mg             231   4e-70   Eutrema salsugineum [saltwater cress]
ref|XP_008784007.1|  PREDICTED: protein trichome birefringence-li...    231   4e-70   Phoenix dactylifera
gb|KFK34680.1|  hypothetical protein AALP_AA5G177300                    230   8e-70   Arabis alpina [alpine rockcress]
emb|CDX76156.1|  BnaA04g04200D                                          229   2e-69   
ref|XP_009139251.1|  PREDICTED: protein trichome birefringence-li...    229   3e-69   Brassica rapa
emb|CDY65398.1|  BnaCnng46890D                                          228   6e-69   Brassica napus [oilseed rape]
ref|XP_010504228.1|  PREDICTED: protein trichome birefringence-li...    227   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010427099.1|  PREDICTED: protein trichome birefringence-li...    227   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010515948.1|  PREDICTED: protein trichome birefringence-li...    227   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006836042.1|  hypothetical protein AMTR_s00114p00046060          226   6e-68   Amborella trichopoda
ref|XP_006291297.1|  hypothetical protein CARUB_v10017432mg             223   5e-67   
ref|NP_566996.1|  protein TRICHOME BIREFRINGENCE-LIKE 36                222   8e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403597.1|  hypothetical protein EUTSA_v10010451mg             218   7e-65   Eutrema salsugineum [saltwater cress]
emb|CAB71000.1|  putative protein                                       217   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877964.1|  hypothetical protein ARALYDRAFT_485823             211   1e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_011469321.1|  PREDICTED: protein trichome birefringence-li...    209   6e-62   Fragaria vesca subsp. vesca
gb|AFK37199.1|  unknown                                                 182   2e-54   Medicago truncatula
gb|ABK25068.1|  unknown                                                 180   3e-50   Picea sitchensis
gb|ABK22287.1|  unknown                                                 180   3e-50   Picea sitchensis
gb|ACN40917.1|  unknown                                                 178   2e-49   Picea sitchensis
gb|EMT17911.1|  hypothetical protein F775_21346                         174   4e-49   
dbj|BAK05297.1|  predicted protein                                      172   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003561735.1|  PREDICTED: protein PMR5                            171   6e-47   Brachypodium distachyon [annual false brome]
ref|XP_006649908.1|  PREDICTED: protein YLS7-like                       166   3e-45   Oryza brachyantha
ref|XP_006846293.1|  hypothetical protein AMTR_s00012p00251740          166   4e-45   Amborella trichopoda
ref|XP_004984854.1|  PREDICTED: uncharacterized protein LOC101772...    164   3e-44   Setaria italica
gb|EAY89580.1|  hypothetical protein OsI_11109                          163   6e-44   Oryza sativa Indica Group [Indian rice]
gb|ACG43356.1|  hypothetical protein                                    162   1e-43   Zea mays [maize]
gb|KDP21076.1|  hypothetical protein JCGZ_21547                         162   1e-43   Jatropha curcas
ref|XP_010538205.1|  PREDICTED: protein trichome birefringence-li...    158   1e-43   
gb|KHN27090.1|  hypothetical protein glysoja_032858                     159   1e-43   Glycine soja [wild soybean]
ref|NP_001142288.1|  uncharacterized protein LOC100274457               162   1e-43   Zea mays [maize]
ref|XP_002468040.1|  hypothetical protein SORBIDRAFT_01g038480          161   3e-43   Sorghum bicolor [broomcorn]
ref|XP_011042254.1|  PREDICTED: protein trichome birefringence-li...    163   3e-43   Populus euphratica
ref|XP_003599941.1|  hypothetical protein MTR_3g049330                  159   5e-43   Medicago truncatula
ref|NP_001049797.1|  Os03g0290900                                       160   7e-43   
gb|KHN37297.1|  hypothetical protein glysoja_013512                     161   1e-42   Glycine soja [wild soybean]
ref|XP_006448025.1|  hypothetical protein CICLE_v10018196mg             157   2e-42   
gb|KJB69610.1|  hypothetical protein B456_011G033800                    158   2e-42   Gossypium raimondii
ref|XP_010920821.1|  PREDICTED: protein PMR5                            159   2e-42   Elaeis guineensis
ref|XP_011003951.1|  PREDICTED: protein PMR5-like                       159   2e-42   Populus euphratica
ref|XP_008792962.1|  PREDICTED: protein PMR5                            159   2e-42   Phoenix dactylifera
gb|KDO58612.1|  hypothetical protein CISIN_1g018724mg                   158   2e-42   Citrus sinensis [apfelsine]
ref|XP_006492301.1|  PREDICTED: protein YLS7-like                       158   2e-42   Citrus sinensis [apfelsine]
ref|XP_006590231.1|  PREDICTED: protein YLS7-like                       161   2e-42   
ref|XP_004500278.1|  PREDICTED: uncharacterized protein LOC101504380    159   2e-42   Cicer arietinum [garbanzo]
ref|XP_002301513.2|  hypothetical protein POPTR_0002s19680g             160   3e-42   
ref|XP_003555633.2|  PREDICTED: protein YLS7-like                       160   4e-42   Glycine max [soybeans]
gb|KJB49816.1|  hypothetical protein B456_008G139200                    155   5e-42   Gossypium raimondii
ref|XP_002316834.2|  hypothetical protein POPTR_0011s07550g             153   7e-42   
ref|XP_006467669.1|  PREDICTED: protein YLS7-like                       157   7e-42   
ref|XP_011096427.1|  PREDICTED: protein trichome birefringence-li...    157   1e-41   Sesamum indicum [beniseed]
gb|AFK45250.1|  unknown                                                 155   2e-41   Lotus japonicus
gb|KDO77820.1|  hypothetical protein CISIN_1g017263mg                   155   2e-41   Citrus sinensis [apfelsine]
ref|XP_006449479.1|  hypothetical protein CICLE_v10015687mg             155   2e-41   Citrus clementina [clementine]
emb|CAN60202.1|  hypothetical protein VITISV_036403                     155   2e-41   Vitis vinifera
emb|CDP09209.1|  unnamed protein product                                155   3e-41   Coffea canephora [robusta coffee]
ref|XP_010540499.1|  PREDICTED: protein trichome birefringence-li...    155   3e-41   Tarenaya hassleriana [spider flower]
emb|CBI30668.3|  unnamed protein product                                155   3e-41   Vitis vinifera
ref|XP_008228877.1|  PREDICTED: protein trichome birefringence-li...    152   3e-41   
gb|KJB49815.1|  hypothetical protein B456_008G139200                    155   4e-41   Gossypium raimondii
gb|KHG20284.1|  Enolase                                                 155   4e-41   Gossypium arboreum [tree cotton]
ref|XP_010057074.1|  PREDICTED: protein trichome birefringence-li...    155   4e-41   Eucalyptus grandis [rose gum]
ref|XP_010480710.1|  PREDICTED: protein trichome birefringence-li...    155   4e-41   Camelina sativa [gold-of-pleasure]
gb|KJB24277.1|  hypothetical protein B456_004G138200                    154   4e-41   Gossypium raimondii
ref|XP_009787058.1|  PREDICTED: protein PMR5-like isoform X2            152   4e-41   Nicotiana sylvestris
gb|KFK44758.1|  hypothetical protein AALP_AA1G299000                    155   4e-41   Arabis alpina [alpine rockcress]
ref|XP_007146400.1|  hypothetical protein PHAVU_006G037200g             155   4e-41   Phaseolus vulgaris [French bean]
gb|AHN91976.1|  TBL1                                                    155   5e-41   Citrus sinensis [apfelsine]
gb|KEH34316.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    152   5e-41   Medicago truncatula
ref|XP_010460674.1|  PREDICTED: protein trichome birefringence-li...    155   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_003593750.1|  hypothetical protein MTR_2g015720                  154   6e-41   Medicago truncatula
emb|CBI21958.3|  unnamed protein product                                151   6e-41   Vitis vinifera
ref|XP_003593751.1|  hypothetical protein MTR_2g015720                  154   7e-41   
ref|XP_004505509.1|  PREDICTED: uncharacterized protein LOC101514285    154   8e-41   Cicer arietinum [garbanzo]
ref|XP_009588313.1|  PREDICTED: protein PMR5-like                       154   8e-41   Nicotiana tomentosiformis
ref|XP_002313988.1|  hypothetical protein POPTR_0009s07700g             154   9e-41   
gb|KHF98470.1|  Transmembrane protein                                   152   9e-41   Gossypium arboreum [tree cotton]
ref|XP_002274664.1|  PREDICTED: protein trichome birefringence-li...    155   1e-40   Vitis vinifera
ref|XP_003560398.1|  PREDICTED: protein trichome birefringence-li...    155   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_004305456.2|  PREDICTED: protein trichome birefringence-li...    153   1e-40   Fragaria vesca subsp. vesca
gb|KHN11944.1|  hypothetical protein glysoja_019917                     150   1e-40   Glycine soja [wild soybean]
ref|XP_010499424.1|  PREDICTED: protein trichome birefringence-li...    154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007025417.1|  Trichome birefringence-like 37 isoform 1           153   1e-40   
ref|XP_006305057.1|  hypothetical protein CARUB_v10009422mg             154   1e-40   Capsella rubella
ref|XP_002522557.1|  conserved hypothetical protein                     153   1e-40   Ricinus communis
ref|XP_008225213.1|  PREDICTED: protein trichome birefringence-li...    153   2e-40   Prunus mume [ume]
gb|KDP28262.1|  hypothetical protein JCGZ_14033                         156   2e-40   Jatropha curcas
ref|XP_002893546.1|  hypothetical protein ARALYDRAFT_473111             153   2e-40   
gb|AAF88130.1|AC021043_23  Unknown protein                              153   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008352647.1|  PREDICTED: protein trichome birefringence-li...    152   2e-40   
ref|XP_007216008.1|  hypothetical protein PRUPE_ppa014688mg             152   2e-40   Prunus persica
ref|XP_004500006.1|  PREDICTED: uncharacterized protein LOC101510811    153   2e-40   Cicer arietinum [garbanzo]
ref|XP_010102792.1|  hypothetical protein L484_007599                   153   2e-40   Morus notabilis
gb|KJB49817.1|  hypothetical protein B456_008G139200                    155   2e-40   Gossypium raimondii
ref|XP_003613275.1|  hypothetical protein MTR_5g034810                  152   2e-40   
ref|XP_011460601.1|  PREDICTED: protein trichome birefringence-li...    153   2e-40   Fragaria vesca subsp. vesca
ref|XP_009622720.1|  PREDICTED: protein PMR5-like                       152   3e-40   Nicotiana tomentosiformis
ref|NP_564318.1|  protein trichome birefringence-like 38                152   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20810.1|  hypothetical protein glysoja_049140                     149   4e-40   Glycine soja [wild soybean]
ref|XP_010267992.1|  PREDICTED: protein trichome birefringence-li...    154   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_011089477.1|  PREDICTED: protein PMR5-like                       152   5e-40   Sesamum indicum [beniseed]
ref|XP_006597476.1|  PREDICTED: protein YLS7-like                       152   6e-40   Glycine max [soybeans]
gb|KHG15499.1|  Calpain clp-1                                           150   6e-40   Gossypium arboreum [tree cotton]
emb|CAJ40777.1|  alpha galactosidase precursor                          152   6e-40   Coffea arabica [arabica coffee]
gb|KEH34315.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    152   6e-40   Medicago truncatula
gb|AFK49604.1|  unknown                                                 152   7e-40   Lotus japonicus
ref|XP_006415616.1|  hypothetical protein EUTSA_v10007896mg             152   7e-40   Eutrema salsugineum [saltwater cress]
gb|KDO77821.1|  hypothetical protein CISIN_1g017263mg                   152   7e-40   Citrus sinensis [apfelsine]
ref|XP_002525125.1|  conserved hypothetical protein                     151   9e-40   
ref|XP_002515280.1|  conserved hypothetical protein                     154   9e-40   Ricinus communis
ref|XP_009787057.1|  PREDICTED: protein PMR5-like isoform X1            152   1e-39   Nicotiana sylvestris
ref|XP_009375160.1|  PREDICTED: protein trichome birefringence-like     152   1e-39   
gb|KDO77819.1|  hypothetical protein CISIN_1g017263mg                   151   1e-39   Citrus sinensis [apfelsine]
ref|XP_010253781.1|  PREDICTED: protein PMR5-like                       151   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_011024935.1|  PREDICTED: protein PMR5-like                       151   1e-39   Populus euphratica
ref|XP_009339560.1|  PREDICTED: protein trichome birefringence-li...    150   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_010099368.1|  hypothetical protein L484_004794                   150   2e-39   Morus notabilis
gb|KDO77822.1|  hypothetical protein CISIN_1g017263mg                   150   2e-39   Citrus sinensis [apfelsine]
ref|XP_002305083.1|  hypothetical protein POPTR_0004s05420g             151   2e-39   
ref|XP_011045911.1|  PREDICTED: protein trichome birefringence-li...    150   2e-39   Populus euphratica
gb|KDP40076.1|  hypothetical protein JCGZ_02074                         150   2e-39   Jatropha curcas
gb|KHN08449.1|  hypothetical protein glysoja_014214                     150   2e-39   Glycine soja [wild soybean]
ref|XP_010914510.1|  PREDICTED: protein trichome birefringence-li...    151   2e-39   
emb|CDO96761.1|  unnamed protein product                                150   3e-39   Coffea canephora [robusta coffee]
ref|XP_009766231.1|  PREDICTED: protein PMR5-like                       150   3e-39   Nicotiana sylvestris
gb|EYU28072.1|  hypothetical protein MIMGU_mgv1a008400mg                150   3e-39   Erythranthe guttata [common monkey flower]
gb|KHG17132.1|  CAS1 domain-containing 1                                150   3e-39   Gossypium arboreum [tree cotton]
ref|XP_003608140.1|  hypothetical protein MTR_4g088030                  146   3e-39   
ref|XP_002279857.1|  PREDICTED: protein trichome birefringence-li...    150   3e-39   Vitis vinifera
ref|XP_006840447.1|  hypothetical protein AMTR_s00045p00169080          150   3e-39   
ref|XP_010453963.1|  PREDICTED: protein PMR5-like                       150   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003545134.1|  PREDICTED: protein YLS7-like                       149   4e-39   Glycine max [soybeans]
ref|XP_011005473.1|  PREDICTED: protein trichome birefringence-li...    149   4e-39   Populus euphratica
ref|XP_003542986.1|  PREDICTED: protein YLS7-like isoform X1            150   4e-39   Glycine max [soybeans]
gb|KJB08986.1|  hypothetical protein B456_001G116900                    150   4e-39   Gossypium raimondii
ref|XP_010483461.1|  PREDICTED: protein PMR5-like                       150   4e-39   Camelina sativa [gold-of-pleasure]
gb|KHN40085.1|  hypothetical protein glysoja_009462                     150   4e-39   Glycine soja [wild soybean]
ref|XP_009339559.1|  PREDICTED: protein trichome birefringence-li...    149   4e-39   Pyrus x bretschneideri [bai li]
gb|KHN21700.1|  hypothetical protein glysoja_050079                     147   4e-39   Glycine soja [wild soybean]
ref|XP_006594557.1|  PREDICTED: protein YLS7-like isoform X2            150   5e-39   Glycine max [soybeans]
ref|XP_010685528.1|  PREDICTED: protein PMR5-like                       150   5e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009380697.1|  PREDICTED: protein PMR5 isoform X4                 149   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004149051.1|  PREDICTED: uncharacterized protein LOC101203509    149   5e-39   Cucumis sativus [cucumbers]
ref|XP_010443601.1|  PREDICTED: protein PMR5                            150   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006477896.1|  PREDICTED: protein YLS7-like                       149   6e-39   
gb|KEH39261.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    149   6e-39   Medicago truncatula
gb|KHN19645.1|  hypothetical protein glysoja_042542                     147   6e-39   Glycine soja [wild soybean]
ref|XP_010259297.1|  PREDICTED: protein trichome birefringence-li...    151   7e-39   Nelumbo nucifera [Indian lotus]
ref|NP_001058264.1|  Os06g0659400                                       150   7e-39   
ref|XP_009784314.1|  PREDICTED: protein trichome birefringence-li...    149   7e-39   Nicotiana sylvestris
ref|XP_010272740.1|  PREDICTED: protein trichome birefringence-li...    149   7e-39   Nelumbo nucifera [Indian lotus]
gb|ACU18958.1|  unknown                                                 148   8e-39   Glycine max [soybeans]
ref|XP_008221187.1|  PREDICTED: protein PMR5                            149   9e-39   Prunus mume [ume]
ref|XP_010035884.1|  PREDICTED: protein trichome birefringence-li...    149   9e-39   Eucalyptus grandis [rose gum]
ref|XP_004489870.1|  PREDICTED: uncharacterized protein LOC101510652    148   9e-39   Cicer arietinum [garbanzo]
ref|XP_006280567.1|  hypothetical protein CARUB_v10026519mg             149   9e-39   Capsella rubella
gb|ABA29157.1|  unknown                                                 149   1e-38   Pisum sativum [garden pea]
ref|XP_004296154.1|  PREDICTED: protein trichome birefringence-li...    150   1e-38   Fragaria vesca subsp. vesca
gb|KHN09214.1|  hypothetical protein glysoja_036442                     146   1e-38   Glycine soja [wild soybean]
ref|XP_011002532.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Populus euphratica
ref|XP_006849537.1|  hypothetical protein AMTR_s00024p00162030          152   1e-38   
ref|XP_003544889.2|  PREDICTED: protein YLS7-like                       150   1e-38   
ref|XP_010272739.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008229144.1|  PREDICTED: protein trichome birefringence-li...    150   1e-38   
gb|KJB68384.1|  hypothetical protein B456_010G242200                    148   2e-38   Gossypium raimondii
gb|KDO63324.1|  hypothetical protein CISIN_1g017063mg                   148   2e-38   Citrus sinensis [apfelsine]
ref|XP_002325581.2|  hypothetical protein POPTR_0019s11990g             148   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008363351.1|  PREDICTED: protein trichome birefringence-li...    150   2e-38   
ref|XP_008229347.1|  PREDICTED: protein trichome birefringence-like     152   2e-38   
ref|XP_003551303.1|  PREDICTED: protein YLS7-like                       145   2e-38   
ref|XP_007016071.1|  Uncharacterized protein TCM_041593                 148   2e-38   
emb|CDY30832.1|  BnaC05g22080D                                          148   2e-38   Brassica napus [oilseed rape]
ref|XP_004301795.1|  PREDICTED: protein trichome birefringence-li...    150   2e-38   Fragaria vesca subsp. vesca
gb|AGV54877.1|  hypothetical protein                                    146   2e-38   Phaseolus vulgaris [French bean]
ref|XP_006301170.1|  hypothetical protein CARUB_v10021567mg             147   2e-38   Capsella rubella
ref|XP_007207333.1|  hypothetical protein PRUPE_ppa006874mg             148   2e-38   Prunus persica
ref|XP_010052537.1|  PREDICTED: protein trichome birefringence-li...    147   2e-38   Eucalyptus grandis [rose gum]
ref|XP_006444502.1|  hypothetical protein CICLE_v100200871mg            148   2e-38   
ref|XP_009787170.1|  PREDICTED: protein trichome birefringence-li...    147   2e-38   Nicotiana sylvestris
ref|XP_006492340.1|  PREDICTED: protein YLS7-like                       150   2e-38   Citrus sinensis [apfelsine]
emb|CBI15933.3|  unnamed protein product                                146   2e-38   Vitis vinifera
ref|XP_008352661.1|  PREDICTED: protein trichome birefringence-li...    150   2e-38   
ref|XP_010679388.1|  PREDICTED: protein trichome birefringence-li...    150   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004487169.1|  PREDICTED: uncharacterized protein LOC101503983    147   3e-38   Cicer arietinum [garbanzo]
ref|XP_006469036.1|  PREDICTED: protein YLS7-like                       147   3e-38   Citrus sinensis [apfelsine]
ref|XP_010921490.1|  PREDICTED: protein trichome birefringence-li...    150   3e-38   Elaeis guineensis
ref|XP_006344054.1|  PREDICTED: uncharacterized protein LOC102598924    148   3e-38   Solanum tuberosum [potatoes]
ref|XP_008342760.1|  PREDICTED: protein trichome birefringence-li...    144   3e-38   
ref|XP_010038289.1|  PREDICTED: protein trichome birefringence-li...    149   3e-38   Eucalyptus grandis [rose gum]
ref|XP_003552076.2|  PREDICTED: protein YLS7-like                       147   3e-38   
ref|XP_006446762.1|  hypothetical protein CICLE_v10015634mg             147   3e-38   Citrus clementina [clementine]
ref|XP_009395765.1|  PREDICTED: protein trichome birefringence-li...    149   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008385046.1|  PREDICTED: protein PMR5-like                       143   3e-38   
ref|XP_003607565.1|  hypothetical protein MTR_4g079700                  147   3e-38   Medicago truncatula
ref|XP_007207689.1|  hypothetical protein PRUPE_ppa023743mg             149   3e-38   
ref|XP_008443074.1|  PREDICTED: protein trichome birefringence-li...    148   4e-38   Cucumis melo [Oriental melon]
ref|XP_006348847.1|  PREDICTED: uncharacterized protein LOC102593679    147   4e-38   Solanum tuberosum [potatoes]
ref|XP_002862622.1|  hypothetical protein ARALYDRAFT_333274             147   4e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_008342494.1|  PREDICTED: protein trichome birefringence-li...    147   4e-38   
ref|XP_010273483.1|  PREDICTED: protein trichome birefringence-li...    147   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_003551258.1|  PREDICTED: protein YLS7-like                       147   4e-38   Glycine max [soybeans]
ref|XP_007201163.1|  hypothetical protein PRUPE_ppa004056mg             149   4e-38   Prunus persica
gb|KHN02079.1|  hypothetical protein glysoja_028282                     147   4e-38   Glycine soja [wild soybean]
ref|XP_004228795.2|  PREDICTED: protein trichome birefringence-like     147   5e-38   
ref|XP_010035886.1|  PREDICTED: protein trichome birefringence-li...    147   5e-38   Eucalyptus grandis [rose gum]
ref|XP_004243406.1|  PREDICTED: protein trichome birefringence-li...    146   5e-38   Solanum lycopersicum
ref|XP_002298483.2|  hypothetical protein POPTR_0001s28490g             147   5e-38   
ref|XP_010264606.1|  PREDICTED: protein PMR5-like                       147   5e-38   Nelumbo nucifera [Indian lotus]
emb|CDX94643.1|  BnaC07g10150D                                          147   5e-38   
ref|XP_009102887.1|  PREDICTED: protein trichome birefringence-li...    147   6e-38   Brassica rapa
ref|XP_006582288.1|  PREDICTED: protein YLS7-like                       146   6e-38   Glycine max [soybeans]
ref|XP_003539337.1|  PREDICTED: protein YLS7-like                       147   6e-38   Glycine max [soybeans]
gb|ABA29158.1|  unknown                                                 146   6e-38   Pisum sativum [garden pea]
ref|XP_009769000.1|  PREDICTED: protein trichome birefringence-li...    146   6e-38   Nicotiana sylvestris
ref|XP_009123178.1|  PREDICTED: protein trichome birefringence-li...    147   6e-38   Brassica rapa
ref|XP_010486896.1|  PREDICTED: protein trichome birefringence-li...    149   6e-38   Camelina sativa [gold-of-pleasure]
ref|XP_003551901.1|  PREDICTED: protein YLS7-like                       146   6e-38   Glycine max [soybeans]
ref|XP_009386636.1|  PREDICTED: protein trichome birefringence-li...    147   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348409.1|  PREDICTED: protein trichome birefringence-li...    146   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_008360191.1|  PREDICTED: protein trichome birefringence-li...    149   6e-38   
ref|NP_001241538.1|  uncharacterized protein LOC100786668 precursor     146   6e-38   Glycine max [soybeans]
gb|KHN19842.1|  hypothetical protein glysoja_043771                     147   6e-38   Glycine soja [wild soybean]
ref|XP_008778408.1|  PREDICTED: protein trichome birefringence-li...    148   7e-38   Phoenix dactylifera
ref|XP_007142193.1|  hypothetical protein PHAVU_008G260000g             147   7e-38   Phaseolus vulgaris [French bean]
gb|KDP45792.1|  hypothetical protein JCGZ_17399                         146   7e-38   Jatropha curcas
ref|XP_004485883.1|  PREDICTED: uncharacterized protein LOC101498973    146   7e-38   Cicer arietinum [garbanzo]
ref|XP_007148060.1|  hypothetical protein PHAVU_006G177100g             146   7e-38   Phaseolus vulgaris [French bean]
ref|XP_009593637.1|  PREDICTED: protein trichome birefringence-li...    146   7e-38   Nicotiana tomentosiformis
ref|XP_007149752.1|  hypothetical protein PHAVU_005G096200g             146   8e-38   Phaseolus vulgaris [French bean]
gb|KDP31782.1|  hypothetical protein JCGZ_12243                         146   9e-38   Jatropha curcas
ref|XP_007204980.1|  hypothetical protein PRUPE_ppa003027mg             149   9e-38   Prunus persica
ref|XP_006364115.1|  PREDICTED: uncharacterized protein LOC102591526    142   9e-38   
ref|XP_006376352.1|  hypothetical protein POPTR_0013s12290g             146   9e-38   
ref|XP_006657213.1|  PREDICTED: protein YLS7-like                       146   9e-38   
ref|XP_009386635.1|  PREDICTED: protein trichome birefringence-li...    148   1e-37   
ref|XP_009591836.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   
ref|XP_004303168.1|  PREDICTED: protein trichome birefringence-li...    146   1e-37   
ref|NP_565779.1|  trichome birefringence-like 37 protein                146   1e-37   
ref|XP_008381177.1|  PREDICTED: protein trichome birefringence-li...    144   1e-37   
ref|XP_011100405.1|  PREDICTED: protein trichome birefringence-li...    146   1e-37   
ref|XP_002516811.1|  conserved hypothetical protein                     145   1e-37   
ref|XP_010932482.1|  PREDICTED: protein trichome birefringence-li...    149   1e-37   
ref|XP_009391441.1|  PREDICTED: protein trichome birefringence-like     149   1e-37   
gb|EYU43352.1|  hypothetical protein MIMGU_mgv1a017695mg                145   1e-37   
ref|XP_006602443.1|  PREDICTED: protein YLS7-like                       145   1e-37   
ref|XP_010509796.1|  PREDICTED: protein trichome birefringence-li...    146   1e-37   
ref|XP_002521169.1|  conserved hypothetical protein                     144   1e-37   
ref|XP_007153710.1|  hypothetical protein PHAVU_003G058400g             145   1e-37   
gb|AAC20724.1|  hypothetical protein                                    145   1e-37   
ref|XP_009365268.1|  PREDICTED: protein trichome birefringence-li...    146   1e-37   
ref|XP_009357163.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   
ref|XP_008810174.1|  PREDICTED: protein trichome birefringence-li...    147   1e-37   
ref|XP_004164982.1|  PREDICTED: uncharacterized LOC101220002            146   1e-37   
ref|XP_002277229.1|  PREDICTED: protein PMR5                            146   1e-37   
ref|XP_006367779.1|  PREDICTED: uncharacterized protein LOC102593572    142   1e-37   
ref|NP_180647.2|  protein TRICHOME BIREFRINGENCE-LIKE 43                145   1e-37   
ref|XP_011082791.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   
ref|XP_010513188.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   
ref|XP_010046898.1|  PREDICTED: protein trichome birefringence-li...    147   1e-37   
ref|XP_008439751.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   
ref|XP_002526381.1|  conserved hypothetical protein                     146   1e-37   
ref|XP_008466999.1|  PREDICTED: protein trichome birefringence-li...    140   2e-37   
ref|XP_011044588.1|  PREDICTED: protein trichome birefringence-li...    145   2e-37   
ref|XP_004140246.1|  PREDICTED: uncharacterized protein LOC101219162    144   2e-37   
ref|XP_010277751.1|  PREDICTED: protein trichome birefringence-li...    146   2e-37   
ref|XP_009352799.1|  PREDICTED: protein trichome birefringence-li...    145   2e-37   
ref|XP_006294394.1|  hypothetical protein CARUB_v10023411mg             145   2e-37   
ref|XP_009783417.1|  PREDICTED: protein trichome birefringence-li...    147   2e-37   
ref|XP_010070349.1|  PREDICTED: protein trichome birefringence-li...    145   2e-37   
gb|AFK40281.1|  unknown                                                 145   2e-37   
ref|XP_007050058.1|  Trichome birefringence-like 39                     145   2e-37   
gb|EPS73377.1|  hypothetical protein M569_01379                         144   2e-37   
ref|XP_003615710.1|  hypothetical protein MTR_5g071350                  145   2e-37   
gb|KCW89619.1|  hypothetical protein EUGRSUZ_A01902                     145   2e-37   
ref|XP_011086013.1|  PREDICTED: protein trichome birefringence-li...    144   2e-37   
emb|CDP15911.1|  unnamed protein product                                145   2e-37   
ref|XP_002437399.1|  hypothetical protein SORBIDRAFT_10g026240          147   2e-37   
gb|KJB35225.1|  hypothetical protein B456_006G105300                    145   2e-37   
gb|AES90337.2|  trichome birefringence-like protein                     144   2e-37   
gb|KGN47983.1|  hypothetical protein Csa_6G421770                       144   2e-37   
ref|XP_004497358.1|  PREDICTED: uncharacterized protein LOC101512304    147   2e-37   
ref|XP_003625972.1|  hypothetical protein MTR_7g109550                  146   2e-37   
ref|XP_004240405.1|  PREDICTED: protein PMR5                            146   2e-37   
ref|XP_009587467.1|  PREDICTED: protein trichome birefringence-like     147   2e-37   
gb|KFK27389.1|  hypothetical protein AALP_AA8G376300                    145   3e-37   
ref|XP_006852467.1|  hypothetical protein AMTR_s00021p00122990          146   3e-37   
ref|XP_003543309.1|  PREDICTED: protein YLS7                            145   3e-37   
ref|XP_009370960.1|  PREDICTED: protein trichome birefringence-li...    144   3e-37   
ref|XP_009353878.1|  PREDICTED: protein PMR5-like                       145   3e-37   
ref|XP_008381569.1|  PREDICTED: protein trichome birefringence-li...    145   3e-37   
ref|XP_003553667.1|  PREDICTED: protein YLS7-like                       146   3e-37   
ref|XP_004505135.1|  PREDICTED: uncharacterized protein LOC101503421    144   3e-37   
gb|KJB73054.1|  hypothetical protein B456_011G212300                    147   3e-37   
gb|KDO66930.1|  hypothetical protein CISIN_1g016108mg                   143   3e-37   
ref|XP_009378728.1|  PREDICTED: protein trichome birefringence-li...    145   3e-37   
ref|XP_009354247.1|  PREDICTED: protein trichome birefringence-li...    144   3e-37   
ref|XP_007146779.1|  hypothetical protein PHAVU_006G069200g             145   3e-37   
ref|XP_010464957.1|  PREDICTED: protein trichome birefringence-li...    147   3e-37   
ref|XP_009338946.1|  PREDICTED: protein PMR5-like                       145   3e-37   
ref|XP_007216935.1|  hypothetical protein PRUPE_ppa016438mg             140   3e-37   
gb|EYU41140.1|  hypothetical protein MIMGU_mgv1a008520mg                144   3e-37   
ref|XP_004134666.1|  PREDICTED: uncharacterized protein LOC101216213    144   3e-37   
ref|NP_001049898.2|  Os03g0307700                                       147   4e-37   
emb|CDX84181.1|  BnaC04g09430D                                          144   4e-37   
ref|XP_009376704.1|  PREDICTED: protein trichome birefringence-li...    147   4e-37   
gb|EMT12175.1|  hypothetical protein F775_08902                         145   4e-37   
ref|XP_007011182.1|  Uncharacterized protein isoform 1                  147   4e-37   
ref|XP_004152223.1|  PREDICTED: uncharacterized protein LOC101220002    146   4e-37   
ref|XP_010473941.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   
emb|CDY17220.1|  BnaA05g09680D                                          144   4e-37   
ref|XP_010469399.1|  PREDICTED: protein trichome birefringence-li...    144   5e-37   
ref|XP_010413780.1|  PREDICTED: protein trichome birefringence-li...    144   5e-37   
ref|XP_008449501.1|  PREDICTED: protein trichome birefringence-li...    144   5e-37   
gb|AFK44929.1|  unknown                                                 146   5e-37   
ref|XP_009410826.1|  PREDICTED: protein trichome birefringence-li...    144   5e-37   
gb|KHN36688.1|  hypothetical protein glysoja_001419                     144   5e-37   
gb|KFK38572.1|  hypothetical protein AALP_AA3G130900                    146   5e-37   
ref|XP_010498482.1|  PREDICTED: protein trichome birefringence-li...    146   5e-37   
ref|XP_010549391.1|  PREDICTED: protein trichome birefringence-li...    144   5e-37   
ref|XP_002866280.1|  hypothetical protein ARALYDRAFT_495984             144   5e-37   
gb|KJB33252.1|  hypothetical protein B456_006G004100                    143   5e-37   
ref|XP_006299462.1|  hypothetical protein CARUB_v10015627mg             146   6e-37   
ref|XP_011464795.1|  PREDICTED: protein trichome birefringence-li...    144   6e-37   
gb|AES97753.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    145   6e-37   
ref|XP_004305820.2|  PREDICTED: protein trichome birefringence-li...    143   7e-37   
gb|EYU26676.1|  hypothetical protein MIMGU_mgv1a006839mg                144   7e-37   
ref|XP_009781572.1|  PREDICTED: protein trichome birefringence-li...    144   7e-37   
ref|XP_008345228.1|  PREDICTED: protein trichome birefringence-li...    143   7e-37   
ref|XP_009604954.1|  PREDICTED: protein trichome birefringence-li...    145   8e-37   
ref|XP_006843604.1|  hypothetical protein AMTR_s00007p00137180          143   9e-37   
ref|XP_010413281.1|  PREDICTED: protein trichome birefringence-li...    145   9e-37   
ref|XP_002283620.1|  PREDICTED: protein trichome birefringence-li...    142   9e-37   
gb|EAZ01954.1|  hypothetical protein OsI_23985                          145   9e-37   
ref|XP_009354272.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   
ref|XP_008354275.1|  PREDICTED: protein PMR5-like                       144   1e-36   
ref|XP_008343824.1|  PREDICTED: protein PMR5-like                       144   1e-36   
ref|XP_010544965.1|  PREDICTED: protein trichome birefringence-li...    145   1e-36   
ref|XP_002878459.1|  hypothetical protein ARALYDRAFT_486743             145   1e-36   
ref|XP_002862720.1|  hypothetical protein ARALYDRAFT_497319             145   1e-36   
ref|XP_010512629.1|  PREDICTED: protein trichome birefringence-li...    145   1e-36   
ref|XP_008381176.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   
ref|XP_004984615.1|  PREDICTED: uncharacterized protein LOC101785375    146   1e-36   
ref|XP_006358930.1|  PREDICTED: uncharacterized protein LOC102599643    140   1e-36   
ref|XP_002276383.1|  PREDICTED: protein trichome birefringence-li...    144   1e-36   
ref|XP_010468959.1|  PREDICTED: protein trichome birefringence-li...    145   1e-36   
ref|XP_006357865.1|  PREDICTED: uncharacterized protein LOC102596807    146   1e-36   
ref|XP_009125778.1|  PREDICTED: protein trichome birefringence-like     145   1e-36   
emb|CDX79555.1|  BnaC03g18910D                                          143   1e-36   
ref|XP_003518885.1|  PREDICTED: protein YLS7-like                       143   1e-36   
emb|CDX84658.1|  BnaA03g15720D                                          143   1e-36   
ref|XP_008789200.1|  PREDICTED: protein trichome birefringence          146   1e-36   
ref|XP_009132974.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   
ref|XP_003561699.1|  PREDICTED: protein trichome birefringence-li...    145   1e-36   
gb|KHN32337.1|  hypothetical protein glysoja_032520                     143   1e-36   
ref|XP_008361466.1|  PREDICTED: protein trichome birefringence-li...    145   1e-36   
ref|XP_002285609.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   
ref|XP_008345148.1|  PREDICTED: protein trichome birefringence-li...    142   1e-36   
ref|NP_191798.1|  protein trichome birefringence-like 6                 144   1e-36   
emb|CDY64767.1|  BnaCnng44810D                                          143   1e-36   
ref|XP_009143811.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   
ref|XP_009396650.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   
emb|CDY05000.1|  BnaAnng01820D                                          145   1e-36   
gb|AAP22494.1|  hypothetical protein At2g30900                          142   1e-36   
ref|XP_010060752.1|  PREDICTED: protein trichome birefringence-li...    140   1e-36   
ref|XP_008371453.1|  PREDICTED: protein trichome birefringence-li...    142   1e-36   
ref|XP_010414204.1|  PREDICTED: protein trichome birefringence-li...    142   1e-36   
emb|CDY17219.1|  BnaA05g09690D                                          143   1e-36   
ref|XP_008454494.1|  PREDICTED: protein trichome birefringence-li...    144   2e-36   
gb|KDO66926.1|  hypothetical protein CISIN_1g016108mg                   143   2e-36   
ref|XP_006425092.1|  hypothetical protein CICLE_v10028623mg             143   2e-36   
ref|XP_006488549.1|  PREDICTED: protein YLS7-like                       143   2e-36   
ref|XP_004229386.1|  PREDICTED: protein trichome birefringence-li...    144   2e-36   
ref|XP_009120375.1|  PREDICTED: protein PMR5                            143   2e-36   
ref|XP_004149371.1|  PREDICTED: uncharacterized protein LOC101205461    142   2e-36   
ref|XP_004140241.1|  PREDICTED: uncharacterized protein LOC101217736    143   2e-36   
ref|XP_009384432.1|  PREDICTED: protein trichome birefringence-li...    144   2e-36   
gb|AAM62736.1|  unknown                                                 143   2e-36   
emb|CDP17066.1|  unnamed protein product                                144   2e-36   
gb|KHG14015.1|  CAS1 domain-containing 1                                144   2e-36   
ref|XP_008363352.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   
emb|CAN82331.1|  hypothetical protein VITISV_007322                     142   2e-36   
ref|NP_200668.1|  protein POWDERY MILDEW RESISTANT 5                    143   2e-36   
ref|XP_009141359.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   
dbj|BAE98654.1|  hypothetical protein                                   141   2e-36   
ref|XP_004232960.1|  PREDICTED: protein trichome birefringence-li...    143   2e-36   
dbj|BAK07580.1|  predicted protein                                      145   2e-36   
ref|XP_008383643.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   
ref|XP_002882764.1|  predicted protein                                  144   2e-36   
ref|XP_010265940.1|  PREDICTED: protein trichome birefringence-like     144   2e-36   
ref|XP_009143809.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   
ref|XP_003552077.1|  PREDICTED: protein YLS7-like                       142   2e-36   
ref|XP_006576076.1|  PREDICTED: protein YLS7-like                       139   2e-36   
emb|CDX76633.1|  BnaC08g32190D                                          144   2e-36   
emb|CDX79269.1|  BnaC06g20340D                                          142   2e-36   
ref|XP_004242518.1|  PREDICTED: protein PMR5                            142   3e-36   
ref|XP_006350844.1|  PREDICTED: uncharacterized protein LOC102591356    142   3e-36   
ref|XP_004234094.1|  PREDICTED: protein trichome birefringence-li...    142   3e-36   
ref|XP_009384431.1|  PREDICTED: protein trichome birefringence-li...    144   3e-36   
ref|XP_010665974.1|  PREDICTED: protein trichome birefringence-li...    142   3e-36   
ref|XP_010915618.1|  PREDICTED: protein trichome birefringence-li...    142   3e-36   
ref|XP_010687461.1|  PREDICTED: protein trichome birefringence-li...    143   3e-36   
ref|XP_010652247.1|  PREDICTED: protein trichome birefringence-li...    144   3e-36   
ref|XP_009394684.1|  PREDICTED: protein trichome birefringence-li...    143   3e-36   
ref|XP_010060751.1|  PREDICTED: protein trichome birefringence-li...    140   3e-36   
ref|XP_002283611.1|  PREDICTED: protein trichome birefringence-li...    141   3e-36   
ref|XP_008783904.1|  PREDICTED: protein trichome birefringence-li...    142   3e-36   
ref|XP_009378730.1|  PREDICTED: protein trichome birefringence-li...    144   3e-36   
emb|CBW30214.1|  Conserved hypothetical protein                         143   4e-36   
ref|XP_010032986.1|  PREDICTED: protein trichome birefringence-li...    142   4e-36   
ref|XP_009364158.1|  PREDICTED: protein trichome birefringence-li...    144   4e-36   
emb|CDY40499.1|  BnaC09g14570D                                          143   4e-36   
ref|XP_009104567.1|  PREDICTED: protein trichome birefringence-li...    141   4e-36   
ref|XP_006442366.1|  hypothetical protein CICLE_v10024135mg             142   4e-36   
ref|XP_010087235.1|  hypothetical protein L484_009744                   143   4e-36   
emb|CDY08459.1|  BnaA05g26950D                                          144   4e-36   
ref|XP_006401062.1|  hypothetical protein EUTSA_v10013734mg             142   4e-36   
ref|XP_009113182.1|  PREDICTED: protein trichome birefringence-li...    143   4e-36   
gb|AAM67355.1|  unknown                                                 140   4e-36   
ref|XP_011020096.1|  PREDICTED: protein trichome birefringence-li...    143   4e-36   
gb|KHG04354.1|  CAS1 domain-containing 1                                143   5e-36   
ref|XP_010417475.1|  PREDICTED: protein trichome birefringence-li...    141   5e-36   
ref|XP_007154672.1|  hypothetical protein PHAVU_003G138100g             142   5e-36   
ref|XP_008369108.1|  PREDICTED: protein trichome birefringence-li...    143   5e-36   
ref|XP_010917266.1|  PREDICTED: protein trichome birefringence          144   5e-36   
ref|XP_010472706.1|  PREDICTED: protein trichome birefringence-li...    141   5e-36   
ref|XP_009783488.1|  PREDICTED: protein trichome birefringence-li...    143   5e-36   
ref|XP_008449392.1|  PREDICTED: protein trichome birefringence-li...    142   5e-36   
gb|KCW52496.1|  hypothetical protein EUGRSUZ_J01893                     141   5e-36   
ref|XP_010273481.1|  PREDICTED: protein trichome birefringence-li...    141   6e-36   
ref|XP_004294299.1|  PREDICTED: protein PMR5-like                       141   6e-36   
ref|XP_008781812.1|  PREDICTED: protein trichome birefringence-li...    143   6e-36   
ref|XP_009378729.1|  PREDICTED: protein trichome birefringence-li...    142   6e-36   
ref|XP_006294476.1|  hypothetical protein CARUB_v10023492mg             141   6e-36   
ref|XP_009590824.1|  PREDICTED: protein trichome birefringence-li...    141   6e-36   
ref|XP_009790075.1|  PREDICTED: protein trichome birefringence-li...    141   6e-36   
ref|XP_007051109.1|  Trichome birefringence-like 6                      143   6e-36   
ref|XP_006348399.1|  PREDICTED: uncharacterized protein LOC102583199    141   6e-36   
ref|XP_010429700.1|  PREDICTED: protein trichome birefringence-li...    140   6e-36   
gb|KHN19212.1|  hypothetical protein glysoja_041564                     141   7e-36   
ref|XP_009590818.1|  PREDICTED: protein trichome birefringence-li...    141   7e-36   
ref|XP_007222250.1|  hypothetical protein PRUPE_ppa004735mg             142   7e-36   
ref|XP_002317442.1|  hypothetical protein POPTR_0011s10730g             141   7e-36   
ref|XP_002308095.2|  hypothetical protein POPTR_0006s07090g             142   7e-36   
ref|XP_004494426.1|  PREDICTED: uncharacterized protein LOC101501...    142   7e-36   
ref|XP_008660213.1|  PREDICTED: protein trichome birefringence-li...    144   7e-36   
ref|XP_009146650.1|  PREDICTED: protein trichome birefringence-li...    143   7e-36   
ref|XP_010535369.1|  PREDICTED: protein PMR5                            141   7e-36   
ref|XP_008781112.1|  PREDICTED: protein trichome birefringence-li...    143   7e-36   
emb|CDY69617.1|  BnaA09g53160D                                          143   7e-36   
ref|XP_007048774.1|  Trichome birefringence-like 43 isoform 2           139   8e-36   
ref|XP_006576523.1|  PREDICTED: protein YLS7-like                       142   8e-36   
ref|XP_008223825.1|  PREDICTED: protein trichome birefringence-li...    142   8e-36   



>ref|XP_009587659.1| PREDICTED: protein trichome birefringence-like 36 [Nicotiana 
tomentosiformis]
Length=374

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENA+YWRG+DVLVFDSAHWWTHS   SSWD IMEG +F+R MNPMVAYEKGLMTWA
Sbjct  192  DMIEENAKYWRGADVLVFDSAHWWTHSDKYSSWDLIMEGNSFYRNMNPMVAYEKGLMTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RVFFRSMSP+HNRENGWKCFN+REPLE FS P VP+ L+VLK+VLRRM
Sbjct  252  KWVDLNLDPRKTRVFFRSMSPRHNRENGWKCFNQREPLEFFSHPHVPEPLLVLKEVLRRM  311

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPV  QDI+TM+A RRD HPSVY K V Q +KQHL  YKSDCSHWCLPGVPD WNEMLN
Sbjct  312  SFPVSFQDITTMTALRRDGHPSVYSKFVSQTDKQHLGDYKSDCSHWCLPGVPDTWNEMLN  371

Query  161  AM  156
            AM
Sbjct  372  AM  373



>ref|XP_009803690.1| PREDICTED: protein trichome birefringence-like 36 [Nicotiana 
sylvestris]
Length=374

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENA+YWRG+DVLVFDSAHWWTHS   SSWD +MEG +F+R MNPMVAYEKGLMTWA
Sbjct  192  DMIEENAKYWRGADVLVFDSAHWWTHSDKYSSWDLVMEGNSFYRNMNPMVAYEKGLMTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RVFFRSMSP+HNRENGWKCFN+REPLE FS P VP+ L+VLK+VLRRM
Sbjct  252  KWVDLNLDPRKTRVFFRSMSPRHNRENGWKCFNQREPLEFFSHPHVPEPLLVLKEVLRRM  311

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPV  QDI+TM+A RRD HPSVY K V Q  KQHL  YKSDCSHWCLPGVPD WNEMLN
Sbjct  312  SFPVSFQDITTMTALRRDGHPSVYSKFVSQTGKQHLGDYKSDCSHWCLPGVPDTWNEMLN  371

Query  161  AM  156
            AM
Sbjct  372  AM  373



>ref|XP_004249967.1| PREDICTED: protein trichome birefringence-like 36 [Solanum lycopersicum]
Length=378

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENA+YWRG+DVLVFDSAHWWTHS   SSWD IMEG +F+R MNPMVAYEKGLMTWA
Sbjct  196  DMIEENAKYWRGADVLVFDSAHWWTHSDKYSSWDLIMEGNSFYRNMNPMVAYEKGLMTWA  255

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RVFFRSMSP+HNRENGWKCFN+REPLE FS P VP+ L+VLK+VLR M
Sbjct  256  KWVDLNLDPRKTRVFFRSMSPRHNRENGWKCFNQREPLEFFSHPHVPEPLLVLKEVLRGM  315

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPV  QDI+TM+A RRD HPSVY K V Q  KQHL  YKSDCSHWCLPGVPD WNEMLN
Sbjct  316  SFPVSFQDITTMTALRRDGHPSVYSKFVSQTGKQHLGDYKSDCSHWCLPGVPDTWNEMLN  375

Query  161  AM  156
             M
Sbjct  376  VM  377



>ref|XP_006361471.1| PREDICTED: uncharacterized protein LOC102605360 [Solanum tuberosum]
Length=378

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENA+YWRG+DVLVFDSAHWWTHS   SSWD IMEG +F+R MNPMVAYEKGLMTWA
Sbjct  196  DMIEENAKYWRGADVLVFDSAHWWTHSDKYSSWDLIMEGNSFYRNMNPMVAYEKGLMTWA  255

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPRK+RVFFRSMSP+HNRENGWKCFN+REPLE FS P VP+ L+VLK+VLR M
Sbjct  256  KWIDLNLDPRKTRVFFRSMSPRHNRENGWKCFNQREPLEFFSHPHVPEPLLVLKEVLRGM  315

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPV  QDI+T++A RRD HPSVY K V Q  KQHL  YKSDCSHWCLPGVPD WNEMLN
Sbjct  316  SFPVSFQDITTLTALRRDGHPSVYSKFVSQTGKQHLGDYKSDCSHWCLPGVPDTWNEMLN  375

Query  161  AM  156
             M
Sbjct  376  VM  377



>emb|CDO99906.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWD++ +G N +  MNPMVAYEKGL TWA
Sbjct  201  DLIEENAKYWRGVDVLVFDSAHWWTHSDQYSSWDFLADGNNAYTTMNPMVAYEKGLTTWA  260

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPR+SRVFFRSMSP+HNR+NGWKC+N++EPL++FS P VP QL VL+ VLRRM
Sbjct  261  KWIDLNLDPRRSRVFFRSMSPRHNRDNGWKCYNQKEPLQYFSHPHVPPQLPVLRGVLRRM  320

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+T+SA RRD HPSVYG+ +GQEEKQH++GY SDCSHWCLPGVPD WNEMLN
Sbjct  321  RFPVYLQDITTLSALRRDGHPSVYGRSIGQEEKQHVKGYTSDCSHWCLPGVPDTWNEMLN  380

Query  161  AM  156
             +
Sbjct  381  VL  382



>ref|XP_004308558.2| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011469319.1| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011469320.1| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Fragaria vesca subsp. vesca]
Length=384

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWDY MEG + F  MNPMVAY+KGL TWA
Sbjct  202  DLIEENAKYWRGVDVLVFDSAHWWTHSDKTSSWDYYMEGKSLFTSMNPMVAYQKGLTTWA  261

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSMSP+HNRENGW+C+N+++PL +FS   VP+ L+VL+ VLR+M
Sbjct  262  KWVDLNLDPRKTRVIFRSMSPRHNRENGWRCYNQKQPLANFSHQHVPEPLLVLQGVLRKM  321

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+T+SAFRRD HPSVY + +GQEEKQHLR Y SDCSHWCLPGVPDIWNEML+
Sbjct  322  RFPVYLQDITTISAFRRDGHPSVYRRAMGQEEKQHLREYSSDCSHWCLPGVPDIWNEMLS  381

Query  161  AM  156
            A+
Sbjct  382  AL  383



>ref|XP_008375566.1| PREDICTED: protein trichome birefringence-like 36 [Malus domestica]
Length=379

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG+DVLVFDSAHWWTHS   SSWDY MEG + +  +NPMVAY+KGL TWA
Sbjct  197  DLIEENAKYWRGADVLVFDSAHWWTHSDKSSSWDYYMEGHSLYTNINPMVAYQKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPRK+RV FRSMSP+HNRENGW+C+N+++PL +FS   VP+ L+VL+ VLR M
Sbjct  257  KWIDLNLDPRKTRVIFRSMSPRHNRENGWRCYNQKQPLAYFSHQHVPEPLIVLQTVLRNM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TMSAFRRD HPSVY + +GQEEKQH  G  SDCSHWCLPGVPD WNEMLN
Sbjct  317  RFPVYLQDITTMSAFRRDGHPSVYRRAMGQEEKQHPXGLSSDCSHWCLPGVPDSWNEMLN  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>ref|XP_009356126.1| PREDICTED: protein trichome birefringence-like 36 [Pyrus x bretschneideri]
Length=379

 Score =   279 bits (714),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWDY MEG + +  MNPMVAY+KGL TWA
Sbjct  197  DLIEENAKYWRGVDVLVFDSAHWWTHSDKSSSWDYYMEGQSLYTNMNPMVAYQKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPRK+RV FRSMSP+HNR+NGW+C+N+++PL +FS   VP+ L+VL+ VLR M
Sbjct  257  KWIDLNLDPRKTRVIFRSMSPRHNRQNGWRCYNQKQPLAYFSHQHVPEPLIVLQTVLRNM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TMSAFRRD HPSVY + +GQEE+QH RG  SDCSHWCLPGVPD WNEML+
Sbjct  317  RFPVYLQDITTMSAFRRDGHPSVYRRAMGQEERQHPRGLSSDCSHWCLPGVPDSWNEMLS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>ref|XP_007211438.1| hypothetical protein PRUPE_ppa007187mg [Prunus persica]
 gb|EMJ12637.1| hypothetical protein PRUPE_ppa007187mg [Prunus persica]
Length=379

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWDY MEG + +  MNPMVAY+KGL TWA
Sbjct  197  DLIEENAKYWRGVDVLVFDSAHWWTHSDQSSSWDYYMEGHSLYTNMNPMVAYQKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSMSP+HNRENGW+C+N+++PL +FS   VP+ L+VL+ VLR+M
Sbjct  257  KWVDLNLDPRKTRVIFRSMSPRHNRENGWRCYNQKQPLAYFSHQHVPEPLLVLQGVLRKM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TMSAFRRD HPSVY + +GQEE+QH R + SDCSHWCLPGVPD WNE+L+
Sbjct  317  RFPVYLQDITTMSAFRRDGHPSVYRRAMGQEERQHPRDFSSDCSHWCLPGVPDSWNEILS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>ref|XP_008231948.1| PREDICTED: protein trichome birefringence-like 36 [Prunus mume]
Length=379

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWDY MEG + +  MNPMVAY+KGL TWA
Sbjct  197  DLIEENAKYWRGVDVLVFDSAHWWTHSDQSSSWDYYMEGHSLYTNMNPMVAYQKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSMSP+HNRENGW+C+N+++PL +FS   VP+ L+VL+ VLR+M
Sbjct  257  KWVDLNLDPRKTRVIFRSMSPRHNRENGWRCYNQKQPLAYFSHQHVPEPLLVLQGVLRKM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TMSAFRRD HPSVY + +GQEE+QH R + SDCSHWCLPGVPD WNE+L+
Sbjct  317  RFPVYLQDITTMSAFRRDGHPSVYRRAMGQEERQHPRDFSSDCSHWCLPGVPDSWNEILS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>gb|KDO44402.1| hypothetical protein CISIN_1g017027mg [Citrus sinensis]
Length=379

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE+NARYWRG+DVLVFDSAHWWTHS+  SSWDY MEG + ++ MNPM+AYEKGL TWA
Sbjct  197  DLIEDNARYWRGADVLVFDSAHWWTHSEQWSSWDYYMEGKSVYKVMNPMIAYEKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPR++RV FRSMSP+HNRENGWKC+ +R PL  FS   VP+QLVVLK+VLRRM
Sbjct  257  KWIDLNIDPRRTRVIFRSMSPRHNRENGWKCYKQRTPLAFFSHQHVPEQLVVLKEVLRRM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TMSA RRD HPSVY + +GQEE+QH + + SDCSHWCLPGVPD WNEML+
Sbjct  317  RFPVYLQDITTMSALRRDGHPSVYRRAMGQEERQHSKDFSSDCSHWCLPGVPDSWNEMLS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>ref|XP_006445722.1| hypothetical protein CICLE_v10015623mg [Citrus clementina]
 ref|XP_006485201.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|ESR58962.1| hypothetical protein CICLE_v10015623mg [Citrus clementina]
Length=379

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE+NARYWRG+DVLVFDSAHWWTHS+  SSWDY MEG + ++ MNPM+AYEKGL TWA
Sbjct  197  DLIEDNARYWRGADVLVFDSAHWWTHSEQWSSWDYYMEGKSVYKVMNPMIAYEKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPR++RV FRSMSP+HNRENGWKC+ +R PL  FS   VP+QLVVLK+VLRRM
Sbjct  257  KWIDLNIDPRRTRVIFRSMSPRHNRENGWKCYKQRTPLAFFSHQHVPEQLVVLKEVLRRM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TMSA RRD HPSVY + +GQEE+QH + + SDCSHWCLPGVPD WNEML+
Sbjct  317  RFPVYLQDITTMSALRRDGHPSVYRRAMGQEERQHSKDFSSDCSHWCLPGVPDSWNEMLS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>gb|KDP35804.1| hypothetical protein JCGZ_10440 [Jatropha curcas]
Length=376

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENARYWR  D+LVFDSAHWWTHS   SSWDY MEG    + MNPM+AY+KGL TWA
Sbjct  194  DMIEENARYWRNVDILVFDSAHWWTHSDQWSSWDYYMEGQRLIKNMNPMIAYQKGLTTWA  253

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPRK+RV FRSMSP+HNRENGWKC+N+R+PL  FS   VP+Q+VVLK+VLR+M
Sbjct  254  KWIDLNLDPRKTRVIFRSMSPRHNRENGWKCYNQRKPLAFFSHQHVPEQMVVLKEVLRKM  313

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYLQDI+T+SA RRD HPSVY + + QEE+QH + + SDCSHWCLPGVPDIWNEML+
Sbjct  314  SFPVYLQDITTISALRRDGHPSVYKRAISQEERQHPKAFSSDCSHWCLPGVPDIWNEMLS  373

Query  161  AM  156
            A+
Sbjct  374  AI  375



>gb|ABK92623.1| unknown [Populus trichocarpa]
Length=218

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWR  DVLVFDSAHWWTHS   SSWDY ME    F+ MNPMVAY+KGL TWA
Sbjct  36   DLIEENARYWRNVDVLVFDSAHWWTHSDQWSSWDYYMEKQTLFQSMNPMVAYQKGLTTWA  95

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +WIDLN+DPRK+RV FRS+SP+HNRENGWKC+N+R+PL   S   VP+  VVLK+VLR+M
Sbjct  96   RWIDLNLDPRKTRVIFRSISPRHNRENGWKCYNQRQPLAFSSHQHVPESFVVLKEVLRKM  155

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYLQDI+ MSA RRD HPSVY + + Q+ +QH  G+ SDCSHWCLPGVPDIWNEML+
Sbjct  156  SFPVYLQDITAMSALRRDGHPSVYRRAISQQARQHPSGFSSDCSHWCLPGVPDIWNEMLS  215

Query  161  AM  156
            A+
Sbjct  216  AL  217



>gb|KJB78678.1| hypothetical protein B456_013G011800 [Gossypium raimondii]
Length=372

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWRG DVLVFDSAHWWTHS   SSWDY MEG + ++ MNPM+AY+KGL TWA
Sbjct  190  DLIEENARYWRGVDVLVFDSAHWWTHSDQWSSWDYYMEGKSLYKTMNPMIAYQKGLTTWA  249

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPRK+RV FRS+SP+HNR+NGW+C+N++ PL+ FS P VP+Q+VVLK VL+RM
Sbjct  250  KWIDLNIDPRKTRVIFRSVSPRHNRQNGWRCYNQKTPLKFFSHPHVPEQVVVLKGVLKRM  309

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYL D++ MSAFRRDAHPSVY + + Q ++QH R + SDCSHWCLPGVPDIWNEML+
Sbjct  310  SFPVYLHDVTMMSAFRRDAHPSVYRRALNQAQRQHPREFSSDCSHWCLPGVPDIWNEMLS  369

Query  161  AM  156
            AM
Sbjct  370  AM  371



>ref|XP_010032073.1| PREDICTED: protein trichome birefringence-like 36 [Eucalyptus 
grandis]
 gb|KCW51460.1| hypothetical protein EUGRSUZ_J00985 [Eucalyptus grandis]
Length=387

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWDY MEG + F  +NPMVAYEKGL TWA
Sbjct  205  DLIEENAKYWRGVDVLVFDSAHWWTHSDKWSSWDYYMEGRSMFTNINPMVAYEKGLTTWA  264

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPR++RV FRSMSP+HNRENGWKC+N+++PL +FS   VP+QLVVL+QV+RRM
Sbjct  265  KWVDLNLDPRRTRVIFRSMSPRHNRENGWKCYNQKQPLAYFSHRHVPEQLVVLQQVVRRM  324

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+ MSA RRD HPSVY + + Q+E+Q+ RG+ SDCSHWCLPGVPD WNEML 
Sbjct  325  RFPVYLQDITAMSALRRDGHPSVYRRAMNQQERQNPRGFSSDCSHWCLPGVPDTWNEMLT  384

Query  161  AM  156
            A+
Sbjct  385  AL  386



>gb|KHG28346.1| Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] [Gossypium 
arboreum]
Length=347

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWRG DVLVFDSAHWWTHS   SSWDY MEG + ++ MNPM+AY+KGL TWA
Sbjct  165  DLIEENARYWRGVDVLVFDSAHWWTHSDQWSSWDYYMEGKSLYKTMNPMIAYQKGLTTWA  224

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRS+SP+HNR+NGW+C+N++ PL+ FS P VP+Q+VVLK VL+RM
Sbjct  225  KWVDLNLDPRKTRVIFRSVSPRHNRQNGWRCYNQKTPLKFFSHPHVPEQVVVLKGVLKRM  284

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYL D++ MSAFRRD HPSVY + + Q ++QH R + SDCSHWCLPGVPDIWNEML+
Sbjct  285  SFPVYLHDVTMMSAFRRDGHPSVYRRALNQAQRQHPREFSSDCSHWCLPGVPDIWNEMLS  344

Query  161  AM  156
            AM
Sbjct  345  AM  346



>ref|XP_002521177.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41208.1| conserved hypothetical protein [Ricinus communis]
Length=379

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENARYWR  D+LVFDSAHWWTHS   SSWDY MEG +  + MNPM+AY+KGL TWA
Sbjct  197  DMIEENARYWRNVDILVFDSAHWWTHSDKWSSWDYYMEGQSLIKSMNPMIAYQKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPR++RV FRSMSP+HNR+NGWKC+ +R PL  FS   +P+QLVVLK+VLR+M
Sbjct  257  KWIDLNLDPRRTRVIFRSMSPRHNRDNGWKCYKQRTPLAFFSHQHIPEQLVVLKEVLRKM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYLQDI+TMSA RRD HPSVY + + QEE+QH R + SDCSHWCLPGVPDIWNEML+
Sbjct  317  SFPVYLQDITTMSALRRDGHPSVYRRAISQEERQHPRDFSSDCSHWCLPGVPDIWNEMLS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>ref|XP_007010436.1| Trichome birefringence-like 36 [Theobroma cacao]
 gb|EOY19246.1| Trichome birefringence-like 36 [Theobroma cacao]
Length=375

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IEENARYWRG DVLVFDSAHWWTHS   SSWDY MEG + ++ MNPM+AY+KGL TWA
Sbjct  193  DMIEENARYWRGVDVLVFDSAHWWTHSDQWSSWDYYMEGKSLYKNMNPMIAYQKGLTTWA  252

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSMSP+HNR+NGWKC+N++ PL  FS P VP+Q++VL+ VLRRM
Sbjct  253  KWVDLNLDPRKTRVIFRSMSPRHNRDNGWKCYNQKSPLAFFSHPHVPEQVLVLQGVLRRM  312

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYL DI+TMSAFRRD HPSVY + + Q ++QH R + SDCSHWCLPGVPDIWNEML+
Sbjct  313  RFPVYLHDITTMSAFRRDGHPSVYRRALNQADRQHPREFSSDCSHWCLPGVPDIWNEMLS  372

Query  161  AM  156
            A+
Sbjct  373  AL  374



>ref|XP_010088792.1| hypothetical protein L484_018353 [Morus notabilis]
 gb|EXB36975.1| hypothetical protein L484_018353 [Morus notabilis]
Length=376

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YWRG+DVL+FDSAHWWTHS   SSWDY MEG    + MNPMVAY+KGL TWA
Sbjct  194  DSIEENAKYWRGADVLLFDSAHWWTHSDKWSSWDYFMEGHTLVKSMNPMVAYQKGLTTWA  253

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DP K+RVFFRSMSP+HNRENGWKC+N+++PL  FS P VP++LVVL+ VLR+M
Sbjct  254  KWVDLNLDPHKTRVFFRSMSPRHNRENGWKCYNQKKPLAAFSHPHVPEELVVLQGVLRKM  313

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQD++T+SAFRRD HPSVY + +GQEE+QH   + SDCSHWCLPGVPD WNE+L+
Sbjct  314  RFPVYLQDVTTLSAFRRDGHPSVYRRALGQEERQHPGNFSSDCSHWCLPGVPDTWNEILS  373

Query  161  AM  156
            A+
Sbjct  374  AL  375



>ref|XP_011076935.1| PREDICTED: protein trichome birefringence-like 36 [Sesamum indicum]
Length=383

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YWRG DVLVFDSAHWWTHS   SSWD++MEG N ++ +NP +AYEKGL TWA
Sbjct  201  DWIEENAKYWRGVDVLVFDSAHWWTHSDKWSSWDFMMEGNNVYKSINPTIAYEKGLTTWA  260

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPR++RVFFRSMSP+HNR+NGWKC N+REPLE F RP +P+QL+VL++V+RRM
Sbjct  261  KWIDLNLDPRRTRVFFRSMSPRHNRDNGWKCHNQREPLESFIRPHIPEQLIVLEKVVRRM  320

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVY+QDI+TMSA RRD HPSVYG+  G +  Q L+   SDCSHWCLPGVPD WNE+LN
Sbjct  321  EFPVYIQDITTMSALRRDGHPSVYGRASGDKNNQQLKDRSSDCSHWCLPGVPDTWNEILN  380

Query  161  AM  156
            A+
Sbjct  381  AV  382



>ref|XP_004135033.1| PREDICTED: uncharacterized protein LOC101204429 [Cucumis sativus]
 ref|XP_004164142.1| PREDICTED: uncharacterized protein LOC101230513 [Cucumis sativus]
 gb|KGN52192.1| hypothetical protein Csa_5G614680 [Cucumis sativus]
Length=378

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YW G D+LVFDSAHWWTHSQ  SSWDY MEG   ++YMNPM+AYEKGL TWA
Sbjct  196  DRIEENAKYWTGVDILVFDSAHWWTHSQQWSSWDYYMEGQTMYKYMNPMIAYEKGLTTWA  255

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN++P K+RV FRSMSP+HNR NGWKC+N+R+PL +FS   VP QL VL+ VL++M
Sbjct  256  KWVDLNLNPEKTRVIFRSMSPRHNRNNGWKCYNQRQPLAYFSHQHVPGQLHVLQAVLKKM  315

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI++MSA RRD HPSVY   + QE KQH     SDCSHWCLPGVPDIWNEML+
Sbjct  316  RFPVYLQDITSMSALRRDGHPSVYRNNLSQEGKQHQESLSSDCSHWCLPGVPDIWNEMLS  375

Query  161  AM  156
            A+
Sbjct  376  AL  377



>ref|XP_002311947.1| hypothetical protein POPTR_0008s02180g [Populus trichocarpa]
 gb|EEE89314.1| hypothetical protein POPTR_0008s02180g [Populus trichocarpa]
Length=384

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWR  DVLVFDSAHWWTHS   SSWDY ME    F+ MNPMVAY+KGL TWA
Sbjct  202  DLIEENARYWRNVDVLVFDSAHWWTHSDQWSSWDYYMEKQTLFQSMNPMVAYQKGLTTWA  261

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +WIDLN+DPRK+RV FRS+SP+HNRENGWKC+N+R+PL   S   VP+  VVLK+VLR+M
Sbjct  262  RWIDLNLDPRKTRVIFRSISPRHNRENGWKCYNQRQPLAFSSHQHVPESFVVLKEVLRKM  321

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYLQDI+ MSA RRD HPSVY + + Q+ +QH  G+ SDCSHWCLPGVPDIWNEML+
Sbjct  322  SFPVYLQDITAMSALRRDGHPSVYRRAISQQARQHPSGFSSDCSHWCLPGVPDIWNEMLS  381

Query  161  AM  156
            A+
Sbjct  382  AL  383



>ref|XP_008446761.1| PREDICTED: protein trichome birefringence-like 36 [Cucumis melo]
Length=378

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YW G D+LVFDSAHWWTHSQ  SSWDY MEG   ++YMNPM+AYEKGL TWA
Sbjct  196  DKIEENAKYWTGVDILVFDSAHWWTHSQQWSSWDYYMEGQTMYKYMNPMIAYEKGLTTWA  255

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN++P+K+RV FRSMSP+HNR+NGWKC+N+R+PL +FS   VP QL VL++VLR+M
Sbjct  256  KWVDLNLNPKKTRVIFRSMSPRHNRDNGWKCYNQRQPLAYFSHQHVPGQLHVLQEVLRKM  315

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI++MSA RRD HPSVY   + QE K+H     SDCSHWCLPGVPDIWNEML+
Sbjct  316  RFPVYLQDITSMSALRRDGHPSVYRNNLSQEGKRHQESLSSDCSHWCLPGVPDIWNEMLS  375

Query  161  AM  156
            A+
Sbjct  376  AL  377



>ref|XP_007142840.1| hypothetical protein PHAVU_007G021300g [Phaseolus vulgaris]
 gb|ESW14834.1| hypothetical protein PHAVU_007G021300g [Phaseolus vulgaris]
Length=379

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE+NARYWRG D+LVFDSAHWWTHS   SSWDY MEG +    MNPMVAY+KGL TWA
Sbjct  197  DLIEDNARYWRGVDILVFDSAHWWTHSGQTSSWDYYMEGNSIITNMNPMVAYQKGLSTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+DLN++PRK+R+ FRSMSP+HNR+NGWKC+ +R+P++ FS   VP+ LVVL+ V++RM
Sbjct  257  RWVDLNLNPRKTRIIFRSMSPRHNRQNGWKCYKQRQPVQFFSHLHVPEPLVVLQGVIKRM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TM+AFRRD HPSVY K V +E ++   G  SDCSHWCLPGVPDIWNEML+
Sbjct  317  RFPVYLQDITTMTAFRRDGHPSVYSKAVNEERQKAGTGLSSDCSHWCLPGVPDIWNEMLS  376

Query  161  AM  156
            A+
Sbjct  377  AL  378



>gb|KHN09736.1| hypothetical protein glysoja_049465 [Glycine soja]
Length=335

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWRG D+LVFDSAHWWTH    SSWDY MEG N  R MNPMVAY+KGL TWA
Sbjct  152  DLIEENARYWRGVDILVFDSAHWWTHPDQTSSWDYYMEGNNLTRNMNPMVAYQKGLSTWA  211

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+D N++PR++ V FRSMSP+HNRENGWKC+N+++PL   S   VP+ L VL+ VL+RM
Sbjct  212  RWVDQNLNPRRTEVIFRSMSPRHNRENGWKCYNQKQPLPFSSHLHVPEPLAVLQGVLKRM  271

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHL-RGYKSDCSHWCLPGVPDIWNEML  165
             FPVYLQDI+TM+A RRD HPSVY +V+ Q+EKQ   +G+ SDCSHWCLPGVPDIWNEML
Sbjct  272  RFPVYLQDITTMTALRRDGHPSVYRRVISQDEKQKPGKGHSSDCSHWCLPGVPDIWNEML  331

Query  164  NAM  156
            +A+
Sbjct  332  SAL  334



>gb|KEH44322.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=369

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYW+G D+L FDSAHWWTHS   SSWDY MEG +    MN MVAYEKG+ TWA
Sbjct  186  DLIEENARYWKGVDILAFDSAHWWTHSGQSSSWDYYMEGNSIITNMNQMVAYEKGVSTWA  245

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSM+P+HNR+NGWKC+N+R+P+++FS   VP  LVVLK VL+RM
Sbjct  246  KWVDLNLDPRKTRVIFRSMAPRHNRQNGWKCYNQRQPVKYFSHLHVPGPLVVLKGVLKRM  305

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQ-HLRGYKSDCSHWCLPGVPDIWNEML  165
             FPVYLQDI+TM+AFRRD HPSVY K + ++E+Q    G  SDCSHWCLPGVPDIWNEML
Sbjct  306  RFPVYLQDITTMTAFRRDGHPSVYSKAISEKERQKQGNGQSSDCSHWCLPGVPDIWNEML  365

Query  164  NA  159
            +A
Sbjct  366  SA  367



>gb|KEH44323.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=382

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYW+G D+L FDSAHWWTHS   SSWDY MEG +    MN MVAYEKG+ TWA
Sbjct  199  DLIEENARYWKGVDILAFDSAHWWTHSGQSSSWDYYMEGNSIITNMNQMVAYEKGVSTWA  258

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSM+P+HNR+NGWKC+N+R+P+++FS   VP  LVVLK VL+RM
Sbjct  259  KWVDLNLDPRKTRVIFRSMAPRHNRQNGWKCYNQRQPVKYFSHLHVPGPLVVLKGVLKRM  318

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQ-HLRGYKSDCSHWCLPGVPDIWNEML  165
             FPVYLQDI+TM+AFRRD HPSVY K + ++E+Q    G  SDCSHWCLPGVPDIWNEML
Sbjct  319  RFPVYLQDITTMTAFRRDGHPSVYSKAISEKERQKQGNGQSSDCSHWCLPGVPDIWNEML  378

Query  164  NA  159
            +A
Sbjct  379  SA  380



>ref|XP_003535878.1| PREDICTED: protein YLS7 [Glycine max]
Length=382

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWRG D+LVFDSAHWWTH    SSWDY +EG N  R MNPMVAY+KGL TWA
Sbjct  199  DLIEENARYWRGVDILVFDSAHWWTHPDQTSSWDYYLEGNNLTRNMNPMVAYQKGLSTWA  258

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+D N++PR++ V FRSMSP+HNRENGWKC+N+++PL   S   VP+ L VL+ VL+RM
Sbjct  259  RWVDQNLNPRRTEVIFRSMSPRHNRENGWKCYNQKQPLPFSSHLHVPEPLAVLQGVLKRM  318

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHL-RGYKSDCSHWCLPGVPDIWNEML  165
             FPVYLQDI+TM+A RRD HPSVY +V+ Q+EKQ   +G+ SDCSHWCLPGVPDIWNEML
Sbjct  319  RFPVYLQDITTMTALRRDGHPSVYRRVISQDEKQKPGKGHSSDCSHWCLPGVPDIWNEML  378

Query  164  NAM  156
            +A+
Sbjct  379  SAL  381



>gb|EYU19805.1| hypothetical protein MIMGU_mgv1a008074mg [Erythranthe guttata]
Length=385

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 155/188 (82%), Gaps = 7/188 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YWRG D LVFDSAHWWTHS   SSWDY+MEG+N +R +NP +AYEKGL TWA
Sbjct  198  DSIEENAKYWRGVDSLVFDSAHWWTHSDKWSSWDYVMEGSNIYRNINPRIAYEKGLTTWA  257

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KWIDLN+DPR +RVFFR+MSP HNRENGWKC+N+REPLE+FSR +VP+Q V+L++VLR M
Sbjct  258  KWIDLNLDPRSTRVFFRTMSPSHNRENGWKCYNQREPLEYFSRIQVPEQSVILRKVLRGM  317

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKV------VGQEEKQHLRGYKSDCSHWCLPGVPDI  180
             FPV ++DI+ +SA R+D HPSVYG +       G++EKQ L+   SDCSHWCLPGVPD 
Sbjct  318  EFPVSVEDITVISALRKDGHPSVYGNIGANNNSSGEKEKQ-LKDRNSDCSHWCLPGVPDT  376

Query  179  WNEMLNAM  156
            WNE+LNAM
Sbjct  377  WNEILNAM  384



>ref|XP_011032863.1| PREDICTED: protein trichome birefringence-like 36 [Populus euphratica]
Length=415

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWR  DVLVFDSAHWWTHS   SSWDY ME    F+ MNPMVAY+KGL TWA
Sbjct  233  DLIEENARYWRNVDVLVFDSAHWWTHSDQWSSWDYYMEKQTLFQSMNPMVAYQKGLTTWA  292

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +WIDLN+DPRK+RV FRSMSP+HNR NGWKC+N+R+PL   S   VP+ LVVLK+VLR+M
Sbjct  293  RWIDLNLDPRKTRVIFRSMSPRHNRGNGWKCYNQRQPLAFSSHQHVPESLVVLKEVLRKM  352

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
            +FPVYLQDI+ MSA RRD HPSVY + + ++ +QH     SDCSHWCLPGVPDIWNEML+
Sbjct  353  SFPVYLQDITAMSALRRDGHPSVYRRAISEQARQHPGSLSSDCSHWCLPGVPDIWNEMLS  412

Query  161  AM  156
            A+
Sbjct  413  AL  414



>ref|XP_002269148.1| PREDICTED: protein trichome birefringence-like 36 [Vitis vinifera]
 emb|CBI18592.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLV+DSAHWWTHS   SSWDY ME     R MNPMVAY+KGL TWA
Sbjct  203  DLIEENAKYWRGVDVLVYDSAHWWTHSDKWSSWDYYMEANTVLRSMNPMVAYQKGLTTWA  262

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            KW+DLN+DP K+RV FRS+SP+HNR+NGWKC+N+++PLE FS +  VP+Q+VVLK VL+ 
Sbjct  263  KWVDLNLDPHKTRVIFRSVSPRHNRQNGWKCYNQKQPLEFFSHQLHVPEQMVVLKGVLKG  322

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M FPVYLQDI+ MSA R+D HPSVY + + QE+KQH R + SDCSHWCLPGVPD WNE+L
Sbjct  323  MRFPVYLQDITMMSALRKDGHPSVYTRAMDQEQKQHPRDFTSDCSHWCLPGVPDAWNEIL  382

Query  164  NAM  156
            +A+
Sbjct  383  SAL  385



>emb|CAN74465.1| hypothetical protein VITISV_004134 [Vitis vinifera]
Length=388

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLV+DSAHWWTHS   SSWDY ME     R MNPMVAY+KGL TWA
Sbjct  203  DLIEENAKYWRGVDVLVYDSAHWWTHSDKWSSWDYYMEANTVLRSMNPMVAYQKGLTTWA  262

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            KW+DLN+DP K+RV FRS+SP+HNR++GWKC+N+++PLE FS +  VP+Q+VVLK VL+ 
Sbjct  263  KWVDLNLDPHKTRVIFRSVSPRHNRQDGWKCYNQKQPLEFFSHQLHVPEQMVVLKGVLKG  322

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M FPVYLQDI+ MSA R+D HPSVY + + QE+KQH R + SDCSHWCLPGVPD WNE+L
Sbjct  323  MRFPVYLQDITMMSALRKDGHPSVYTRAMDQEQKQHPRDFTSDCSHWCLPGVPDAWNEIL  382

Query  164  NAM  156
            +A+
Sbjct  383  SAL  385



>ref|XP_010536307.1| PREDICTED: protein trichome birefringence-like 36 [Tarenaya hassleriana]
Length=391

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG D+LVFDSAHWWTHS   SSWDY M+G   F+ MNPM AYEKGL TWA
Sbjct  204  DSIEDNARYWRGVDILVFDSAHWWTHSDKWSSWDYYMDGNKVFKAMNPMAAYEKGLSTWA  263

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+++N+DPRK++V FRSMSP+HNRE+G +C+N+R+PL +FS+P VP QL+VLK+VLRRM
Sbjct  264  KWVEVNLDPRKTKVIFRSMSPRHNRESGRRCYNQRQPLPYFSKPHVPGQLIVLKEVLRRM  323

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             F VYL DI+TMSA+RRD HPSVY + +GQEEK+H+    SDCSHWCLPGVPDIWNEML+
Sbjct  324  KFRVYLHDITTMSAYRRDGHPSVYKRAIGQEEKRHIAEAPSDCSHWCLPGVPDIWNEMLS  383

Query  161  AM  156
            ++
Sbjct  384  SI  385



>gb|KHN11469.1| hypothetical protein glysoja_015364 [Glycine soja]
Length=386

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYW+G DVLVFDSAHWWTHS    SWDY MEG +    MNPMVAY+KGL TWA
Sbjct  204  DLIEENARYWKGVDVLVFDSAHWWTHSGQTRSWDYYMEGNSIITNMNPMVAYQKGLSTWA  263

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+DLN+D R++R+ FRSMSP+HNR NGWKC+ +R+PL+ FS   VP+ LVVLK VL+RM
Sbjct  264  RWVDLNLDSRRTRIIFRSMSPRHNRLNGWKCYKQRQPLQFFSHIHVPEPLVVLKGVLKRM  323

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TM+AFRRD HPSVY K + +E ++   G  SDCSHWCLPGVPDIWNEML+
Sbjct  324  RFPVYLQDITTMTAFRRDGHPSVYNKAMSEERQKAGTGLSSDCSHWCLPGVPDIWNEMLS  383

Query  161  A  159
            A
Sbjct  384  A  384



>ref|XP_003555875.1| PREDICTED: protein YLS7-like [Glycine max]
Length=386

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYW+G DVLVFDSAHWWTHS    SWDY MEG +    MNPMVAY+KGL TWA
Sbjct  204  DLIEENARYWKGVDVLVFDSAHWWTHSGQTRSWDYYMEGNSIITNMNPMVAYQKGLSTWA  263

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+DLN+D R++R+ FRSMSP+HNR NGWKC+ +R+PL+ FS   VP+ LVVLK VL+RM
Sbjct  264  RWVDLNLDSRRTRIIFRSMSPRHNRLNGWKCYKQRQPLQFFSHIHVPEPLVVLKGVLKRM  323

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TM+AFRRD HPSVY K + +E ++   G  SDCSHWCLPGVPDIWNEML+
Sbjct  324  RFPVYLQDITTMTAFRRDGHPSVYNKAMSEERQKAGTGLSSDCSHWCLPGVPDIWNEMLS  383

Query  161  A  159
            +
Sbjct  384  S  384



>ref|XP_010271679.1| PREDICTED: protein trichome birefringence-like 36 [Nelumbo nucifera]
Length=380

 Score =   253 bits (646),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA++WRG D+LVFDSAHWWTHS   SS D+ MEG +    +NPMVAYEKGL TWA
Sbjct  197  DLIEENAKFWRGVDILVFDSAHWWTHSGKWSSVDFYMEGNSMITSLNPMVAYEKGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            +W+DLN+DP+++RV FRS+SP+HNRENGWKC+N+REPL +F+ +P VP+QL +L+ VL R
Sbjct  257  RWVDLNLDPKRTRVIFRSISPRHNRENGWKCYNQREPLRNFNHQPHVPEQLPILEAVLER  316

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M+FPVYL DI+ MSAFRRDAHPSVY + + ++++QH   Y SDCSHWCLPGVPDIWNEML
Sbjct  317  MSFPVYLHDITRMSAFRRDAHPSVYSRALDEQQRQHPTDYTSDCSHWCLPGVPDIWNEML  376

Query  164  NAM  156
            N +
Sbjct  377  NVL  379



>gb|ACU24162.1| unknown [Glycine max]
Length=386

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYW+G DVLVFDSAHWWTHS    SWDY MEG +    MNPMVAY+KGL TWA
Sbjct  204  DLIEENARYWKGVDVLVFDSAHWWTHSGQTRSWDYYMEGNSIITNMNPMVAYQKGLSTWA  263

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+DLN+D R++R+ FRSMSP+HNR NGWKC+ +R+PL+ FS   VP+ LVVLK VL+RM
Sbjct  264  RWVDLNLDSRRTRIIFRSMSPRHNRLNGWKCYKQRQPLQFFSHIHVPEPLVVLKGVLKRM  323

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TM+AFRRD HPSVY K + +E ++   G  SDCSHWCLPGVPDIWNE+L+
Sbjct  324  RFPVYLQDITTMTAFRRDGHPSVYNKAMSEERQKAGTGLSSDCSHWCLPGVPDIWNEILS  383

Query  161  AM  156
            + 
Sbjct  384  SF  385



>ref|XP_007145481.1| hypothetical protein PHAVU_007G242600g [Phaseolus vulgaris]
 gb|ESW17475.1| hypothetical protein PHAVU_007G242600g [Phaseolus vulgaris]
Length=380

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENARYWRG D+LVFDSAHWWTHS   SSWDY MEG N  R M+ M AY++GL TWA
Sbjct  197  DLIEENARYWRGVDILVFDSAHWWTHSDQTSSWDYYMEGNNLIRNMSAMAAYQRGLSTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+D N+DP +++V FRSMS +HNRENGWKC+N+++PL  FS  +VP+ LVVL+ VL+RM
Sbjct  257  RWVDQNLDPLRTQVIFRSMSSRHNRENGWKCYNQKQPLPFFSHLQVPEPLVVLQGVLKRM  316

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQ-HLRGYKSDCSHWCLPGVPDIWNEML  165
             FPVYLQDI+TM+  RRD HPSVY + +GQ E+Q   +G  SDCSHWCLPGVPDIWNEML
Sbjct  317  RFPVYLQDITTMTELRRDGHPSVYMRAIGQNERQKQGKGLSSDCSHWCLPGVPDIWNEML  376

Query  164  NAM  156
            +A+
Sbjct  377  SAL  379



>ref|XP_006589717.1| PREDICTED: uncharacterized protein LOC102660356 [Glycine max]
Length=238

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENAR W+G DVLVFDSAHWWTHS    SWDY MEG +    MNPMVA +KGL TWA
Sbjct  57   DLIEENARCWKGVDVLVFDSAHWWTHSGQTRSWDYYMEGNSIITNMNPMVACQKGLSTWA  116

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+DLN+DPR++RV FRSMSP+HNR NG KC+ +R+PL+ FS   VP+ LVVLK VL+RM
Sbjct  117  RWVDLNLDPRRTRVIFRSMSPRHNRLNGRKCYKQRKPLQFFSHIHVPEPLVVLKGVLKRM  176

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TM+AFRRD HPSVY K +  EE+Q   G  SDCSHWCLPGVPDIWNEML+
Sbjct  177  RFPVYLQDITTMTAFRRDGHPSVYSKAMS-EERQKGTGLSSDCSHWCLPGVPDIWNEMLS  235

Query  161  AM  156
             +
Sbjct  236  TL  237



>gb|KEH41400.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=375

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 151/183 (83%), Gaps = 2/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG D+LVFDSA WWTHS   SSWDY  EG+N  + M+ MVAY+KGL TWA
Sbjct  193  DLIEENAKYWRGVDILVFDSAQWWTHSDKTSSWDYYKEGSNLIKNMSLMVAYQKGLSTWA  252

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            +W+DLN++P+K++V FRSMSP+HNRENGWKC N+++PL  FS +   P+ LVVL+ VL++
Sbjct  253  RWVDLNLNPQKTKVIFRSMSPRHNRENGWKCDNQKQPLPFFSLQQHAPEPLVVLQGVLKK  312

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M FPVYLQDI+TM+A RRD HPSVY K   Q+EKQ + G+ SDCSHWCLPGVPDIWNEML
Sbjct  313  MRFPVYLQDITTMTALRRDGHPSVYRKATSQDEKQRM-GHSSDCSHWCLPGVPDIWNEML  371

Query  164  NAM  156
            +A+
Sbjct  372  SAL  374



>ref|XP_004514721.1| PREDICTED: uncharacterized protein LOC101494450 [Cicer arietinum]
Length=388

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+ WRG D+L+FDSAHWW HS   SSWDY MEG N  R MNPMVAY+KGL TWA
Sbjct  204  DLIEENAKSWRGVDILIFDSAHWWAHSDQTSSWDYYMEGNNLIRNMNPMVAYQKGLNTWA  263

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            +W+DLN+DP++++V FRS+SP+HNRENGWKC+N+++PL  FS +    + +VVLK VL+R
Sbjct  264  RWVDLNLDPQRTKVIFRSISPRHNRENGWKCYNQKQPLPFFSLQKHASEPMVVLKGVLKR  323

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHL-RGYKSDCSHWCLPGVPDIWNEM  168
            M FPVYLQDI+TM+A R D HPSVY K + Q+EKQ   + + SDCSHWCLPGVPDIWNEM
Sbjct  324  MRFPVYLQDITTMTALRGDGHPSVYRKAINQDEKQKQGKNHSSDCSHWCLPGVPDIWNEM  383

Query  167  LNAM  156
             +A+
Sbjct  384  FSAL  387



>gb|KHN37414.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=658

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENAR W+G DVLVFDSAHWWTHS    SWDY MEG +    MNPMVA +KGL TWA
Sbjct  477  DLIEENARCWKGVDVLVFDSAHWWTHSGQTRSWDYYMEGNSIITNMNPMVACQKGLSTWA  536

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+DLN+DPR++RV FRSMSP+HNR NG KC+ +R+PL+ FS   VP+ LVVLK VL+RM
Sbjct  537  RWVDLNLDPRRTRVIFRSMSPRHNRLNGRKCYKQRKPLQFFSHIHVPEPLVVLKGVLKRM  596

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
             FPVYLQDI+TM+AFRRD HPSVY K +  EE+Q   G  SDCSHWCLPGVPDIWNEML+
Sbjct  597  RFPVYLQDITTMTAFRRDGHPSVYSKAMS-EERQKGTGLSSDCSHWCLPGVPDIWNEMLS  655

Query  161  AM  156
             +
Sbjct  656  TL  657



>ref|XP_008790903.1| PREDICTED: protein trichome birefringence-like 36 [Phoenix dactylifera]
Length=446

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YWRG DVLVFDSAHWWTHS   SSWDY  EG   F  +NPMVAYEKGL TWA
Sbjct  261  DSIEENAKYWRGVDVLVFDSAHWWTHSGKWSSWDYYKEGERLFASLNPMVAYEKGLTTWA  320

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            KW+DLN+DP ++RV FRS+SP+HNR+NGW+C+ +REPL     RPRVP QL V+  VL++
Sbjct  321  KWVDLNLDPNRTRVIFRSVSPRHNRKNGWQCYKQREPLVFLGYRPRVPGQLAVVHDVLKK  380

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M+FPVYL D+++MSA RRD HPS++G+  G++ +    G+ SDC+HWCLPGVPD WNEML
Sbjct  381  MSFPVYLLDVTSMSALRRDGHPSIFGRAAGEQGRLDTVGWTSDCTHWCLPGVPDAWNEML  440

Query  164  N  162
            +
Sbjct  441  S  441



>ref|XP_010912275.1| PREDICTED: protein trichome birefringence-like 36 [Elaeis guineensis]
Length=388

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YWRG DVLVFDSAHWWTHS   SSWDY  EG   F  +NPMVAYEKGL TWA
Sbjct  205  DSIEENAKYWRGVDVLVFDSAHWWTHSGKWSSWDYYKEGDRLFTGLNPMVAYEKGLTTWA  264

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            KW+DLN+DPR++RV FRS+SP+H+R+NGW+C+ +REP      RPRVP QLVVL++ L++
Sbjct  265  KWVDLNLDPRRTRVIFRSVSPQHSRDNGWQCYRQREPRVFLGHRPRVPWQLVVLREALKK  324

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
             +FPVYL D+++MSA RRD HPS+YG+    + +Q   G  SDCSHWCLPGVPD WNEML
Sbjct  325  TSFPVYLLDVTSMSALRRDGHPSIYGRAADAQGRQEAAGRTSDCSHWCLPGVPDAWNEML  384

Query  164  NAM  156
             A+
Sbjct  385  YAL  387



>ref|XP_010907119.1| PREDICTED: protein trichome birefringence-like 36 [Elaeis guineensis]
Length=389

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I++NA+YWRG D+LVFDSAHWWTHS   S WDY  EG   F  +NPMVAYEKGL TWA
Sbjct  206  DSIDDNAKYWRGVDILVFDSAHWWTHSGKWSLWDYYKEGERLFTSLNPMVAYEKGLTTWA  265

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            KW+DLN+DP ++RV FRS+SP+HNRENGW+C+ +REPL     +PRVP QLVVL++VL++
Sbjct  266  KWVDLNLDPNRTRVIFRSVSPRHNRENGWQCYKQREPLVFLGFKPRVPGQLVVLREVLKK  325

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M+FPVYL D+++MSA RRD HPSVYG+    + +Q      SDC+HWCLPGVPD WNEML
Sbjct  326  MSFPVYLLDVTSMSALRRDGHPSVYGRAADAQGRQDTAVRTSDCTHWCLPGVPDAWNEML  385

Query  164  NAM  156
             A+
Sbjct  386  YAL  388



>ref|XP_009404370.1| PREDICTED: protein trichome birefringence-like 36 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 143/183 (78%), Gaps = 6/183 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YW G DVLVFDSAHWWTHS   SSWDY  EG   F  +NPMVAYEKGL TWA
Sbjct  177  DSIEENAKYWLGVDVLVFDSAHWWTHSGKWSSWDYFQEGARLFTNLNPMVAYEKGLTTWA  236

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            KW+DLN+DPR++RV FRS+SP+HNRENGW+C+ ++EPL      PRVP QLVVL++VL++
Sbjct  237  KWVDLNLDPRRTRVVFRSVSPRHNRENGWQCYKQKEPLVFLGYSPRVPGQLVVLREVLKK  296

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M+FPVYL D+++MSA RRD HPS+Y      EE +   G  SDCSHWCLPGVPD WNEML
Sbjct  297  MSFPVYLMDVTSMSALRRDGHPSIYA-----EEGRDREGPASDCSHWCLPGVPDAWNEML  351

Query  164  NAM  156
             A+
Sbjct  352  YAL  354



>ref|XP_006391872.1| hypothetical protein EUTSA_v10023527mg [Eutrema salsugineum]
 gb|ESQ29158.1| hypothetical protein EUTSA_v10023527mg [Eutrema salsugineum]
Length=378

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE NARYWRG DVLVFDSAHWWTHSQ RSSWDY  +G   F+ M+PMVAYE+GL TW+
Sbjct  193  DLIEGNARYWRGVDVLVFDSAHWWTHSQKRSSWDYYKDGNKLFKAMDPMVAYERGLTTWS  252

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+++N+DP K++V FR+ SP   RE+G KC+N+R PL   S   VPQQ  VLK+VL RM
Sbjct  253  KWVEINLDPSKTKVIFRTSSP---RESGQKCYNQRHPLPSPSESHVPQQSRVLKKVLTRM  309

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEK-QHLRGYKSDCSHWCLPGVPDIWNEML  165
             + VYL DI+TMSA+RRD HPSV+ + + +EEK  H+ G  SDCSHWCLPGVPDIWNEML
Sbjct  310  KYRVYLHDITTMSAYRRDGHPSVFKRAMREEEKHHHIAGSLSDCSHWCLPGVPDIWNEML  369

Query  164  NAM  156
            +++
Sbjct  370  SSI  372



>ref|XP_008784007.1| PREDICTED: protein trichome birefringence-like 36 [Phoenix dactylifera]
Length=389

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEENA+YWRG DVLVFDSAHWWTHS   SSWDY   G   F  +NPMVAYE+GL TWA
Sbjct  206  DSIEENAKYWRGVDVLVFDSAHWWTHSGEWSSWDYYKVGGRLFTGLNPMVAYERGLTTWA  265

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
             W+DLN+DPR++RV FRS+SP+H+RENGW+C+ +REPL     RPRVP QLVVL++VLR+
Sbjct  266  NWVDLNLDPRRTRVIFRSVSPQHSRENGWQCYKQREPLVGLGHRPRVPWQLVVLREVLRK  325

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
             +FPVYL D++ MSA RRD HPS+YG+    + +Q    + SDCSHWCLPGVPD WNEML
Sbjct  326  TSFPVYLLDVTRMSAVRRDGHPSIYGRAADAQGRQDTAAWTSDCSHWCLPGVPDAWNEML  385

Query  164  NAM  156
             A+
Sbjct  386  YAL  388



>gb|KFK34680.1| hypothetical protein AALP_AA5G177300 [Arabis alpina]
Length=384

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 146/186 (78%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG +VLVFDSAHWWTHSQ R+SWDY  +G   F+ M PMVAYE+GL TWA
Sbjct  195  DSIEDNARYWRGVNVLVFDSAHWWTHSQKRNSWDYYKDGNKLFKAMAPMVAYERGLTTWA  254

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHF----SRprvpqqlvvlkqv  354
            KW+++N+DP K++V FR++SP   RE+G KCFN+R PL  F    S+P VPQQ  VL +V
Sbjct  255  KWVEVNLDPSKTKVIFRTLSP---RESGEKCFNQRHPLPSFASSSSKPDVPQQSRVLNKV  311

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L+RM + VYL DI+TMSA+RRD HPSV+ + +  EEK H+ G  SDCSHWCLPGVPDIWN
Sbjct  312  LKRMKYRVYLHDITTMSAYRRDGHPSVFKRAMRGEEKHHISGPTSDCSHWCLPGVPDIWN  371

Query  173  EMLNAM  156
            EML+++
Sbjct  372  EMLSSI  377



>emb|CDX76156.1| BnaA04g04200D [Brassica napus]
Length=372

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ RSSWDY  +G   ++ MNPMVAYE+GL TWA
Sbjct  187  DSIEDNARYWRGVDVLVFDSAHWWTHSQKRSSWDYYKDGNKLYKAMNPMVAYERGLTTWA  246

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+++N+DP K++V FR+ SP   RE+G KC+N++ PL   S P VPQQ  VLK+VL +M
Sbjct  247  EWVEINLDPSKTKVIFRTSSP---RESGQKCYNQKHPLPSSSEPHVPQQSRVLKKVLMKM  303

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQH-LRGYKSDCSHWCLPGVPDIWNEML  165
             + VYL DI+TMSA+RRD HPSV+ + +G+EEK H   G   DCSHWCLPGVPDIWNEML
Sbjct  304  KYRVYLHDITTMSAYRRDGHPSVFKRAMGEEEKHHRFAGPLPDCSHWCLPGVPDIWNEML  363

Query  164  NAM  156
            +++
Sbjct  364  SSI  366



>ref|XP_009139251.1| PREDICTED: protein trichome birefringence-like 36 [Brassica rapa]
Length=378

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ RSSWDY  +G   ++ MNPMVAYE+GL TWA
Sbjct  193  DSIEDNARYWRGVDVLVFDSAHWWTHSQKRSSWDYYKDGNKLYKAMNPMVAYERGLTTWA  252

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+++N+DP K++V FR+ SP   RE+G KC+N++ PL   S P VPQQ  VLK+VL +M
Sbjct  253  EWVEINLDPSKTKVIFRTSSP---RESGQKCYNQKHPLPSSSEPHVPQQSRVLKKVLMKM  309

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQH-LRGYKSDCSHWCLPGVPDIWNEML  165
             + VYL DI+TMSA+RRD HPSV+ + +G+EEK H   G   DCSHWCLPGVPDIWNEML
Sbjct  310  KYRVYLHDITTMSAYRRDGHPSVFKRAMGEEEKHHRFAGPLPDCSHWCLPGVPDIWNEML  369

Query  164  NAM  156
            +++
Sbjct  370  SSI  372



>emb|CDY65398.1| BnaCnng46890D [Brassica napus]
Length=380

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ R+SWDY  +G   ++ MNPMVAYE+GL TWA
Sbjct  195  DSIEDNARYWRGVDVLVFDSAHWWTHSQKRNSWDYYKDGNKLYKAMNPMVAYERGLTTWA  254

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            +W+++N+DP K++V FR+ SP   RE+G KC+N+R PL   S P VPQQ  VLK+VL +M
Sbjct  255  EWVEINLDPSKTKVIFRTSSP---RESGQKCYNQRHPLPSSSEPHVPQQSRVLKKVLMKM  311

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQH-LRGYKSDCSHWCLPGVPDIWNEML  165
             + VYL DI+TMSA+RRD HPSV+ + +G+EEK H   G   DCSHWCLPGVPDIWNEML
Sbjct  312  KYRVYLHDITTMSAYRRDGHPSVFKRAMGEEEKHHRFAGPLPDCSHWCLPGVPDIWNEML  371

Query  164  NAM  156
            +++
Sbjct  372  SSI  374



>ref|XP_010504228.1| PREDICTED: protein trichome birefringence-like 36 [Camelina sativa]
Length=380

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 144/186 (77%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ  SSWDY M+G   F+ MNPMVAYE+GL TWA
Sbjct  192  DSIEDNARYWRGVDVLVFDSAHWWTHSQKWSSWDYYMDGNKLFKVMNPMVAYERGLTTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS---Rprvpqqlvvlkqvl  351
            KW+++N+DP K++V FR++SP   RE+G  C+N+R PL   S   +P +PQQ  VL +VL
Sbjct  252  KWVEINLDPSKTKVIFRTISP---RESGQMCYNQRHPLPSLSSSRKPHMPQQSRVLNKVL  308

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEK-QHLRGYKSDCSHWCLPGVPDIWN  174
              M + VYL DI+TMSA+RRD HPSV+ + + +EEK  H+ G  SDCSHWCLPGVPDIWN
Sbjct  309  STMKYRVYLHDITTMSAYRRDGHPSVFKRAMHEEEKHHHISGPSSDCSHWCLPGVPDIWN  368

Query  173  EMLNAM  156
            EML+++
Sbjct  369  EMLSSI  374



>ref|XP_010427099.1| PREDICTED: protein trichome birefringence-like 36 [Camelina sativa]
Length=380

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 143/186 (77%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ  SSWDY M+G   F+ MNPMVAYE+GL TWA
Sbjct  192  DSIEDNARYWRGVDVLVFDSAHWWTHSQKWSSWDYYMDGNKLFKAMNPMVAYERGLTTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS---Rprvpqqlvvlkqvl  351
            KW+++N+DP K++V FR++SP   RE+G  C+N+R PL   S   +  +PQQ  VL +VL
Sbjct  252  KWVEINLDPSKTKVIFRTISP---RESGQMCYNQRHPLPSLSSSRKRHMPQQSRVLNKVL  308

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEK-QHLRGYKSDCSHWCLPGVPDIWN  174
              M + VYL DI+TMSA+RRD HPSV+ + + +EEK  H+ G  SDCSHWCLPGVPDIWN
Sbjct  309  STMKYRVYLHDITTMSAYRRDGHPSVFKRAMHEEEKHHHISGPSSDCSHWCLPGVPDIWN  368

Query  173  EMLNAM  156
            EML+++
Sbjct  369  EMLSSI  374



>ref|XP_010515948.1| PREDICTED: protein trichome birefringence-like 36 [Camelina sativa]
Length=399

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 144/186 (77%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ  SSWDY M+G   F+ MNPMVAYE+GL TWA
Sbjct  211  DSIEDNARYWRGVDVLVFDSAHWWTHSQKWSSWDYYMDGNKLFKVMNPMVAYERGLTTWA  270

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS---Rprvpqqlvvlkqvl  351
            KW+++N+DP K++V FR++SP   RE+G  C+N+R PL   S   +P +PQQ  VL +VL
Sbjct  271  KWVEINLDPSKTKVIFRTISP---RESGQMCYNQRHPLPSLSSSRKPHMPQQSRVLNKVL  327

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEK-QHLRGYKSDCSHWCLPGVPDIWN  174
              M + VYL DI+TMSA+RRD HPSV+ + + +EEK  H+ G  SDCSHWCLPGVPDIWN
Sbjct  328  STMKYRVYLHDITTMSAYRRDGHPSVFKRAMHEEEKHHHISGPSSDCSHWCLPGVPDIWN  387

Query  173  EMLNAM  156
            EML+++
Sbjct  388  EMLSSI  393



>ref|XP_006836042.1| hypothetical protein AMTR_s00114p00046060 [Amborella trichopoda]
 gb|ERM98895.1| hypothetical protein AMTR_s00114p00046060 [Amborella trichopoda]
Length=403

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE NA+YW+G D+LVFDSAHWWTH+ +  SWDY MEG   F+ +NPMVAYEKGL TWA
Sbjct  219  DSIEGNAKYWKGVDILVFDSAHWWTHTGSGRSWDYYMEGGRLFKNLNPMVAYEKGLSTWA  278

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRpr-vpqqlvvlkqvlrR  345
            KW+DLN+DPR++RV FRS+SPKHNR+NG KC+N+ EP+   S    VP QLVV++ VLR 
Sbjct  279  KWVDLNLDPRRTRVIFRSVSPKHNRQNGQKCYNQHEPVRRPSYTPHVPPQLVVVRGVLRS  338

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M FPVYL DIS MS +R+D HPSV+   + ++++  L  Y SDCSHWCLPGVPD WNE+L
Sbjct  339  MRFPVYLLDISEMSMYRKDGHPSVFTWPIKEQQRAPLDHYASDCSHWCLPGVPDAWNEIL  398

Query  164  NA  159
             A
Sbjct  399  YA  400



>ref|XP_006291297.1| hypothetical protein CARUB_v10017432mg [Capsella rubella]
 gb|EOA24195.1| hypothetical protein CARUB_v10017432mg [Capsella rubella]
Length=381

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG D LVFDSAHWWTHSQ  SSWDY  +G   F+ MNPMVAYE+GL TWA
Sbjct  192  DSIEDNARYWRGVDALVFDSAHWWTHSQKWSSWDYYKDGNRLFKVMNPMVAYERGLTTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS---Rprvpqqlvvlkqvl  351
            KW+++N+DP K++V FR++SP   RE+G  C+N+R PL   S   +P +PQQ  VL +VL
Sbjct  252  KWVEINLDPSKTKVIFRTLSP---RESGQMCYNQRNPLPSLSSSRKPHMPQQSRVLNKVL  308

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEK-QHLRGYKSDCSHWCLPGVPDIWN  174
              M + VYL DI+TMSA+RRD HPSV+ + + +EEK  H+ G  SDCSHWCLPGVPDIWN
Sbjct  309  STMKYRVYLHDITTMSAYRRDGHPSVFKRAMHEEEKHHHISGPSSDCSHWCLPGVPDIWN  368

Query  173  EMLNAM  156
            EML+++
Sbjct  369  EMLSSI  374



>ref|NP_566996.1| protein TRICHOME BIREFRINGENCE-LIKE 36 [Arabidopsis thaliana]
 sp|Q940H3.1|TBL36_ARATH RecName: Full=Protein trichome birefringence-like 36 [Arabidopsis 
thaliana]
 gb|AAK96825.1| putative protein [Arabidopsis thaliana]
 gb|AAM10080.1| putative protein [Arabidopsis thaliana]
 gb|AEE79205.1| protein trichome birefringence-like 36 [Arabidopsis thaliana]
Length=379

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 145/186 (78%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ  SSWDY M+G   F+ M+PMVAYE+GL TWA
Sbjct  191  DSIEDNARYWRGVDVLVFDSAHWWTHSQRWSSWDYYMDGNKIFKAMDPMVAYERGLTTWA  250

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS---Rprvpqqlvvlkqvl  351
            KW+++N+DP K++V FR++SP   RE+G  C+N++ PL   S   +P VPQQ  VL +VL
Sbjct  251  KWVEINLDPSKTKVIFRTVSP---RESGQMCYNQKHPLPSLSSSTKPHVPQQSRVLNKVL  307

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQH-LRGYKSDCSHWCLPGVPDIWN  174
            R M + VYL DI+TMSA+RRD HPSV+ + + +EEK H + G  SDCSHWCLPGVPDIWN
Sbjct  308  RTMKYRVYLYDITTMSAYRRDGHPSVFKRAMHEEEKHHRIAGPSSDCSHWCLPGVPDIWN  367

Query  173  EMLNAM  156
            EML+++
Sbjct  368  EMLSSI  373



>ref|XP_006403597.1| hypothetical protein EUTSA_v10010451mg [Eutrema salsugineum]
 gb|ESQ45050.1| hypothetical protein EUTSA_v10010451mg [Eutrema salsugineum]
Length=381

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 142/187 (76%), Gaps = 8/187 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ R+SWDY  +G      M+PMVAYE+GL TWA
Sbjct  192  DSIEDNARYWRGVDVLVFDSAHWWTHSQKRNSWDYYKDGNEVLNSMDPMVAYERGLTTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvp----qqlvvlkqv  354
            KW+++N+DP K++V FR++SP   RE+G KC+N+R PL   S         +Q  VLK+V
Sbjct  252  KWVEINLDPSKTKVIFRTISP---RESGQKCYNQRHPLPSSSSSSNNSHVPKQSRVLKKV  308

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEK-QHLRGYKSDCSHWCLPGVPDIW  177
            LRRM + VYL DI+TMSA+RRD HPSV+ + + +EEK  H+ G  SDCSHWCLPGVPDIW
Sbjct  309  LRRMKYRVYLHDITTMSAYRRDGHPSVFKRSMREEEKHHHIAGPLSDCSHWCLPGVPDIW  368

Query  176  NEMLNAM  156
            NEML+++
Sbjct  369  NEMLSSI  375



>emb|CAB71000.1| putative protein [Arabidopsis thaliana]
Length=408

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 143/186 (77%), Gaps = 9/186 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ  SSWDY M+G   F+ M+PMVAYE+GL TWA
Sbjct  222  DSIEDNARYWRGVDVLVFDSAHWWTHSQRWSSWDYYMDGNKIFKAMDPMVAYERGLTTWA  281

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS---Rprvpqqlvvlkqvl  351
            KW+++N+DP K++V FR++SP     +G  C+N++ PL   S   +P VPQQ  VL +VL
Sbjct  282  KWVEINLDPSKTKVIFRTVSP-----SGQMCYNQKHPLPSLSSSTKPHVPQQSRVLNKVL  336

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQH-LRGYKSDCSHWCLPGVPDIWN  174
            R M + VYL DI+TMSA+RRD HPSV+ + + +EEK H + G  SDCSHWCLPGVPDIWN
Sbjct  337  RTMKYRVYLYDITTMSAYRRDGHPSVFKRAMHEEEKHHRIAGPSSDCSHWCLPGVPDIWN  396

Query  173  EMLNAM  156
            EML+++
Sbjct  397  EMLSSI  402



>ref|XP_002877964.1| hypothetical protein ARALYDRAFT_485823 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54223.1| hypothetical protein ARALYDRAFT_485823 [Arabidopsis lyrata subsp. 
lyrata]
Length=379

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 143/186 (77%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IE+NARYWRG DVLVFDSAHWWTHSQ  SSWDY M+G   F+ M+PMVAYE+GL TWA
Sbjct  191  DSIEDNARYWRGVDVLVFDSAHWWTHSQKWSSWDYYMDGNKVFKAMDPMVAYERGLTTWA  250

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNERE---PLEHFSRprvpqqlvvlkqvl  351
            +W+++N+DP K++V FR++SP   RE+G  C+N++     L   S+P VPQQ  VL +VL
Sbjct  251  EWVEINLDPSKTKVIFRTVSP---RESGQMCYNQKHPLPSLSSSSKPHVPQQSRVLNKVL  307

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHL-RGYKSDCSHWCLPGVPDIWN  174
             +M + VYL DI+TMSA+RRD HPSV+ + + +EEK H   G  SDCSHWCLPGVPDIWN
Sbjct  308  SKMKYRVYLHDITTMSAYRRDGHPSVFKRAMHEEEKHHRSTGPSSDCSHWCLPGVPDIWN  367

Query  173  EMLNAM  156
            EML+++
Sbjct  368  EMLSSI  373



>ref|XP_011469321.1| PREDICTED: protein trichome birefringence-like 36 isoform X2 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIEENA+YWRG DVLVFDSAHWWTHS   SSWDY MEG + F  MNPMVAY+KGL TWA
Sbjct  202  DLIEENAKYWRGVDVLVFDSAHWWTHSDKTSSWDYYMEGKSLFTSMNPMVAYQKGLTTWA  261

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlrRM  342
            KW+DLN+DPRK+RV FRSMSP+HNRENGW+C+N+++PL +FS   VP+ L+VL+ VLR+M
Sbjct  262  KWVDLNLDPRKTRVIFRSMSPRHNRENGWRCYNQKQPLANFSHQHVPEPLLVLQGVLRKM  321

Query  341  NFPVYLQDISTMSAFRRDAHP  279
             FPVYLQDI+T+SAFRRD  P
Sbjct  322  RFPVYLQDITTISAFRRDQTP  342



>gb|AFK37199.1| unknown [Medicago truncatula]
Length=138

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -2

Query  566  MNPMVAYEKGLMTWAKWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEHFS-Rp  390
            M+ MVAY+KGL TWA+W+DLN++P+K++V FRSMSP+HNRENGWKC N+++PL  FS + 
Sbjct  1    MSLMVAYQKGLSTWARWVDLNLNPQKTKVIFRSMSPRHNRENGWKCDNQKQPLPFFSLQQ  60

Query  389  rvpqqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCS  210
              P+ LVVL+ VL++M FPVYLQDI+TM+A RRD HPSVY K   Q+EKQ + G+ SDCS
Sbjct  61   HAPEPLVVLQGVLKKMRFPVYLQDITTMTALRRDGHPSVYRKATSQDEKQRM-GHSSDCS  119

Query  209  HWCLPGVPDIWNEMLNAM  156
            HWCLPGVPDIWNEML+A+
Sbjct  120  HWCLPGVPDIWNEMLSAL  137



>gb|ABK25068.1| unknown [Picea sitchensis]
Length=412

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 123/181 (68%), Gaps = 3/181 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D  E N R W+G+D+LVF+S HWWTH+ N   WDY+ EG  F+  M+ MVAY+KG+ TW 
Sbjct  226  DSAEINGRGWKGADILVFNSGHWWTHTGNLRGWDYMQEGNRFYTTMDQMVAYQKGMATWG  285

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNR-ENGWKCFNEREPLEHFSRprvp-qqlvvlkqvlr  348
             WID N+DPR+++VFFRS SP H+   NG  C++E+EP    S       Q  V ++V+R
Sbjct  286  NWIDSNIDPRRTKVFFRSFSPSHSSITNGGNCYSEKEPTAGSSYLGAYPPQFQVAERVVR  345

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             M  PV   +I+T+S  R+DAHPSVY   +   ++++ + Y +DCSHWCLPG+PDIWNE+
Sbjct  346  SMRSPVSFLNITTLSLLRQDAHPSVYSNDLTVGQRKNPQRY-ADCSHWCLPGLPDIWNEL  404

Query  167  L  165
            L
Sbjct  405  L  405



>gb|ABK22287.1| unknown [Picea sitchensis]
 gb|ACN39781.1| unknown [Picea sitchensis]
Length=412

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 123/181 (68%), Gaps = 3/181 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D  E N R W+G+D+LVF+S HWWTH+ N   WDY+ EG  F+  M+ MVAY+KG+ TW 
Sbjct  226  DSAEINGRGWKGADILVFNSGHWWTHTGNLRGWDYMQEGNRFYTTMDQMVAYQKGMATWG  285

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNR-ENGWKCFNEREPLEHFSRprvp-qqlvvlkqvlr  348
             WID N+DPR+++VFFRS SP H+   NG  C++E+EP    S       Q  V ++V+R
Sbjct  286  NWIDSNIDPRRTKVFFRSFSPSHSSITNGGNCYSEKEPTAGSSYLGAYPPQFQVAERVVR  345

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             M  PV   +I+T+S  R+DAHPSVY   +   ++++ + Y +DCSHWCLPG+PDIWNE+
Sbjct  346  SMRSPVSFLNITTLSLLRQDAHPSVYSNDLTVGQRKNPQRY-ADCSHWCLPGLPDIWNEL  404

Query  167  L  165
            L
Sbjct  405  L  405



>gb|ACN40917.1| unknown [Picea sitchensis]
Length=437

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 126/186 (68%), Gaps = 12/186 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D +E N  YW+G DVLVF+S+HWW H +    WD IM+G      M+PMVAY+K LMTW 
Sbjct  246  DSMESNGIYWQGIDVLVFESSHWWQHQR----WDLIMDGNKPDPNMDPMVAYKKALMTWT  301

Query  521  KWIDLNVDPRKSRVFFRSMSPKH------NRENGWKCFNEREPLEHFS-Rprvpqqlvvl  363
            KWI  N+DP++S VFF + SPKH      +  N + C+N+  P++    RP VP Q++++
Sbjct  302  KWISANIDPKRSLVFFSTTSPKHYDPREWSETNVYHCYNQTGPVQFEGFRPPVPPQVLIV  361

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            K+V+  M+FPV L DI+ +S FR+D HPS+Y  V+  EEK+H   +  DCSHWCLPGVPD
Sbjct  362  KEVVESMSFPVTLMDITGLSQFRKDGHPSIYSSVLSNEEKKHPEKF-GDCSHWCLPGVPD  420

Query  182  IWNEML  165
             WNE+L
Sbjct  421  TWNELL  426



>gb|EMT17911.1| hypothetical protein F775_21346 [Aegilops tauschii]
Length=284

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 117/189 (62%), Gaps = 8/189 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA+ WRG+DVL F+S HWWTH+     WDY+ EG  +   M+ MVA+++G+ TWA
Sbjct  93   DDIAENAQAWRGADVLSFNSGHWWTHTGALQGWDYMGEGGRYSEDMDRMVAFQRGMTTWA  152

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHF-SRprvpqqlvvl  363
             W+DLNVDP K+RVFF+SMSP H     W       C+ E  PL    S  +   Q  V 
Sbjct  153  NWVDLNVDPAKTRVFFQSMSPTHYSSKEWPNPVSKNCYGETVPLAGLNSTAQPMGQEQVT  212

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            K VL+ M  PV L DI+ +SA R+DAHPSVY       ++ +  G  +DCSHWCLPG+PD
Sbjct  213  KTVLQGMKSPVRLLDITALSALRKDAHPSVYSGDFSPAQRGNPAG-SADCSHWCLPGLPD  271

Query  182  IWNEMLNAM  156
             WN++   +
Sbjct  272  TWNQLFYTL  280



>dbj|BAK05297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 116/189 (61%), Gaps = 8/189 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA+ WRG+DVL F+S HWWTH+     WDY+ EG  +   M+ MVA+++G+ TWA
Sbjct  187  DYIAENAQAWRGADVLSFNSGHWWTHTGALQGWDYMGEGGRYSEDMDRMVAFQRGMTTWA  246

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSRprv-pqqlvvl  363
             W+DLNVDP K+RVFF+SMSP H     W       C+ E  PL   +       Q  V 
Sbjct  247  NWVDLNVDPAKTRVFFQSMSPTHYSSKEWPNPVSKNCYGETVPLAGPNNTSQPMGQEQVT  306

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            K VL+ M  PV L DI+ +SA R+DAHPSVY       ++ +  G  +DCSHWCLPG+PD
Sbjct  307  KTVLQGMKSPVRLLDITALSALRKDAHPSVYSGDFSPAQRGNPAG-SADCSHWCLPGLPD  365

Query  182  IWNEMLNAM  156
             WN++   +
Sbjct  366  TWNQLFYTL  374



>ref|XP_003561735.1| PREDICTED: protein PMR5 [Brachypodium distachyon]
Length=388

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 119/192 (62%), Gaps = 11/192 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA+ WRG+DVL F+S HWWTH+     WDY+  G  +   M+ M A+++G+ TWA
Sbjct  194  DDIAENAQAWRGADVLSFNSGHWWTHTGALQGWDYMGVGGRYTEDMDRMAAFQRGMTTWA  253

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREP----LEHFSRprvpqql  372
             W+DLNVDP K+RVFF+SMSP H     W       C+ E  P    L   ++P    Q 
Sbjct  254  NWVDLNVDPAKTRVFFQSMSPTHYSSKEWPNPVSKNCYGETAPLMTGLNSTAQPASTGQQ  313

Query  371  vvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPG  192
             V++ VL+ M  PV+L DI+ +SA R+DAHPSVY   +   ++ +L    +DCSHWCLPG
Sbjct  314  QVIQTVLQGMRSPVHLLDITALSALRKDAHPSVYSGDLSPPQRANLAA-SADCSHWCLPG  372

Query  191  VPDIWNEMLNAM  156
            +PD WN++   +
Sbjct  373  LPDTWNQLFYTL  384



>ref|XP_006649908.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=388

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 109/192 (57%), Gaps = 10/192 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I EN   WRG+DVL F+S HWWTH+     WDY+     ++  M+ MVA+++G+ TWA
Sbjct  193  DDISENGEAWRGADVLSFNSGHWWTHTGALQGWDYMGADGQYYEDMDRMVAFQRGMATWA  252

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSRprvpqqlvvl-  363
             W+D NVDP K+RVFF+SMSP H     W       C+ E  P    +    P       
Sbjct  253  NWVDANVDPAKTRVFFQSMSPTHYSSKEWASPVSKNCYGETAPAAGVNATAPPLATSGQD  312

Query  362  ---kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPG  192
               +  LR M   V L DI+ +SA R+DAHPSVY   +   ++    G  +DCSHWCLPG
Sbjct  313  RVIQATLRSMKSQVRLLDITALSALRKDAHPSVYSGDLSPAQRASGGGAAADCSHWCLPG  372

Query  191  VPDIWNEMLNAM  156
            +PD WN++  A+
Sbjct  373  LPDTWNQLFYAL  384



>ref|XP_006846293.1| hypothetical protein AMTR_s00012p00251740 [Amborella trichopoda]
 gb|ERN07968.1| hypothetical protein AMTR_s00012p00251740 [Amborella trichopoda]
Length=394

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 122/184 (66%), Gaps = 9/184 (5%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            IE NA+ WRG D+L+F+SAH+WTH     SWDYI      +  ++ M  Y+KG+ TWA W
Sbjct  207  IEGNAQAWRGVDILIFNSAHYWTHLGGLKSWDYIEYENGLYEDLDRMFIYQKGMETWASW  266

Query  515  IDLNVDPRKSRVFFRSMSPKH------NRENGWKCFNEREPLEHFS-Rprvpqqlvvlkq  357
            ID N+DP+K+RVFFRS+SP H      +  NG +C NE EP+   +    +P Q+ +++ 
Sbjct  267  IDSNLDPQKTRVFFRSISPIHTDPSQWDEPNGNRCVNETEPITQDAFLSPIPPQMTIIET  326

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            VL++M FPVY  +I+ +S +R+DAHPSVY    G  E ++     +DCSHWC+ GVPDIW
Sbjct  327  VLKQMKFPVYFFNITRLSDYRKDAHPSVYTS--GDGEMRYGSASPADCSHWCVSGVPDIW  384

Query  176  NEML  165
            NE+L
Sbjct  385  NELL  388



>ref|XP_004984854.1| PREDICTED: uncharacterized protein LOC101772831 isoform X2 [Setaria 
italica]
Length=392

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 111/193 (58%), Gaps = 12/193 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA  WR +DVL F+S HWWTH+     WDY+ E   ++  M+  VA+++GL TWA
Sbjct  197  DDITENAEAWRDADVLSFNSGHWWTHTGAMQGWDYMGEAGRYYEDMDRTVAFQRGLTTWA  256

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSRprvpqqlvvlk  360
             W+DLNVDP K+RVFF++MSP H     W       C+ E  P+   +      Q    +
Sbjct  257  NWVDLNVDPAKTRVFFQAMSPTHYSSKEWPNPVSKNCYGETTPVVGLNSTTTTGQASSGQ  316

Query  359  qvlrR-----MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + + +     M  PV L DI+ +SA R+DAHPSVY       ++ +  G   DCSHWCLP
Sbjct  317  EQVIQAVLRGMKSPVRLLDITALSAMRKDAHPSVYSGDFSPAQRANPGG-SVDCSHWCLP  375

Query  194  GVPDIWNEMLNAM  156
            G+PD WN++   +
Sbjct  376  GLPDTWNQLFYTL  388



>gb|EAY89580.1| hypothetical protein OsI_11109 [Oryza sativa Indica Group]
Length=395

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 113/197 (57%), Gaps = 15/197 (8%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I EN   WRG+DVL F+S HWWTH+     WDY+     ++  M+ MVA+++G+ TWA
Sbjct  195  DDISENGEAWRGADVLSFNSGHWWTHTGTLQGWDYMGADGRYYEDMDRMVAFQRGMATWA  254

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK------CFNE---------REPLEHFSRpr  387
             W+D NVDP K+RVFF+SMSP H     W       C+ E            L   +   
Sbjct  255  NWVDANVDPAKTRVFFQSMSPTHYSSKEWANPVSKNCYGETAPAAAAAAAAGLNATTAQA  314

Query  386  vpqqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSH  207
               Q  V++  LR M  PV L DIS +SA R+DAHPSVY   +   ++ +  G  +DCSH
Sbjct  315  TSGQDQVIQATLRSMKSPVRLLDISALSALRKDAHPSVYSGDLSPAQRANPGGGSADCSH  374

Query  206  WCLPGVPDIWNEMLNAM  156
            WCLPG+PD WN++  A+
Sbjct  375  WCLPGLPDTWNQLFYAL  391



>gb|ACG43356.1| hypothetical protein [Zea mays]
Length=391

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 111/189 (59%), Gaps = 7/189 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA  WR +DVL F+S HWWTH+ +   WDY+ E   ++  M+  VA+++GL TWA
Sbjct  199  DDISENAESWRDADVLSFNSGHWWTHTSSMQGWDYMGESGRYYEDMDRTVAFQRGLTTWA  258

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHF-SRprvpqqlvvl  363
             W+DLN+D  K+RVFF+SMSP H     W       C+ E  P     S  +   Q  V+
Sbjct  259  SWVDLNLDQAKTRVFFQSMSPTHYSSKEWPNPVSKNCYGETAPATGLNSTGQASGQDQVI  318

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            + VLR M  PV L DI+ +SA R+DAHPS Y       ++ +      DCSHWCLPG+PD
Sbjct  319  QAVLRGMKSPVRLLDITALSAMRKDAHPSAYSGDFSPAQRANPGAGSVDCSHWCLPGLPD  378

Query  182  IWNEMLNAM  156
             WN++   +
Sbjct  379  TWNQLFYTL  387



>gb|KDP21076.1| hypothetical protein JCGZ_21547 [Jatropha curcas]
Length=367

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 112/183 (61%), Gaps = 16/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  + W+G D+L+F+S HWWTH+     WDY+ +G   ++ MN + A+ KGL TWAKW+D
Sbjct  191  EAGKAWKGMDMLIFNSWHWWTHTGKSQPWDYMRDGPALYKDMNRLEAFYKGLSTWAKWVD  250

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            LNVDP K++VFF+ +SP H     W      C+ E +PL   +     P  + V+ QV+ 
Sbjct  251  LNVDPSKTKVFFQGISPTHYEGRDWNQPRKNCYGEAQPLSGSTYPGGAPPAVAVVNQVIS  310

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             M  P+YL DI+T+S  R+DAHPS Y             G  +DCSHWCLPG+PDIWN++
Sbjct  311  TMKKPIYLLDITTLSQLRKDAHPSTYSG----------EGSGTDCSHWCLPGLPDIWNQL  360

Query  167  LNA  159
            L A
Sbjct  361  LYA  363



>ref|XP_010538205.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=250

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 110/185 (59%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+G D+L+F+S HWWTH      WDY+ EG+   R M+ +VA+ KGL TWA+W
Sbjct  73   IDGGADLWKGMDLLIFNSWHWWTHKGQSQGWDYMREGSALMRDMDRLVAFYKGLTTWAQW  132

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +DLNVD   +RVFF+ +SP H     W      C  + EPL   +     P    V+++V
Sbjct  133  VDLNVDTAVTRVFFQGISPTHYEGREWNEPRKSCNGQMEPLSGSTYPGGEPPAAAVVEKV  192

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PVYL DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  193  LSSMRTPVYLLDITTLSQLRKDAHPSTYGGDGG-----------TDCSHWCLPGLPDTWN  241

Query  173  EMLNA  159
            ++L A
Sbjct  242  QLLYA  246



>gb|KHN27090.1| hypothetical protein glysoja_032858 [Glycine soja]
Length=295

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 115/185 (62%), Gaps = 4/185 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DL+E +   ++ +DVL+F++ HWWTH +      Y  EG + +  MN   A+ K L+TWA
Sbjct  96   DLLERSCDKYKDADVLIFNTGHWWTHEKRIEGKGYYQEGDHIYGQMNVEEAFHKALLTWA  155

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
            +WID NVDP+K+ VFFR  SP H R   W    KC NE EP+E  S    P+ ++ +  V
Sbjct  156  QWIDSNVDPKKTTVFFRGYSPSHFRGGEWNSGGKCDNETEPMESESDLETPEMMMTIDSV  215

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV+  +I+ M+ FRRDAHPS++      EE +       DCSHWCLPGVPD+WN
Sbjct  216  IKKMKTPVFYLNITKMTYFRRDAHPSLFRNENMTEETKRYMLSHQDCSHWCLPGVPDLWN  275

Query  173  EMLNA  159
            E++ A
Sbjct  276  ELVYA  280



>ref|NP_001142288.1| uncharacterized protein LOC100274457 [Zea mays]
 gb|ACF88098.1| unknown [Zea mays]
 gb|AFW88699.1| putative DUF231 domain containing family protein [Zea mays]
Length=391

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 111/189 (59%), Gaps = 7/189 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA  WR +DVL F+S HWWTH+ +   WDY+ E   ++  M+  VA+++GL TWA
Sbjct  199  DDISENAESWRDADVLSFNSGHWWTHTGSMQGWDYMGESGRYYEDMDRTVAFQRGLTTWA  258

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHF-SRprvpqqlvvl  363
             W+DLN+D  K+RVFF+SMSP H     W       C+ E  P     S  +   Q  V+
Sbjct  259  SWVDLNLDQAKTRVFFQSMSPTHYSSKEWPNPVSKNCYGETAPATGLNSTGQASGQDQVI  318

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            + VLR M  PV L DI+ +SA R+DAHPS Y       ++ +      DCSHWCLPG+PD
Sbjct  319  QAVLRGMKSPVRLLDITALSAMRKDAHPSAYSGDFSPAQRANPGAGSVDCSHWCLPGLPD  378

Query  182  IWNEMLNAM  156
             WN++   +
Sbjct  379  TWNQLFYTL  387



>ref|XP_002468040.1| hypothetical protein SORBIDRAFT_01g038480 [Sorghum bicolor]
 gb|EER95038.1| hypothetical protein SORBIDRAFT_01g038480 [Sorghum bicolor]
Length=394

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 112/190 (59%), Gaps = 8/190 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I ENA  WR +DVL F+S HWWTH+ +   WDY+     ++  M+  VA+++GL TWA
Sbjct  201  DDISENAEAWRDADVLSFNSGHWWTHTGSMQGWDYMGTSGRYYEDMDRTVAFQRGLTTWA  260

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHF-SRprvpqqlvvl  363
             W+DLN+D  K+RVFF+SMSP H     W       C+ E  P+    S  +   Q  V+
Sbjct  261  NWVDLNLDQAKTRVFFQSMSPTHYSSKEWPNPVSKNCYGETAPVTGLNSTGQASGQDQVI  320

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVP  186
            + VLR M  PV L DI+ +SA R+DAHPSVY G     +      G   DCSHWCLPG+P
Sbjct  321  QAVLRGMKSPVRLLDITALSAMRKDAHPSVYSGDFSPAQRANPGAGGSVDCSHWCLPGLP  380

Query  185  DIWNEMLNAM  156
            D WN++   +
Sbjct  381  DTWNQLFYTL  390



>ref|XP_011042254.1| PREDICTED: protein trichome birefringence-like 6 [Populus euphratica]
Length=550

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 115/184 (63%), Gaps = 8/184 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+L+F++AHWW+H + ++  +Y  EG      ++  +A+ + LMTWA
Sbjct  361  DAIDHGSSRWRGADILIFNTAHWWSHFKTKAGINYYQEGNQVHPQLDVSIAFRRALMTWA  420

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK+RVFFRS +P H R   W    +C +  +PL   SR    ++  ++++ 
Sbjct  421  SWVDRHINPRKTRVFFRSSAPSHFRGGQWNSGGQCMDATQPLNETSRTGYSEKNSIVEET  480

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            ++ M  PV L +I+  S FR D HPS+YG+  G+     ++    DCSHWCLPGVPD WN
Sbjct  481  IKHMKTPVTLLNITGFSGFRTDGHPSIYGRRPGKRYASSIQ----DCSHWCLPGVPDTWN  536

Query  173  EMLN  162
            E L+
Sbjct  537  EFLS  540



>ref|XP_003599941.1| hypothetical protein MTR_3g049330 [Medicago truncatula]
 gb|AES70192.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=351

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 110/184 (60%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++AR W+G DVL+FDS HWW H+  +  WD I EG N FR M+ +VAYEKGL TWAKWID
Sbjct  174  QSARNWKGIDVLIFDSWHWWLHTGRKQPWDLIQEGNNTFRDMDRLVAYEKGLKTWAKWID  233

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLE-HFSRprvpqqlvvlkqvl  351
             NVD  K++VFF+ +SP H     W       C  + +PL             + L++V+
Sbjct  234  DNVDITKTKVFFQGISPDHLNSRQWGDPKANFCEGQEKPLSGSMYPGGPVPAQLALERVI  293

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M  PVYL DI+T+S  R+D HPSVYG         H      DCSHWCL GVPD WN+
Sbjct  294  RAMKKPVYLLDITTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPDTWNQ  344

Query  170  MLNA  159
            +L A
Sbjct  345  LLYA  348



>ref|NP_001049797.1| Os03g0290900 [Oryza sativa Japonica Group]
 gb|ABF95399.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11711.1| Os03g0290900 [Oryza sativa Japonica Group]
 gb|EAZ26555.1| hypothetical protein OsJ_10450 [Oryza sativa Japonica Group]
 dbj|BAG88804.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 112/195 (57%), Gaps = 13/195 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   WRG+DVL F+S HWWTH+     WDY+     ++  M+ MVA+++G+ TWA
Sbjct  195  DDISGNGEAWRGADVLSFNSGHWWTHTGTLQGWDYMGADGRYYEDMDRMVAFQRGMATWA  254

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK------CFNE-------REPLEHFSRprvp  381
             W+D NVDP K+RVF++SMSP H     W       C+ E          L   +     
Sbjct  255  NWVDANVDPAKTRVFYQSMSPTHYSSKEWANPVSKNCYGETAPAAAAAAGLNATTAQATS  314

Query  380  qqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWC  201
             Q  V++  LR M  PV L DIS +SA R+DAHPSVY   +   ++ +  G  +DCSHWC
Sbjct  315  GQDQVIQATLRSMKSPVRLLDISALSALRKDAHPSVYSGDLSPAQRANPGGGSADCSHWC  374

Query  200  LPGVPDIWNEMLNAM  156
            LPG+PD WN++  A+
Sbjct  375  LPGLPDTWNQLFYAL  389



>gb|KHN37297.1| hypothetical protein glysoja_013512 [Glycine soja]
Length=526

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 122/186 (66%), Gaps = 6/186 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D++E +   ++ +DVL+F++ HWWTH +      Y  EG + +  MN   A+ K L+TWA
Sbjct  327  DVLERSCDKYKDADVLIFNTGHWWTHEKRIEGKGYYQEGNHIYGQMNVEEAFHKALLTWA  386

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
            +WID N+DP+K+ VFFR  SP H R   W    KC NE EPLE  S    P+ ++ +  V
Sbjct  387  QWIDSNIDPKKTTVFFRGYSPSHFRGGEWNSGGKCDNETEPLESESDLETPEMMMTIDSV  446

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            +++M  PV+  +I+ M+ FRRDAHPS++  + + +E K+H+  ++ DCSHWCLPGVPD+W
Sbjct  447  IKKMKTPVFYLNITKMTYFRRDAHPSLFRNENMTEETKRHMLTHQ-DCSHWCLPGVPDLW  505

Query  176  NEMLNA  159
            NE++ A
Sbjct  506  NELVYA  511



>ref|XP_006448025.1| hypothetical protein CICLE_v10018196mg, partial [Citrus clementina]
 gb|ESR61265.1| hypothetical protein CICLE_v10018196mg, partial [Citrus clementina]
Length=329

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 16/185 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E+   W+  DVL+F++ HWW HS  +  WDYI +G+   R MN +VA+EK L TWAKW+D
Sbjct  148  ESGALWKDKDVLIFNTWHWWLHSGRKQEWDYIEDGSRTMRDMNRLVAFEKALNTWAKWVD  207

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-------KCFNEREP-LEHFSRprvpqqlvvlkqv  354
             N+DP K++VF++ +SP H     W        C  E +P + H  R   P   +V+++V
Sbjct  208  TNIDPTKTKVFYQGVSPDHTNATSWGHSNATKDCREETQPFIVHKYRRGSPAAELVVEKV  267

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +  M+ PV+L  ++ +S  R+DAHPS+YG V G  E        +DCSHWCL GVPD WN
Sbjct  268  ISNMSKPVHLLGVTMLSQLRKDAHPSIYGGVGGHME--------ADCSHWCLAGVPDTWN  319

Query  173  EMLNA  159
            ++L A
Sbjct  320  QLLYA  324



>gb|KJB69610.1| hypothetical protein B456_011G033800 [Gossypium raimondii]
Length=365

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 110/179 (61%), Gaps = 18/179 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W G D+L+F+S HWWTH     +WDYI +G+  ++ MN + AY KGL TWA W+D NVDP
Sbjct  194  WIGMDLLIFNSWHWWTHKGKSQAWDYIRDGSALYKDMNRLEAYNKGLTTWANWVDTNVDP  253

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C+ E+EPL   + +   P    ++ +VL  MN P
Sbjct  254  TKTKVFFQGISPTHYEGREWNQPKRSCYGEQEPLSGSTYQAGAPPSAAIVNKVLGSMNKP  313

Query  332  VYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN++L A
Sbjct  314  VYLLDITTLSQLRKDAHPSTYSGDHSG-----------NDCSHWCLPGLPDTWNQLLYA  361



>ref|XP_010920821.1| PREDICTED: protein PMR5 [Elaeis guineensis]
Length=382

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 115/186 (62%), Gaps = 8/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   W+G+DVL F+S HWWTH  +   WDY+ +G N+   M+ +VA++KGL TWA
Sbjct  192  DDISANGNAWKGADVLCFNSGHWWTHKGSLQGWDYMRDGGNYCADMDRLVAFQKGLSTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFS-Rprvpqqlvvl  363
             W+D+N+D  +++VFF+S+SP H     W       CF +  P+  F+     P Q+ V+
Sbjct  252  NWVDVNIDRTRTKVFFQSISPTHYNPTEWGDPTSKNCFGQTVPVSGFNYSGVYPSQMQVV  311

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            + VLR M  P YL DI+T+S  R+D HPS+Y   +  E++ +     +DCSHWCLPGVPD
Sbjct  312  QGVLRAMQSPAYLLDITTLSELRKDGHPSIYSGDLSPEQRAN-PDRSADCSHWCLPGVPD  370

Query  182  IWNEML  165
             WN + 
Sbjct  371  TWNRLF  376



>ref|XP_011003951.1| PREDICTED: protein PMR5-like [Populus euphratica]
Length=394

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 116/190 (61%), Gaps = 12/190 (6%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WR +DVLVF++ HWW+H  +   WDY+  G  F++ M+ +VA E+GL TWAKW
Sbjct  202  ISGNANAWRNADVLVFNTGHWWSHQGSLQGWDYMESGGTFYQDMDRLVALERGLRTWAKW  261

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGWK----------CFNEREPLEHFSR-prvpqqlv  369
            +D N+D  ++RVFF+S+SP H   + W           C+ E  P+   +     P Q+ 
Sbjct  262  VDSNIDTARTRVFFQSISPTHYNPSEWSAGTTVTTTRNCYGETTPMNGMTYPGAYPDQMR  321

Query  368  vlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGV  189
            V+  V+R M+ P YL DI+ +S  R+D HPS+Y  V+  +++    G  +DCSHWCLPG+
Sbjct  322  VVDTVIRDMHNPAYLLDITMLSELRKDGHPSIYSGVLSPQQRADPSG-SADCSHWCLPGL  380

Query  188  PDIWNEMLNA  159
            PD WN++  A
Sbjct  381  PDTWNQLFYA  390



>ref|XP_008792962.1| PREDICTED: protein PMR5 [Phoenix dactylifera]
Length=382

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 118/186 (63%), Gaps = 8/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   W+G+DVL F+S HWWTH+ +   WDY+ +G N++  M+ ++A++KGL TWA
Sbjct  192  DDISANGNAWKGADVLSFNSGHWWTHTGSLQGWDYMGDGGNYYVDMDRLIAFQKGLSTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFS-Rprvpqqlvvl  363
             W+DLN+D  +++VFF+S+SP H     W       CF +  P+  F+     P Q+ VL
Sbjct  252  NWVDLNIDRTRTKVFFQSISPTHYNPIEWGDPTSKNCFGQTVPISGFNYSGLYPSQMQVL  311

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            + VLR M  P +L DI+T+S  R+D HPS+Y   +  E++ +     +DCSHWCLPG+PD
Sbjct  312  QGVLRAMQSPAFLLDITTLSELRKDGHPSIYSGDLSPEQRAN-PDRSADCSHWCLPGLPD  370

Query  182  IWNEML  165
             WN++ 
Sbjct  371  TWNQLF  376



>gb|KDO58612.1| hypothetical protein CISIN_1g018724mg [Citrus sinensis]
Length=351

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 16/185 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E+   W+  DVL+F++ HWW HS  +  WDYI +G+   R MN +VA+EK L TWAKW+D
Sbjct  170  ESGALWKDKDVLIFNTWHWWLHSGRKQEWDYIEDGSRTMRDMNRLVAFEKALNTWAKWVD  229

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-------KCFNEREP-LEHFSRprvpqqlvvlkqv  354
             N+DP K++VF++ +SP H     W        C  E +P + H  R   P   +V+++V
Sbjct  230  ANIDPTKTKVFYQGVSPDHTNATSWGHSNATKDCREETQPFIGHKYRRGSPAAELVVEKV  289

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +  M+ PV+L  ++ +S  R+DAHPS+YG V G  E        +DCSHWCL GVPD WN
Sbjct  290  ISNMSKPVHLLGVTMLSQLRKDAHPSIYGGVGGHME--------ADCSHWCLAGVPDTWN  341

Query  173  EMLNA  159
            ++L A
Sbjct  342  QLLYA  346



>ref|XP_006492301.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=351

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 16/185 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E+   W+  DVL+F++ HWW HS  +  WDYI +G+   R MN +VA+EK L TWAKW+D
Sbjct  170  ESGALWKDKDVLIFNTWHWWLHSGRKQEWDYIEDGSRTMRDMNRLVAFEKALNTWAKWVD  229

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-------KCFNEREP-LEHFSRprvpqqlvvlkqv  354
             N+DP K++VF++ +SP H     W        C  E +P + H  R   P   +V+++V
Sbjct  230  ANIDPTKTKVFYQGVSPDHTNATSWGHSNATKDCREETQPFIGHKYRRGSPAAELVVEKV  289

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +  M+ PV+L  ++ +S  R+DAHPS+YG V G  E        +DCSHWCL GVPD WN
Sbjct  290  ISNMSKPVHLLGVTMLSQLRKDAHPSIYGGVGGHME--------ADCSHWCLAGVPDTWN  341

Query  173  EMLNA  159
            ++L A
Sbjct  342  QLLYA  346



>ref|XP_006590231.1| PREDICTED: protein YLS7-like [Glycine max]
Length=524

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 122/186 (66%), Gaps = 6/186 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D++E +   ++ +DVL+F++ HWWTH +      Y  EG + +  MN   A+ K L+TWA
Sbjct  327  DVLERSCDKYKDADVLIFNTGHWWTHEKRIEGKGYYQEGNHIYGQMNVEEAFHKALLTWA  386

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
            +WID N+DP+K+ VFFR  SP H R   W    KC NE EPLE  S    P+ ++ +  V
Sbjct  387  QWIDSNIDPKKTTVFFRGYSPSHFRGGEWNSGGKCDNETEPLESESDLETPEMMMTIDSV  446

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            +++M  PV+  +I+ M+ FRRDAHPS++  + + +E K+H+  ++ DCSHWCLPGVPD+W
Sbjct  447  IKKMKTPVFYLNITKMTYFRRDAHPSLFRNENMTEETKRHMLIHQ-DCSHWCLPGVPDLW  505

Query  176  NEMLNA  159
            NE++ A
Sbjct  506  NELVYA  511



>ref|XP_004500278.1| PREDICTED: uncharacterized protein LOC101504380 [Cicer arietinum]
Length=388

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 115/190 (61%), Gaps = 14/190 (7%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            ++ N   WR  DVL F+S HWWTH  +   WDYI  G  +++ M+ + A+EKGL TW+ W
Sbjct  194  VDGNGDAWRNVDVLSFNSGHWWTHQGSLQGWDYIESGGKYYQDMDRLAAFEKGLKTWSNW  253

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGWK----------CFNEREPLEHFSRp---rvpqq  375
            +D N+D R+++VFF  +SP H   N W           C+ E  P+           P+Q
Sbjct  254  VDTNIDQRRTKVFFLGISPSHTNPNEWSSGVTTVTSKNCYGETSPIIGTGTTYPGMYPEQ  313

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + V+  V+R MN PVYL DI+ +SAFR+DAHPS+Y   +  +++ +   Y +DCSHWCLP
Sbjct  314  MRVVDMVIREMNNPVYLLDITMLSAFRKDAHPSIYSGDLSPQQRAN-PTYSADCSHWCLP  372

Query  194  GVPDIWNEML  165
            G+PD WN++ 
Sbjct  373  GLPDTWNQLF  382



>ref|XP_002301513.2| hypothetical protein POPTR_0002s19680g [Populus trichocarpa]
 gb|EEE80786.2| hypothetical protein POPTR_0002s19680g [Populus trichocarpa]
Length=492

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+L+F++AHWW+H + ++  +Y  EG      ++  +A+ + LMTWA
Sbjct  297  DAIDHGSSRWRGADILIFNTAHWWSHFKTKAGINYYQEGNQVHPQLDVSIAFRRALMTWA  356

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK+RVFFRS +P H R   W    +C    +PL   S     ++  ++++ 
Sbjct  357  SWVDRHINPRKTRVFFRSSAPSHFRGGQWNSGGQCMGATQPLNETSSTGYSEKNSIVEET  416

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            ++ M  PV   +I+  S FR D HPS+YGK  G+     ++    DCSHWCLPGVPD WN
Sbjct  417  IKHMKTPVTFLNITGFSGFRTDGHPSIYGKRPGKRYASSIQ----DCSHWCLPGVPDTWN  472

Query  173  EMLNA  159
            E L++
Sbjct  473  EFLSS  477



>ref|XP_003555633.2| PREDICTED: protein YLS7-like [Glycine max]
Length=525

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 115/185 (62%), Gaps = 4/185 (2%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DL+E +   ++ +DVL+F++ HWWTH +      Y  EG + +  MN   A+ K L+TWA
Sbjct  326  DLLERSCDKYKDADVLIFNTGHWWTHEKRIEGKGYYQEGDHIYGQMNVEEAFHKALLTWA  385

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
            +WID NVDP+K+ VFFR  SP H R   W    KC NE EP+E  S    P+ ++ +  V
Sbjct  386  QWIDSNVDPKKTTVFFRGYSPSHFRGGEWNSGGKCDNETEPMESESDLETPEMMMTIDSV  445

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV+  +I+ M+ FRRDAHPS++      EE +       DCSHWCLPGVPD+WN
Sbjct  446  IKKMKTPVFYLNITKMTYFRRDAHPSLFRNENMTEETKRYMLSHQDCSHWCLPGVPDLWN  505

Query  173  EMLNA  159
            E++ A
Sbjct  506  ELVYA  510



>gb|KJB49816.1| hypothetical protein B456_008G139200 [Gossypium raimondii]
Length=306

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  W+G+DVLVF++AHWW+H + ++  +Y  EG      ++   A+ K LMTWA
Sbjct  110  DAIDHGSSKWKGADVLVFNTAHWWSHFKTKAGINYYQEGNQVHPKLDVSTAFRKALMTWA  169

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK+RVFFR+++P H R   W     C     PL   S    P++  ++++V
Sbjct  170  GWVDRHINPRKTRVFFRNLAPSHFRGGLWNSGGHCMEATWPLNDTSGMEYPEKNRIVEEV  229

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            + +M  PV L +++ +SA+R D HPS+YGK  G     +++    DCSHWCLPGVPD WN
Sbjct  230  ILQMKTPVTLLNVTGLSAYRIDGHPSIYGKKTGTRYSSNIQ----DCSHWCLPGVPDTWN  285

Query  173  EML  165
            E+L
Sbjct  286  EIL  288



>ref|XP_002316834.2| hypothetical protein POPTR_0011s07550g [Populus trichocarpa]
 gb|EEE97446.2| hypothetical protein POPTR_0011s07550g [Populus trichocarpa]
Length=224

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 106/183 (58%), Gaps = 17/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G D+L+F+S HWW H+     WDYI +G+  ++ M+ + A+ KGL TW +W+D
Sbjct  49   EAGNAWKGMDILIFNSWHWWVHTGRSQGWDYIRDGSALYKNMDRLTAFGKGLTTWGRWVD  108

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             N+DP K++VFF+ +SP H +   W      C  E  PL   +     P    V+ +VL 
Sbjct  109  QNIDPSKTKVFFQGISPTHYQGKDWNQPKKSCSGEAVPLSGSTYPAGSPPAAAVVNKVLS  168

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             M  PVYL DI+T+S  R+DAHPS Y             G  +DCSHWCLPG+PD WN++
Sbjct  169  SMKKPVYLLDITTLSQLRKDAHPSTYSD-----------GSGTDCSHWCLPGLPDTWNQL  217

Query  167  LNA  159
            L A
Sbjct  218  LYA  220



>ref|XP_006467669.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=366

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 111/184 (60%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  ++W+  DVL+F+S HWWTH+     WDYI +G    + M+ + A+ KG+ TWA+W+D
Sbjct  190  QAGKFWKDMDVLIFNSWHWWTHTGKAQPWDYIQDGQTLLKDMDRLEAFYKGMSTWARWVD  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            LNVDP K++VFF+ +SP H     W      C  E EPL   +     P    V+ +VL 
Sbjct  250  LNVDPSKTKVFFQGISPTHYTGKEWNSRKKNCLGELEPLSGSTYPGGAPPAASVVNKVLS  309

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
             +N PVYL DI+T+S  R+DAHPS Y GK  G           +DCSHWCLPG+PD WN+
Sbjct  310  SINKPVYLLDITTLSQLRKDAHPSTYSGKHSG-----------TDCSHWCLPGLPDTWNQ  358

Query  170  MLNA  159
            +L A
Sbjct  359  LLYA  362



>ref|XP_011096427.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=409

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 115/184 (63%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +    WRG D+LVF++ HWWTH     SWDYI +G+   + MN +VA+ KGL TWA+W++
Sbjct  233  QQGNAWRGMDMLVFNTWHWWTHKGKAQSWDYIQDGSTISKDMNRLVAFYKGLTTWARWVE  292

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            LNVDP K++VFF+ +SP H +   WK     C  E++PL   +     P ++ V+ +VL 
Sbjct  293  LNVDPTKTKVFFQGISPTHYQGRDWKSASGNCNGEQQPLTGSTYPAGTPPEVQVVNKVLS  352

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R+  PVYL DI+T+S  R+DAHPS Y G   G            DCSHWCLPG+PD WN+
Sbjct  353  RIKKPVYLLDITTLSQLRKDAHPSAYSGDHSG-----------VDCSHWCLPGLPDTWNQ  401

Query  170  MLNA  159
            +L A
Sbjct  402  LLYA  405



>gb|AFK45250.1| unknown [Lotus japonicus]
Length=361

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 115/186 (62%), Gaps = 18/186 (10%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+L+F+S HWW H+     WDYI +G N  + M+ + AY KGL TWA+
Sbjct  183  IVAGNA--WKGMDMLIFNSWHWWIHTGKSQGWDYIRDGPNLVKNMDRLEAYTKGLTTWAR  240

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkq  357
            W+DLNVDP K++VFF+ +SP H +   W      C  + EPL   +    +PQ   +L  
Sbjct  241  WVDLNVDPSKTKVFFQGISPTHYQGKEWNQPKRSCSGQLEPLAGSTYPAGLPQAANILNS  300

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            VL++MN PVYL DI+ +S  R+DAHPS YG+              +DCSHWCLPG+PD W
Sbjct  301  VLKKMNNPVYLLDITLLSQLRKDAHPSTYGE----------DHSGNDCSHWCLPGLPDTW  350

Query  176  NEMLNA  159
            N++L A
Sbjct  351  NQLLYA  356



>gb|KDO77820.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=366

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 111/184 (60%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  ++W+  DVL+F+S HWWTH+     WDYI +G    + M+ + A+ KG+ TWA+W+D
Sbjct  190  QAGKFWKDMDVLIFNSWHWWTHTGKAQPWDYIQDGQTLLKDMDRLEAFYKGMSTWARWVD  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            LNVDP +++VFF+ +SP H     W      C  E EPL   +     P    V+ +VL 
Sbjct  250  LNVDPSQTKVFFQGISPTHYTGKEWNSRKKNCLGELEPLSGSTYPGGAPPAASVVNKVLS  309

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
             +N PVYL DI+T+S  R+DAHPS Y GK  G           +DCSHWCLPG+PD WN+
Sbjct  310  SINKPVYLLDITTLSQLRKDAHPSTYSGKHSG-----------TDCSHWCLPGLPDTWNQ  358

Query  170  MLNA  159
            +L A
Sbjct  359  LLYA  362



>ref|XP_006449479.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
 gb|ESR62719.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
Length=366

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 111/183 (61%), Gaps = 16/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  ++W   DVL+F+S HWWTH+     WDYI +G    + M+ + A+ KG+ TWA+W+D
Sbjct  190  QAGKFWEDMDVLIFNSWHWWTHTGKAQPWDYIQDGQTLLKDMDRLEAFYKGMSTWARWVD  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            LNVDP K++VFF+ +SP H +   W      C  E EPL   +    VP    V+ +VL 
Sbjct  250  LNVDPSKTKVFFQGISPTHYKGKEWNSRKKNCLGELEPLSGSTYPGGVPPAASVVNKVLS  309

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             +N PVYL DI+T+S  R+DAHPS Y    G+          +DCSHWCLPG+PD WN++
Sbjct  310  SINKPVYLLDITTLSQLRKDAHPSTYS---GEHS-------GTDCSHWCLPGLPDTWNQL  359

Query  167  LNA  159
            L A
Sbjct  360  LYA  362



>emb|CAN60202.1| hypothetical protein VITISV_036403 [Vitis vinifera]
Length=367

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 111/178 (62%), Gaps = 16/178 (9%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+  D+L+F++ HWWTH  N   WDY+ EGT  ++ M+ + A+ KGL TWA W+DLN+DP
Sbjct  194  WKQMDMLIFNTWHWWTHKGNSQGWDYMSEGTKLYKDMDRLTAFYKGLSTWASWVDLNIDP  253

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C+ E EPL   +     P    ++ QVL ++  P
Sbjct  254  SKTKVFFQGISPTHYMGKEWNSQSKNCYGELEPLSGPTYPAGAPAAAAIVNQVLSKIRKP  313

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS YG     E++  +     DCSHWCLPG+PD WN++L A
Sbjct  314  VYLLDITTLSQLRKDAHPSAYG-----EDRTGM-----DCSHWCLPGLPDTWNQLLXA  361



>emb|CDP09209.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 115/189 (61%), Gaps = 11/189 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   WRG DVL F++ HWW+H      WDY+  G + +R M+ + A E+GL TWA
Sbjct  148  DDIRGNGNAWRGVDVLSFNTGHWWSHRGALQGWDYMESGGSLYRDMDRLAALEQGLRTWA  207

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW---------KCFNEREPLEHFS-Rprvpqql  372
            +W+D N+D   +RVFF+S+SP H   + W          C+ E  P+   +     P Q+
Sbjct  208  RWVDANIDASSTRVFFQSISPTHYNPSEWSTGSATAAKSCYGETSPMTGTTYPGTYPDQM  267

Query  371  vvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPG  192
             V+K V+R MN+P +L DI+ +SA R+DAHPS+Y   +  E+K +   + +DCSHWCLPG
Sbjct  268  TVIKTVMRDMNYPPFLLDITLLSAMRKDAHPSIYSGDLTPEQKAN-PDHSADCSHWCLPG  326

Query  191  VPDIWNEML  165
            +PD WN++ 
Sbjct  327  LPDTWNQLF  335



>ref|XP_010540499.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=380

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 112/188 (60%), Gaps = 18/188 (10%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRS-SWDYIMEGTNFFRYMNPMVAYEKGLMTW  525
            + IE  A  W+G +VL+F+S HWWTH  + S  WDY+ +G+   R M+ +VA+ KGL TW
Sbjct  200  NAIEGGANLWKGMEVLIFNSWHWWTHKGSSSQGWDYMRDGSGLMRDMDRLVAFYKGLSTW  259

Query  524  AKWIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvl  363
            AKW+DLNVD  K+RVFF+ +SP H     W      C  +  PL   +     P    V+
Sbjct  260  AKWVDLNVDASKTRVFFQGISPTHYEGREWNEPKKSCSGQMVPLSGSTYPGGAPPATAVV  319

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
             +VLR M  PVYL DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD
Sbjct  320  DKVLRTMKTPVYLLDITTLSQLRKDAHPSTYGGDGG-----------TDCSHWCLPGLPD  368

Query  182  IWNEMLNA  159
             WN +L A
Sbjct  369  TWNRLLYA  376



>emb|CBI30668.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 111/178 (62%), Gaps = 16/178 (9%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+  D+L+F++ HWWTH  N   WDY+ EGT  ++ M+ + A+ KGL TWA W+DLN+DP
Sbjct  204  WKQMDMLIFNTWHWWTHKGNSQGWDYMSEGTKLYKDMDRLTAFYKGLSTWASWVDLNIDP  263

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C+ E EPL   +     P    ++ QVL ++  P
Sbjct  264  SKTKVFFQGISPTHYMGKEWNSQSKNCYGELEPLSGPTYPAGAPAAAAIVNQVLSKIRKP  323

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS YG     E++  +     DCSHWCLPG+PD WN++L A
Sbjct  324  VYLLDITTLSQLRKDAHPSAYG-----EDRTGM-----DCSHWCLPGLPDTWNQLLYA  371



>ref|XP_008228877.1| PREDICTED: protein trichome birefringence-like 43 [Prunus mume]
Length=256

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 110/184 (60%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E+ + W+G D L+F++ HWW HS  +  WD I EG   ++ M+ +VAY+KGL TWA+WID
Sbjct  74   ESGKMWKGIDFLIFNTWHWWLHSGRKQPWDLIQEGNRLYKDMDRLVAYKKGLNTWARWID  133

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREP-LEHFSRprvpqqlvvlkqvl  351
             N+DP+K+RVFF+ +SP HN    W       C  +  P + H          +V+++VL
Sbjct  134  SNLDPKKTRVFFQGVSPDHNNGGDWGERTAKHCEGQMRPVVGHQYPAGSHPAELVVERVL  193

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
              M+ P YL +++T+S  R+D HPSVYG         H      DCSHWCL GVPD WN+
Sbjct  194  HSMSKPAYLLNVTTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPDTWNQ  244

Query  170  MLNA  159
            +L A
Sbjct  245  LLYA  248



>gb|KJB49815.1| hypothetical protein B456_008G139200 [Gossypium raimondii]
Length=356

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  W+G+DVLVF++AHWW+H + ++  +Y  EG      ++   A+ K LMTWA
Sbjct  160  DAIDHGSSKWKGADVLVFNTAHWWSHFKTKAGINYYQEGNQVHPKLDVSTAFRKALMTWA  219

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK+RVFFR+++P H R   W     C     PL   S    P++  ++++V
Sbjct  220  GWVDRHINPRKTRVFFRNLAPSHFRGGLWNSGGHCMEATWPLNDTSGMEYPEKNRIVEEV  279

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            + +M  PV L +++ +SA+R D HPS+YGK  G     +++    DCSHWCLPGVPD WN
Sbjct  280  ILQMKTPVTLLNVTGLSAYRIDGHPSIYGKKTGTRYSSNIQ----DCSHWCLPGVPDTWN  335

Query  173  EML  165
            E+L
Sbjct  336  EIL  338



>gb|KHG20284.1| Enolase [Gossypium arboreum]
Length=365

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 108/179 (60%), Gaps = 18/179 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W G D+L+F+S HWWTH      WDYI +G+  ++ MN + AY KGL TWA W+D NVD 
Sbjct  194  WIGMDLLIFNSWHWWTHKGKSQGWDYIRDGSALYKDMNRLEAYNKGLATWANWVDTNVDQ  253

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C+ E+EPL   + +   P    ++ +VL  MN P
Sbjct  254  TKTKVFFQGISPTHYEGREWNQPKKSCYGEQEPLSGTTYQAGAPPAAAIVNKVLGSMNKP  313

Query  332  VYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN++L A
Sbjct  314  VYLLDITTLSQLRKDAHPSTYSGDHSG-----------NDCSHWCLPGLPDTWNQLLYA  361



>ref|XP_010057074.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW74075.1| hypothetical protein EUGRSUZ_E02713 [Eucalyptus grandis]
Length=373

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 109/184 (59%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  + W+G DVL+F+S HWWTH+     WDYI +G    + M+ + AY KGL TWAKW+D
Sbjct  197  EAGKSWQGMDVLIFNSWHWWTHTGKSQPWDYIQDGGRVVKDMDRLSAYYKGLSTWAKWVD  256

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqvlr  348
            LNVD  K++VFF+ +SP H +   W      C  E+ PL   +     P    V+ +VL 
Sbjct  257  LNVDSSKTKVFFQGISPTHYQGKDWHSPKKNCMGEQSPLSGSTYPTGAPPATSVVSKVLN  316

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
             M  PVYL DI+T+S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN+
Sbjct  317  SMKTPVYLLDITTLSQLRKDAHPSTYSGDHSG-----------TDCSHWCLPGLPDTWNQ  365

Query  170  MLNA  159
            +L A
Sbjct  366  LLYA  369



>ref|XP_010480710.1| PREDICTED: protein trichome birefringence-like 38, partial [Camelina 
sativa]
Length=406

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 109/185 (59%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+ +DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  229  IDGGAGVWKNTDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWARW  288

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  289  VDQNVDTTKTRVFFQGISPTHYEGREWNEPRKSCSGQMQPLGGSSYPSGQPPAAGVVSKV  348

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV+L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  349  LSSMKKPVFLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  397

Query  173  EMLNA  159
            ++L A
Sbjct  398  QLLYA  402



>gb|KJB24277.1| hypothetical protein B456_004G138200 [Gossypium raimondii]
Length=359

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 114/188 (61%), Gaps = 16/188 (9%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D IEE A+ W+G DVL+F++ HWW H+  +  WD+I EG +    M+ +VAYEKGL TWA
Sbjct  176  DSIEEGAKLWKGIDVLIFNTWHWWLHTGRKQPWDFIEEGNHTQVDMDRLVAYEKGLNTWA  235

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSR-prvpqqlvvl  363
            KW+D NV+  K+ VFF+ +SP H   + W       C  ++EP++             V+
Sbjct  236  KWVDANVNTSKTTVFFQGVSPDHINSSDWGEPKAKNCEGQKEPIKGGDYPGGQHPAEKVV  295

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            ++VL+ M+ PVYL +++T+S  R+D HPSVYG         H      DCSHWCL GVPD
Sbjct  296  EKVLKTMSTPVYLLNVTTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPD  346

Query  182  IWNEMLNA  159
             WN++L A
Sbjct  347  TWNQLLYA  354



>ref|XP_009787058.1| PREDICTED: protein PMR5-like isoform X2 [Nicotiana sylvestris]
Length=274

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 112/192 (58%), Gaps = 17/192 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WRG DVL F++ HWWTH  +   WDYI +G   +  M+P+VA E+GL TWA+W
Sbjct  79   IRGNANAWRGVDVLSFNTGHWWTHKGSSQGWDYIDDGGRMYEDMDPLVAMERGLRTWARW  138

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW---------KCFNEREPLE------HFSRprvp  381
            +D N+D  ++R+FF+  SP H   + W          C+ E  P+         +     
Sbjct  139  VDSNIDRSRTRLFFQGTSPNHYDSSVWNGGAATTSGSCYGETSPVTTTLLTGSTNPGMYS  198

Query  380  qqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWC  201
             Q  V++ V+R M+ P +L DI+ +SA R+DAHPS+Y   +    +Q +   K+DC+HWC
Sbjct  199  DQTNVVQTVIRDMDNPPFLLDITLLSAMRKDAHPSIYSGDL--NSQQRINPNKADCTHWC  256

Query  200  LPGVPDIWNEML  165
            LPG+PD WN++ 
Sbjct  257  LPGLPDTWNQLF  268



>gb|KFK44758.1| hypothetical protein AALP_AA1G299000 [Arabis alpina]
Length=380

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 109/185 (59%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+  DVL+F+S HWWTH  N   W YI +G++  R MN + A+ KGL TWA+W
Sbjct  203  IDGGANQWKNMDVLIFNSWHWWTHKGNAQGWQYIRDGSSLVRDMNRLDAFYKGLSTWARW  262

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    ++ +V
Sbjct  263  VDQNVDTTKTRVFFQGISPTHYEGREWNEPRKTCNGQLQPLSGSSYPSGQPPAATIVSKV  322

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L+ M  PVYL DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  323  LKSMKKPVYLLDITTLSQLRKDAHPSTYGGDGG-----------TDCSHWCLPGLPDTWN  371

Query  173  EMLNA  159
            ++L A
Sbjct  372  QLLYA  376



>ref|XP_007146400.1| hypothetical protein PHAVU_006G037200g [Phaseolus vulgaris]
 gb|ESW18394.1| hypothetical protein PHAVU_006G037200g [Phaseolus vulgaris]
Length=375

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 111/183 (61%), Gaps = 18/183 (10%)
 Frame = -2

Query  683  ARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLN  504
            A+ W+G+DVL+FDS HWW H+  +  WD++ +G   F+ M+ +VAYEK L TWAKW+D N
Sbjct  198  AKTWKGADVLIFDSWHWWLHTGRKQPWDFVQDGNQTFKDMDRLVAYEKALTTWAKWVDYN  257

Query  503  VDPRKSRVFFRSMSPKHNRENGW------KCFNEREP-LEHFSRprvpqqlvvlkqvlrR  345
            V+P K+RVFF+ +SP H     W       C  E  P L            +VL++VLR 
Sbjct  258  VNPAKTRVFFQGVSPDHVNAEKWGGHAGNTCVGESRPVLGSKYPGGPLPAELVLEKVLRS  317

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS-DCSHWCLPGVPDIWNEM  168
            M  PV L DI+T+S  R+D HPS+YG            G++S DCSHWCLPGVPD WN +
Sbjct  318  MKKPVELLDITTLSQLRKDGHPSIYGT----------GGHRSLDCSHWCLPGVPDTWNVL  367

Query  167  LNA  159
            L A
Sbjct  368  LYA  370



>gb|AHN91976.1| TBL1 [Citrus sinensis]
Length=366

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 111/184 (60%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  ++W+  DVL+F+S HWWTH+     WDYI +G    + M+ + A+ KG+ TWA+W+D
Sbjct  190  QAGKFWKDMDVLIFNSWHWWTHTGKAQPWDYIQDGQTLLKDMDRLEAFYKGMSTWARWVD  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            L+VDP K++VFF+ +SP H     W      C  E EPL   +     P    V+ +VL 
Sbjct  250  LDVDPSKTKVFFQGISPTHYTGKEWNSRKKNCLGELEPLSGSTYPGGAPPAASVVNKVLS  309

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
             +N PVYL DI+T+S  R+DAHPS Y GK  G           +DCSHWCLPG+PD WN+
Sbjct  310  PINKPVYLLDITTLSQLRKDAHPSTYSGKHSG-----------TDCSHWCLPGLPDTWNQ  358

Query  170  MLNA  159
            +L A
Sbjct  359  LLYA  362



>gb|KEH34316.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=274

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 110/190 (58%), Gaps = 15/190 (8%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+ N   W+  D+L F+S HWWTH  +   WDYI  G  +++ M+ + A E+GL TWA W
Sbjct  81   IDVNGDAWKNVDILSFNSGHWWTHEGSLQGWDYIELGGKYYQDMDRLAAMERGLKTWANW  140

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFSRprvpq---q  375
            +D  VD  +++VFF  +SP H   N W           C+ E  P+             Q
Sbjct  141  VDSKVDKSRTKVFFLGISPSHINPNEWTSGVTTASSKNCYGETGPISSTGTAYPGVFPEQ  200

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + V+  V+R MN+PVYL DI+ +SAFR+DAHPSVY   +  +++ +     SDCSHWCLP
Sbjct  201  MKVIDMVIREMNYPVYLLDITMLSAFRKDAHPSVYSGDLSPQQRAN--PIYSDCSHWCLP  258

Query  194  GVPDIWNEML  165
            G+PD WNE+ 
Sbjct  259  GLPDTWNELF  268



>ref|XP_010460674.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=384

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 109/185 (59%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+ +DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  207  IDGGADVWKNTDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWARW  266

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  267  VDQNVDTTKTRVFFQGISPTHYEGREWNEPRKSCSGQMQPLGGSSYPSGQPPAAGVVSKV  326

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV+L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  327  LSSMKKPVFLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  375

Query  173  EMLNA  159
            ++L A
Sbjct  376  QLLYA  380



>ref|XP_003593750.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
 gb|AES64001.1| trichome birefringence-like protein [Medicago truncatula]
Length=360

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 113/187 (60%), Gaps = 20/187 (11%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+LVF+S HWWTH  +   WDYI +G+   + M+ +VAY KGL TWAK
Sbjct  183  IVAGNA--WKGMDMLVFNSWHWWTHKGSSQGWDYIRDGSKLVKNMDRLVAYNKGLTTWAK  240

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkq  357
            W+DLNVDP K++VFF+ +SP H     W      C  + EPL   +    +P    +L  
Sbjct  241  WVDLNVDPTKTKVFFQGISPTHYMGKEWNQPKNSCSGQLEPLSGSTYPAGLPPSSNILNN  300

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
            VL+ M  PVYL DI+ +S  R+DAHPS Y G   G           +DCSHWCLPG+PD 
Sbjct  301  VLKSMKSPVYLLDITLLSQLRKDAHPSSYSGDHAG-----------NDCSHWCLPGLPDT  349

Query  179  WNEMLNA  159
            WN++L A
Sbjct  350  WNQLLYA  356



>emb|CBI21958.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 15/183 (8%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++   W+G D+L+F++ HWWTH+     WDY+ EG   ++ MN ++AY KGL TWA+W++
Sbjct  74   QSGNAWKGMDMLIFNTWHWWTHTGRTQPWDYVQEGNKLYKDMNRLIAYYKGLTTWARWVN  133

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            +NVDP K++VFF+ +SP H     W      C  E +P    S    +P   VV+ +VL 
Sbjct  134  INVDPSKTKVFFQGISPTHYEGKDWNQPSRSCDGEMQPYFGASYPAGIPMAAVVVNKVLS  193

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            R+  PVYL D++T+S +R DAHPS Y         +H  G  +DCSHWCLPG+PD WN++
Sbjct  194  RIKKPVYLLDVTTLSQYRIDAHPSDY-------SGEH--GGITDCSHWCLPGLPDTWNQL  244

Query  167  LNA  159
            L A
Sbjct  245  LYA  247



>ref|XP_003593751.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
Length=376

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 113/187 (60%), Gaps = 20/187 (11%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+LVF+S HWWTH  +   WDYI +G+   + M+ +VAY KGL TWAK
Sbjct  199  IVAGNA--WKGMDMLVFNSWHWWTHKGSSQGWDYIRDGSKLVKNMDRLVAYNKGLTTWAK  256

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkq  357
            W+DLNVDP K++VFF+ +SP H     W      C  + EPL   +    +P    +L  
Sbjct  257  WVDLNVDPTKTKVFFQGISPTHYMGKEWNQPKNSCSGQLEPLSGSTYPAGLPPSSNILNN  316

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
            VL+ M  PVYL DI+ +S  R+DAHPS Y G   G           +DCSHWCLPG+PD 
Sbjct  317  VLKSMKSPVYLLDITLLSQLRKDAHPSSYSGDHAG-----------NDCSHWCLPGLPDT  365

Query  179  WNEMLNA  159
            WN++L A
Sbjct  366  WNQLLYA  372



>ref|XP_004505509.1| PREDICTED: uncharacterized protein LOC101514285 [Cicer arietinum]
Length=361

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 111/182 (61%), Gaps = 17/182 (9%)
 Frame = -2

Query  686  NARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDL  507
            N   WRG DVL+F++ HWWTH+ +   WDYI E    ++ MN  VA+ KGL TWA+W++ 
Sbjct  187  NGEAWRGMDVLIFNTWHWWTHTGSAQPWDYIQENNKLYKDMNRFVAFYKGLTTWARWVEK  246

Query  506  NVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrR  345
            NV+P +++VFF  +SP H +   W      C +E+EP      P       VV+ +VL R
Sbjct  247  NVNPAQTKVFFLGISPVHYQGRDWNQPSKSCMSEKEPFFGLKYPGGIPMAWVVVNKVLSR  306

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M+ PVY  D++T+S +R+DAHP  Y  V+            +DCSHWCLPG+PD WNE+L
Sbjct  307  MSKPVYFLDVTTLSQYRKDAHPEGYSGVMA-----------TDCSHWCLPGLPDTWNELL  355

Query  164  NA  159
            NA
Sbjct  356  NA  357



>ref|XP_009588313.1| PREDICTED: protein PMR5-like [Nicotiana tomentosiformis]
Length=390

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 113/192 (59%), Gaps = 17/192 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WRG DVL F++ HWWTH  +   WDYI +G   +  M+P+VA E+GL TWA+W
Sbjct  195  IRGNANAWRGVDVLSFNTGHWWTHKGSSQGWDYIDDGGRMYEDMDPLVAMERGLRTWARW  254

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW---------KCFNEREPLE------HFSRprvp  381
            +D N+D  ++R+FF++ SP H   + W          C+ E  P+         +     
Sbjct  255  VDSNIDRSRTRLFFQATSPNHYDSSVWNGGAATTSGSCYGETSPVTTTLLTGSMNPGMYS  314

Query  380  qqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWC  201
             Q  V++ V+R MN P +L DI+ +SA R+DAHPS+Y   +    +Q +   K+DC+HWC
Sbjct  315  DQTNVVQTVIRDMNNPPFLLDITLLSAMRKDAHPSIYSGDL--NSQQRINPNKADCTHWC  372

Query  200  LPGVPDIWNEML  165
            LPG+PD WN++ 
Sbjct  373  LPGLPDTWNQLF  384



>ref|XP_002313988.1| hypothetical protein POPTR_0009s07700g [Populus trichocarpa]
 gb|EEE87943.1| hypothetical protein POPTR_0009s07700g [Populus trichocarpa]
Length=394

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 114/190 (60%), Gaps = 12/190 (6%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WR  DVL+F++ HWW+H  +   WDY+  G  F++ M+ +VA E+GL TWAKW
Sbjct  202  ISGNANAWRNVDVLIFNTGHWWSHQGSLQGWDYMESGGTFYQDMDRLVALERGLRTWAKW  261

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGWK----------CFNEREPLEHFSR-prvpqqlv  369
            +D N+D  ++RVFF+S+SP H   + W           C+ E  P+   +     P Q+ 
Sbjct  262  VDSNIDTTRTRVFFQSISPTHYNPSEWSAGTTVATTRNCYGETTPMNGMTYPGAYPDQMR  321

Query  368  vlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGV  189
            V+  V+R M+ P YL DI+ +S  R+D HPS+Y   +  +++    G  +DCSHWCLPG+
Sbjct  322  VVDTVIRDMHNPAYLLDITMLSELRKDGHPSIYSGDLSPQQRADPSG-SADCSHWCLPGL  380

Query  188  PDIWNEMLNA  159
            PD WN++  A
Sbjct  381  PDTWNQLFYA  390



>gb|KHF98470.1| Transmembrane protein [Gossypium arboreum]
Length=280

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 106/178 (60%), Gaps = 17/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+G D+L+F++ HWWTH     +WDYI +G+  +  M+ +VA+ KGL TWA W+D NVDP
Sbjct  110  WKGMDLLIFNTWHWWTHKGQSQAWDYIRDGSEVYEDMDRLVAFNKGLTTWANWVDNNVDP  169

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
              ++VFF+ +SP H     W      C  E EPL   +     P    V+ +VL  M  P
Sbjct  170  NITKVFFQGISPTHYEGREWNQPNKNCNGELEPLSGPTYPAGAPPAAAVVNKVLGTMKNP  229

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS YG + G           +DCSHWCLPG+PD WN +L A
Sbjct  230  VYLLDITTLSQLRKDAHPSTYGGLSG-----------NDCSHWCLPGLPDTWNHLLYA  276



>ref|XP_002274664.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=409

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 111/178 (62%), Gaps = 16/178 (9%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+  D+L+F++ HWWTH  N   WDY+ EGT  ++ M+ + A+ KGL TWA W+DLN+DP
Sbjct  236  WKQMDMLIFNTWHWWTHKGNSQGWDYMSEGTKLYKDMDRLTAFYKGLSTWASWVDLNIDP  295

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C+ E EPL   +     P    ++ QVL ++  P
Sbjct  296  SKTKVFFQGISPTHYMGKEWNSQSKNCYGELEPLSGPTYPAGAPAAAAIVNQVLSKIRKP  355

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS YG     E++  +     DCSHWCLPG+PD WN++L A
Sbjct  356  VYLLDITTLSQLRKDAHPSAYG-----EDRTGM-----DCSHWCLPGLPDTWNQLLYA  403



>ref|XP_003560398.1| PREDICTED: protein trichome birefringence-like 5 [Brachypodium 
distachyon]
Length=456

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 112/186 (60%), Gaps = 7/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I++ A  W+ +DVLVF++ HWWTH +     +Y  EG   +   +   AY + L TWA
Sbjct  259  DRIDKTASRWKKADVLVFNTGHWWTHGKTARGKNYYKEGDTLYPQFDSTEAYRRALTTWA  318

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREP-LEHFSRprvpqqlvvlkq  357
            +W+D N+DP K+ VF+R  S  H R   W     C  E EP          P++  +  +
Sbjct  319  RWVDKNMDPDKTVVFYRGYSTAHFRGGEWDAGGSCSGETEPAFRGAVVESYPEKTRIAAE  378

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+ RM FPV L +++ +++FR+DAHPSVYGK  G  E++  R  K DCSHWCLPGVPD+W
Sbjct  379  VIARMRFPVRLLNVTRLTSFRKDAHPSVYGKAAGAAERR--RKKKQDCSHWCLPGVPDVW  436

Query  176  NEMLNA  159
            NE++ A
Sbjct  437  NELIYA  442



>ref|XP_004305456.2| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 110/182 (60%), Gaps = 16/182 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++ + W+G D L+F++ HWW H+  +  WD I EG   ++ M+ +VAYEKGL TWAKW+D
Sbjct  184  QSGKLWKGIDYLIFNTWHWWLHTGRKQPWDLIQEGNRTYKDMDRLVAYEKGLNTWAKWVD  243

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSR-prvpqqlvvlkqvl  351
             NVD  K+RVFF+ +SP HN  + W+      C  + +P+              V+++VL
Sbjct  244  TNVDQTKTRVFFQGVSPDHNNASDWRDPTAKACEGQTKPVAGSQYPAGPHPAEQVVERVL  303

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
              M+FPVYL +++T+S  R+D HPSVYG         H      DCSHWCL GVPD WNE
Sbjct  304  HSMSFPVYLLNVTTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPDAWNE  354

Query  170  ML  165
            +L
Sbjct  355  LL  356



>gb|KHN11944.1| hypothetical protein glysoja_019917 [Glycine soja]
Length=235

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 111/184 (60%), Gaps = 17/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  + W+G+ +L+FDS HWW H   +  WD+I EG   F+ MN +VAYEKGL TWAKW++
Sbjct  57   EAGKIWKGNHILIFDSWHWWLHIGRKQPWDFIQEGNRTFKDMNRLVAYEKGLKTWAKWVE  116

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             NVDP K+RVFF+ +SP H     W      C  ++ P++ F          +VL++VL 
Sbjct  117  DNVDPNKTRVFFQGVSPDHLNGAKWGEPRASCEEQKVPVDGFKYPGGSHPAELVLQKVLG  176

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS-DCSHWCLPGVPDIWNE  171
             M+  V L +I+T+S  R+D HPSVYG            G++  DCSHWCLPGVPD WN 
Sbjct  177  AMSKRVNLLNITTLSQMRKDGHPSVYG----------YGGHRDMDCSHWCLPGVPDTWNL  226

Query  170  MLNA  159
            +L A
Sbjct  227  LLYA  230



>ref|XP_010499424.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=383

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 109/185 (59%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+ +DVLVF+S HWWTH      WDYI +G++  + MN + A+ KGL TWA+W
Sbjct  206  IDGGAGVWKNTDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVKDMNRLDAFYKGLSTWARW  265

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  266  VDQNVDTTKTRVFFQGISPTHYEGREWNEPRKSCSGQMQPLGGSSYPSGQPPAAGVVSKV  325

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV+L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  326  LSSMKKPVFLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  374

Query  173  EMLNA  159
            ++L A
Sbjct  375  QLLYA  379



>ref|XP_007025417.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 ref|XP_007025418.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28039.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28040.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
Length=363

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 108/178 (61%), Gaps = 16/178 (9%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+G D+LVF+S HWWTH     +WDYI +G+  ++ M+  VA+ KGL TWA W+D NVDP
Sbjct  192  WKGMDMLVFNSWHWWTHKGKSQAWDYIRDGSELYKDMDRFVAFNKGLTTWANWVDSNVDP  251

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C+ E EPL   +     P    +L +VL  M  P
Sbjct  252  TKTKVFFQGISPTHYEGREWNQPKKNCYGELEPLSGSTYPAGAPPAAAILNKVLGTMKKP  311

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS Y    G+          +DCSHWCLPG+PD WN++L A
Sbjct  312  VYLLDITTLSQLRKDAHPSTYS---GEHS-------GNDCSHWCLPGLPDTWNQLLYA  359



>ref|XP_006305057.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
 gb|EOA37955.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
Length=384

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 108/185 (58%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+  DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  207  IDGGASAWKNMDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWARW  266

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  267  VDQNVDTTKTRVFFQGISPTHYEGREWNEPRKSCSGQMQPLGGSSYPSGQPPSAGVVSKV  326

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV+L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  327  LGSMRKPVFLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  375

Query  173  EMLNA  159
            ++L A
Sbjct  376  QLLYA  380



>ref|XP_002522557.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39857.1| conserved hypothetical protein [Ricinus communis]
Length=370

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 109/183 (60%), Gaps = 17/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G D+L+F+S HWWTH+     WDY+  G + ++ M+ + A+ +G+ TWAKW+D
Sbjct  195  EGGNAWKGMDLLIFNSWHWWTHTGRSQPWDYVRAGASLYKDMDRLEAFYRGMSTWAKWVD  254

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             NVDP K++VFF+ +SP H     W      C  E EPL   +     P  + V+ +VL 
Sbjct  255  QNVDPAKTKVFFQGISPTHYEGREWNQPKKSCNGEAEPLSGSTYPGGAPPAVAVVNKVLS  314

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             +  PVYL DI+T+S  R+DAHPS YG            G  +DCSHWCLPG+PD WN++
Sbjct  315  TIKKPVYLLDITTLSQLRKDAHPSTYGD-----------GSGTDCSHWCLPGLPDTWNQL  363

Query  167  LNA  159
            L A
Sbjct  364  LYA  366



>ref|XP_008225213.1| PREDICTED: protein trichome birefringence-like 37 [Prunus mume]
Length=361

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 18/179 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+  DVL+F+S HWWTH+     WDY+ +GTN ++ M+ + A+ KGL TWAKW+D NVDP
Sbjct  190  WKDMDVLIFNSWHWWTHTGKSQPWDYVRDGTNLYKDMDRLTAFYKGLSTWAKWVDSNVDP  249

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlrRMNFP  333
             K+RVFF+ +SP H +   W      C+ E  PL   +     P    V+ +VL  +  P
Sbjct  250  SKTRVFFQGISPTHYQGQEWNSPKKNCYGELGPLSGTTYPAGPPPAYAVVNKVLSTIKNP  309

Query  332  VYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN++L A
Sbjct  310  VYLLDITTLSQLRKDAHPSTYSGDHSG-----------NDCSHWCLPGLPDTWNQLLYA  357



>gb|KDP28262.1| hypothetical protein JCGZ_14033 [Jatropha curcas]
Length=563

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 113/183 (62%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+L+F++AHWW+H + ++  +Y  EG+     ++   A+ + LMTWA
Sbjct  372  DAIDHGSSRWRGADILIFNTAHWWSHFKTKAGINYYQEGSIVHPKLDVSTAFRRALMTWA  431

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK++VFFRS +P H R   W     C   R+PL   S     ++ ++ + +
Sbjct  432  SWVDRHINPRKTQVFFRSSAPSHFRGGQWNSGGHCEEARQPLNDTSHMGFSEKNMITEDI  491

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            ++ M  PV L +I+++S FR D HPS+YGK+  +    +      DCSHWCLPGVPD WN
Sbjct  492  IKHMRTPVTLLNITSLSEFRIDGHPSMYGKISAKRRGSN----GQDCSHWCLPGVPDTWN  547

Query  173  EML  165
            E L
Sbjct  548  EFL  550



>ref|XP_002893546.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69805.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 107/185 (58%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            IE  A  W+  DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  203  IEGGANAWKNMDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWARW  262

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  263  VDQNVDTTKTRVFFQGISPTHYEGREWNEPRKSCSGQMQPLGGSSYPSGQPPSAGVVSKV  322

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  323  LNSMKKPVTLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  371

Query  173  EMLNA  159
            ++L A
Sbjct  372  QLLYA  376



>gb|AAF88130.1|AC021043_23 Unknown protein [Arabidopsis thaliana]
Length=368

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 107/185 (58%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            IE  A  W+  DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  191  IEGGADAWKNMDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWARW  250

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  251  VDQNVDTAKTRVFFQGISPTHYEGREWNEPRKTCSGQMQPLGGSSYPSGQPPSSGVVSKV  310

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  311  LSSMKKPVTLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  359

Query  173  EMLNA  159
            ++L A
Sbjct  360  QLLYA  364



>ref|XP_008352647.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=356

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 112/186 (60%), Gaps = 5/186 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +      Y  EG+  +  +N   A+ K L TWA
Sbjct  149  DLIEXSSDKYKTADVLIFNTGHWWTHEKTSRGKGYYQEGSYIYDVLNVKEAFRKALTTWA  208

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPL-EHFSRprvpqqlvvlkq  357
            +W+D N++P K+ VFFR  SP H R   W    +C +  EPL +  +R +   +L +   
Sbjct  209  RWVDTNINPEKTIVFFRGFSPNHFRGGRWNSGGQCHDLIEPLAKETNRGKYASKLRIFDS  268

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+  M  P++  +I+ M+ FRRDAHPS+Y K    EE++       DCSHWCLPGVPD W
Sbjct  269  VITGMKTPIFYLNITRMTDFRRDAHPSIYRKQNFTEEERKSPLRHQDCSHWCLPGVPDTW  328

Query  176  NEMLNA  159
            NE+L A
Sbjct  329  NELLYA  334



>ref|XP_007216008.1| hypothetical protein PRUPE_ppa014688mg [Prunus persica]
 gb|EMJ17207.1| hypothetical protein PRUPE_ppa014688mg [Prunus persica]
Length=354

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 110/184 (60%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E+ + W+G D L+F++ HWW HS  +  WD I EG   ++ M+ +VAY+KGL TWA+WID
Sbjct  172  ESGKMWKGIDFLIFNTWHWWLHSGRKQPWDLIQEGNRLYKDMDRLVAYKKGLNTWARWID  231

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREP-LEHFSRprvpqqlvvlkqvl  351
             N+DP+K+RVFF+ +SP HN    W       C  +  P + H          +V+++VL
Sbjct  232  TNLDPKKTRVFFQGVSPDHNNGGDWGEPTAKHCEGQMRPVVGHQYPAGSHPAELVVERVL  291

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
              M+ P YL +++T+S  R+D HPSVYG         H      DCSHWCL GVPD WN+
Sbjct  292  HSMSKPAYLLNVTTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPDTWNQ  342

Query  170  MLNA  159
            +L A
Sbjct  343  LLYA  346



>ref|XP_004500006.1| PREDICTED: uncharacterized protein LOC101510811 [Cicer arietinum]
Length=369

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 108/184 (59%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  + W+G DVL+FDS HWW H+  +  WD I EG N F+ M+ +VAYEKGL TWAKWID
Sbjct  190  EAGKTWKGIDVLIFDSWHWWLHTGRKQPWDIIQEGNNTFKDMDRLVAYEKGLNTWAKWID  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREP-LEHFSRprvpqqlvvlkqvl  351
             NVD  K+RVFF+ +SP H     W       C  + +P L            +VL++VL
Sbjct  250  DNVDINKTRVFFQGVSPDHLNSEQWGEPKANFCEGQEKPLLGSIYPGGPHPAELVLERVL  309

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M  PV L DI+T+S  R+D HPSVYG         H      DCSHWCL GVPD WN+
Sbjct  310  RAMQKPVNLLDITTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPDTWNQ  360

Query  170  MLNA  159
            +L A
Sbjct  361  LLYA  364



>ref|XP_010102792.1| hypothetical protein L484_007599 [Morus notabilis]
 gb|EXB94105.1| hypothetical protein L484_007599 [Morus notabilis]
Length=386

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 110/192 (57%), Gaps = 14/192 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   WRG+DVL F++ HWWTH  +   WDY+  G  +++ M+ + A EKGL TWA
Sbjct  190  DEISGNGNAWRGADVLSFNTGHWWTHKGSLQGWDYMESGGQYYQDMDRVAALEKGLRTWA  249

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFSRprvpq--  378
             W+D N+D  K+RVFF S+SP H   N W           C+ E  P+   S   +    
Sbjct  250  NWVDANIDRTKTRVFFLSISPTHYNPNEWNAGATTTTTKNCYGETSPMSGASTYPMGAYP  309

Query  377  -qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWC  201
             Q+ V+  V+R M  P YL DI+ +S  R+D HPS+Y   +  E++ +     +DCSHWC
Sbjct  310  EQMRVVDTVIRDMQSPAYLLDITMLSELRKDGHPSIYSGDLSPEQRSN-PARSADCSHWC  368

Query  200  LPGVPDIWNEML  165
            LPG+PD WN++ 
Sbjct  369  LPGLPDTWNQLF  380



>gb|KJB49817.1| hypothetical protein B456_008G139200 [Gossypium raimondii]
Length=509

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  W+G+DVLVF++AHWW+H + ++  +Y  EG      ++   A+ K LMTWA
Sbjct  313  DAIDHGSSKWKGADVLVFNTAHWWSHFKTKAGINYYQEGNQVHPKLDVSTAFRKALMTWA  372

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK+RVFFR+++P H R   W     C     PL   S    P++  ++++V
Sbjct  373  GWVDRHINPRKTRVFFRNLAPSHFRGGLWNSGGHCMEATWPLNDTSGMEYPEKNRIVEEV  432

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            + +M  PV L +++ +SA+R D HPS+YGK  G     +++    DCSHWCLPGVPD WN
Sbjct  433  ILQMKTPVTLLNVTGLSAYRIDGHPSIYGKKTGTRYSSNIQ----DCSHWCLPGVPDTWN  488

Query  173  EML  165
            E+L
Sbjct  489  EIL  491



>ref|XP_003613275.1| hypothetical protein MTR_5g034810 [Medicago truncatula]
 gb|AES96233.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=355

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 115/184 (63%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  R W+G+D+L+F+S HWW H+  +  WD++ EG + ++ MN +V Y+K L TWAKW+D
Sbjct  176  EGGRLWKGNDILIFNSWHWWPHTGKKQIWDFVQEGKHIYKDMNRLVMYKKALKTWAKWVD  235

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPL-EHFSRprvpqqlvvlkqvl  351
             NVDP K++VFF+ +SP H   + W       C  ++ P  E  +        + L++V+
Sbjct  236  DNVDPGKTKVFFQGISPDHKNGSKWGQYASTSCKGQKLPFPESKNLGGPYPAELALEKVI  295

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M+ PV+L +I+T+S  R+DAHPSV+    G        G+ +DCSHWCLPGVPD WN 
Sbjct  296  RAMSKPVHLLNITTLSKLRKDAHPSVH---TGHG------GHTNDCSHWCLPGVPDTWNM  346

Query  170  MLNA  159
            +L A
Sbjct  347  LLYA  350



>ref|XP_011460601.1| PREDICTED: protein trichome birefringence-like 38 [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 111/184 (60%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  +YW+  D+L+F+S HWWTH  N   +DY  +GTN ++ M+ + AY KGL TW KW+D
Sbjct  194  EAGKYWKDMDMLIFNSWHWWTHKGNDRPFDYFQDGTNLYKDMDRLTAYYKGLSTWGKWVD  253

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             NVDP K++VFF+ +SP H +   W      C  E EPL   +     P +  V+ +VL 
Sbjct  254  TNVDPSKTKVFFQGISPTHYQGREWNSPKKNCQGELEPLTGSTYPAGAPPEAGVVSKVLN  313

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
             +  PVYL DI+T+S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN+
Sbjct  314  TVKNPVYLLDITTLSQLRKDAHPSTYSGDHSG-----------NDCSHWCLPGLPDTWNQ  362

Query  170  MLNA  159
            +L A
Sbjct  363  LLYA  366



>ref|XP_009622720.1| PREDICTED: protein PMR5-like [Nicotiana tomentosiformis]
Length=380

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 116/190 (61%), Gaps = 12/190 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I +N+  W+G DVL F++ HWWTH  +   WDY+  G   ++ MN +VA E+GL TWA
Sbjct  186  DDISKNSNAWKGVDVLSFNTGHWWTHKGSLQGWDYMDAGGTLYQDMNRLVALERGLRTWA  245

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFSR-prvpqq  375
            +WID N+D  ++R+FF+ +SP H   N W           C+ E  P+   +     P Q
Sbjct  246  RWIDANIDKTRTRLFFQGISPTHYNPNEWTTGATAATSRSCYGETVPMTGTAYPGTYPDQ  305

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + VL+ V+R MN P +L DI+ +SA R+DAHPS+Y   +  E++ +   + +DCSHWCL 
Sbjct  306  MKVLQSVMRDMNNPPFLLDITFLSAMRKDAHPSIYSGALTSEQRAN-PDHSADCSHWCLA  364

Query  194  GVPDIWNEML  165
            G+PD WN++ 
Sbjct  365  GLPDTWNQLF  374



>ref|NP_564318.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
 sp|Q8VY22.1|TBL38_ARATH RecName: Full=Protein trichome birefringence-like 38 [Arabidopsis 
thaliana]
 gb|AAL66969.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20296.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99289.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31037.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
Length=380

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 107/185 (58%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            IE  A  W+  DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  203  IEGGADAWKNMDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWARW  262

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +D NVD  K+RVFF+ +SP H     W      C  + +PL   S     P    V+ +V
Sbjct  263  VDQNVDTAKTRVFFQGISPTHYEGREWNEPRKTCSGQMQPLGGSSYPSGQPPSSGVVSKV  322

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  323  LSSMKKPVTLLDITTLSQLRKDAHPSSYGGDGG-----------TDCSHWCLPGLPDTWN  371

Query  173  EMLNA  159
            ++L A
Sbjct  372  QLLYA  376



>gb|KHN20810.1| hypothetical protein glysoja_049140 [Glycine soja]
Length=253

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 108/185 (58%), Gaps = 16/185 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  + W+G DV++FDS HWW H+  +  WD I  G + +R M+ +VAYE  L TWAKW+D
Sbjct  74   QAGQTWKGIDVMIFDSWHWWIHTGRKQPWDLIQVGNHTYRDMDRLVAYEIALNTWAKWVD  133

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFS-Rprvpqqlvvlkqvl  351
             N+DP ++RVFF+ +SP H     W       C  +  P+  F          +VL++VL
Sbjct  134  YNIDPTRTRVFFQGVSPGHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELVLEKVL  193

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M  PVYL DI+T+S  R D HPSVYG         HL     DCSHWCL GVPD WNE
Sbjct  194  RAMQKPVYLLDITTLSQLRIDGHPSVYGF------GGHL---DPDCSHWCLAGVPDTWNE  244

Query  170  MLNAM  156
            +L A+
Sbjct  245  LLYAI  249



>ref|XP_010267992.1| PREDICTED: protein trichome birefringence-like 6 isoform X1 [Nelumbo 
nucifera]
Length=491

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 118/183 (64%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  W+G+DVLVF++AHWW+H + ++  +Y  EG   + +++  VA+ + LMTWA
Sbjct  300  DSIDRGSSRWKGADVLVFNTAHWWSHYKTKAGVNYYQEGNQVYPHLDVSVAFRRALMTWA  359

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++P K++VFFRS +P H R   W     C    +PL + S    P++ V+ ++V
Sbjct  360  SWVDRHINPHKTQVFFRSSAPSHFRGGQWNSGGHCKEATQPLNNISGTDYPEKNVIAEEV  419

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV L +++++S +R D HPSVYG+    + ++       DCSHWCLPGVPD WN
Sbjct  420  IKQMKTPVTLLNVTSLSEYRIDGHPSVYGR----KPRKGTSSSIQDCSHWCLPGVPDTWN  475

Query  173  EML  165
            E+L
Sbjct  476  ELL  478



>ref|XP_011089477.1| PREDICTED: protein PMR5-like [Sesamum indicum]
Length=394

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 112/190 (59%), Gaps = 12/190 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  NA  W G DVL F++ HWWTH  +   WDY+    + +  M+ +VA E+GL TWA
Sbjct  198  DEIRGNANAWTGVDVLSFNTGHWWTHKGSLQGWDYMEAEGSIYEDMDRLVALERGLRTWA  257

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW---------KCFNEREPLEHFSRprvpq--q  375
            KWID N+D  +SRVFF+ +SP H   + W          C+ E  P+   S        Q
Sbjct  258  KWIDANIDTSRSRVFFQGISPTHYNPSEWNAGAVTTSKSCYGETMPMTGMSGYAGTYPDQ  317

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + V++ VL  MN P +L DI+ +SA R+DAHPS+Y   +  E++ +   + +DCSHWCLP
Sbjct  318  MKVVQVVLSSMNKPPFLLDITLLSAMRKDAHPSIYSGDLTAEQRAN-PDHSADCSHWCLP  376

Query  194  GVPDIWNEML  165
            G+PD WN++ 
Sbjct  377  GLPDTWNQLF  386



>ref|XP_006597476.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN18917.1| hypothetical protein glysoja_036096 [Glycine soja]
Length=364

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 113/187 (60%), Gaps = 20/187 (11%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+L+F+S HWWTH+     WDYI +G N  + M+ + AY KGL TWA 
Sbjct  187  IVAGNA--WKGMDMLIFNSWHWWTHTGKSQGWDYIRDGPNLVKNMDRLEAYNKGLTTWAN  244

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkq  357
            W+D NVDP K++VFF+ +SP H +   W      C  E +PL   +    +P    +L  
Sbjct  245  WVDQNVDPSKTKVFFQGISPTHYQGKDWNQPKRSCSGELQPLSGSTYPAGLPPATTILNN  304

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
            VLR+M+ PVYL DI+ +S  R+DAHPS Y G   G           +DCSHWCLPG+PD 
Sbjct  305  VLRKMSTPVYLLDITLLSQLRKDAHPSAYSGDHAG-----------NDCSHWCLPGLPDT  353

Query  179  WNEMLNA  159
            WN++L A
Sbjct  354  WNQLLYA  360



>gb|KHG15499.1| Calpain clp-1 [Gossypium arboreum]
Length=280

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 111/190 (58%), Gaps = 12/190 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   WR +DVLVF++ HWW H  +   WD I  G  +++ M+ +VA EKGL TWA
Sbjct  31   DDIAGNGNAWRMADVLVFNTGHWWGHEGSLRGWDLIQSGGKYYQDMDRLVAMEKGLRTWA  90

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFS-Rprvpqq  375
             W+D NVD  ++RVFF+S SP H   N W           C+ E EP++  +       Q
Sbjct  91   NWVDSNVDITRTRVFFQSASPDHYNPNEWSAAATATTAKNCYGETEPMKGTTYTSAYADQ  150

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + V+ +V+R M+ P YL DI+ +S  R+D HPS+Y       ++ + +   +DCSHWCLP
Sbjct  151  MGVVNEVIREMHVPTYLMDITMLSELRKDGHPSIYRGDFSPSQRANPQK-SADCSHWCLP  209

Query  194  GVPDIWNEML  165
            G+PD WNE+ 
Sbjct  210  GLPDTWNELF  219



>emb|CAJ40777.1| alpha galactosidase precursor [Coffea arabica]
Length=365

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 112/188 (60%), Gaps = 16/188 (9%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+     W+G D LVF++ HWW H  +   WDY+ +G+   + M+ +VA+ KGL TWA
Sbjct  187  DSIDRGNDAWKGMDALVFNTWHWWLHRGDSQPWDYVQDGSTVSKDMDRLVAFSKGLSTWA  246

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlk  360
            +W++ NVD  K++VFF+ +SP H     W      C+ EREPL+  +    +P  + V+K
Sbjct  247  QWVNQNVDSSKTKVFFQGISPSHYDGKEWGSDSKSCYGEREPLQGSTYPAGLPPAVDVVK  306

Query  359  qvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
            + L  M  PV L DI+T+S  R+DAHPS YG               +DCSHWCLPGVPD 
Sbjct  307  KTLSSMQKPVVLLDITTLSQLRKDAHPSGYGGSTS----------GNDCSHWCLPGVPDT  356

Query  179  WNEMLNAM  156
            WN++L A+
Sbjct  357  WNQLLYAL  364



>gb|KEH34315.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=378

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 110/190 (58%), Gaps = 15/190 (8%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+ N   W+  D+L F+S HWWTH  +   WDYI  G  +++ M+ + A E+GL TWA W
Sbjct  185  IDVNGDAWKNVDILSFNSGHWWTHEGSLQGWDYIELGGKYYQDMDRLAAMERGLKTWANW  244

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGWK----------CFNEREPLEHFSRprvpq---q  375
            +D  VD  +++VFF  +SP H   N W           C+ E  P+             Q
Sbjct  245  VDSKVDKSRTKVFFLGISPSHINPNEWTSGVTTASSKNCYGETGPISSTGTAYPGVFPEQ  304

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + V+  V+R MN+PVYL DI+ +SAFR+DAHPSVY   +  +++ +     SDCSHWCLP
Sbjct  305  MKVIDMVIREMNYPVYLLDITMLSAFRKDAHPSVYSGDLSPQQRAN--PIYSDCSHWCLP  362

Query  194  GVPDIWNEML  165
            G+PD WNE+ 
Sbjct  363  GLPDTWNELF  372



>gb|AFK49604.1| unknown [Lotus japonicus]
Length=367

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 110/186 (59%), Gaps = 19/186 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTN-FFRYMNPMVAYEKGLMTWAKWI  513
            E  + W+G DVL+FDS HWW H+  + +WD+I EG       MN +V YEK L TWAKW+
Sbjct  187  EAGKTWKGKDVLIFDSWHWWLHTGRKQAWDFIQEGNKPLVGDMNRLVVYEKALNTWAKWV  246

Query  512  DLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            + N+DP K+RV F+ +SP H     W       C  +  PL  F+         +VL++V
Sbjct  247  NANIDPTKTRVLFQGVSPDHANAGQWGEPGANSCVGQSRPLLGFNYPGGPHPAELVLEKV  306

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYK-SDCSHWCLPGVPDIW  177
            L  M  PVYL +I+T+S  R+DAHPSVYG            G++ +DCSHWCL GVPD W
Sbjct  307  LGTMKKPVYLLNITTLSQLRKDAHPSVYGA----------GGHRNADCSHWCLAGVPDTW  356

Query  176  NEMLNA  159
            N++L A
Sbjct  357  NQLLYA  362



>ref|XP_006415616.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
 gb|ESQ33969.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
Length=386

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 109/185 (59%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I+  A  W+  DVLVF+S HWWTH      WDYI +G++  R MN + A+ KGL TWA+W
Sbjct  209  IDGGANLWKNMDVLVFNSWHWWTHKGQSQGWDYIRDGSSLVRDMNRLDAFYKGLTTWARW  268

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +D NVD  +++VFF+ +SP H     W      C  + +PL   +     P    V+ +V
Sbjct  269  VDQNVDTSRTKVFFQGISPTHYEGREWNEPRKSCNGQAQPLSGSNYPSGQPPSAGVVSKV  328

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M  PV+L DI+T+S  R+DAHPS+YG   G           +DCSHWCLPG+PD WN
Sbjct  329  LNAMRKPVFLLDITTLSQLRKDAHPSIYGGDGG-----------TDCSHWCLPGLPDTWN  377

Query  173  EMLNA  159
            ++L A
Sbjct  378  QLLYA  382



>gb|KDO77821.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=374

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 112/192 (58%), Gaps = 26/192 (14%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  ++W+  DVL+F+S HWWTH+     WDYI +G    + M+ + A+ KG+ TWA+W+D
Sbjct  190  QAGKFWKDMDVLIFNSWHWWTHTGKAQPWDYIQDGQTLLKDMDRLEAFYKGMSTWARWVD  249

Query  509  LNVDPRKSRVFFRSMSPKH--------NRENGW-----KCFNEREPLEHFSR-prvpqql  372
            LNVDP +++VFF+ +SP H         R   W      C  E EPL   +     P   
Sbjct  250  LNVDPSQTKVFFQGISPTHYTFISLTETRGKEWNSRKKNCLGELEPLSGSTYPGGAPPAA  309

Query  371  vvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLP  195
             V+ +VL  +N PVYL DI+T+S  R+DAHPS Y GK  G           +DCSHWCLP
Sbjct  310  SVVNKVLSSINKPVYLLDITTLSQLRKDAHPSTYSGKHSG-----------TDCSHWCLP  358

Query  194  GVPDIWNEMLNA  159
            G+PD WN++L A
Sbjct  359  GLPDTWNQLLYA  370



>ref|XP_002525125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37252.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 108/181 (60%), Gaps = 17/181 (9%)
 Frame = -2

Query  683  ARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLN  504
             R W G D+L+F++ HWWTH+     WDY+ EG   ++ MN +VAY KGL TWA+W++ N
Sbjct  177  GRAWAGMDMLIFNTWHWWTHTGRTQPWDYMQEGNKLYKDMNRLVAYYKGLTTWARWVNRN  236

Query  503  VDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSRprvpqql-vvlkqvlrRM  342
            VDP K++VFF+ +SP H     W      C  E +P      P       VV+ +VL R+
Sbjct  237  VDPSKTKVFFQGISPTHYEGKDWNEPTRSCAAETQPFFGIRYPAGTPLAWVVVNKVLSRI  296

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
              PVYL D++T+S +R+DAHPS Y            R   +DCSHWCLPG+PD WNE+L 
Sbjct  297  KKPVYLLDVTTLSEYRKDAHPSAYS-----------RDRNTDCSHWCLPGLPDTWNELLY  345

Query  161  A  159
            A
Sbjct  346  A  346



>ref|XP_002515280.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47264.1| conserved hypothetical protein [Ricinus communis]
Length=563

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 109/183 (60%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+L+F++AHWW+H + ++  +Y  EG      ++   A+ + LMTWA
Sbjct  372  DAIDHGSSRWRGADILIFNTAHWWSHFKTKAGINYYQEGNQVHPKLDVSTAFRRALMTWA  431

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++PRK++VFFRS +P H R   W     C    EPL   S    P++  + + +
Sbjct  432  SWVDRHINPRKTQVFFRSSAPSHFRGGQWNSGGHCKEATEPLNETSGVAFPEKNTITEDI  491

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            ++ M  PV   +I+++S FR D HPS+YGK       +       DCSHWCLPG+PD WN
Sbjct  492  IKHMTTPVTFLNITSLSEFRIDGHPSIYGKT----PTKRYTSSGQDCSHWCLPGIPDTWN  547

Query  173  EML  165
            E+L
Sbjct  548  ELL  550



>ref|XP_009787057.1| PREDICTED: protein PMR5-like isoform X1 [Nicotiana sylvestris]
Length=391

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 112/192 (58%), Gaps = 17/192 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WRG DVL F++ HWWTH  +   WDYI +G   +  M+P+VA E+GL TWA+W
Sbjct  196  IRGNANAWRGVDVLSFNTGHWWTHKGSSQGWDYIDDGGRMYEDMDPLVAMERGLRTWARW  255

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW---------KCFNEREPLE------HFSRprvp  381
            +D N+D  ++R+FF+  SP H   + W          C+ E  P+         +     
Sbjct  256  VDSNIDRSRTRLFFQGTSPNHYDSSVWNGGAATTSGSCYGETSPVTTTLLTGSTNPGMYS  315

Query  380  qqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWC  201
             Q  V++ V+R M+ P +L DI+ +SA R+DAHPS+Y   +    +Q +   K+DC+HWC
Sbjct  316  DQTNVVQTVIRDMDNPPFLLDITLLSAMRKDAHPSIYSGDL--NSQQRINPNKADCTHWC  373

Query  200  LPGVPDIWNEML  165
            LPG+PD WN++ 
Sbjct  374  LPGLPDTWNQLF  385



>ref|XP_009375160.1| PREDICTED: protein trichome birefringence-like [Pyrus x bretschneideri]
Length=454

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +      Y  EG+  +  +N   A+ K L TWA
Sbjct  247  DLIERSSDKYKTADVLIFNTGHWWTHEKTSRGKGYYQEGSYIYDVLNVKEAFRKALTTWA  306

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPL-EHFSRprvpqqlvvlkq  357
            +W+D N++P K+ VFFR+ SP H R   W    +C +  EPL +  +R +   +L +   
Sbjct  307  RWVDTNLNPEKTIVFFRAYSPNHFRGGRWNSGGQCHDLIEPLAKETTRGKYASKLRIFDS  366

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+  M  P++  +I+ M+ FRRDAHPS+Y K    EE++       DCSHWCLPGVPD W
Sbjct  367  VITGMKTPIFYLNITRMTDFRRDAHPSIYRKQNFTEEERKSPFRYQDCSHWCLPGVPDTW  426

Query  176  NEMLNAM  156
            NE+L A 
Sbjct  427  NELLYAQ  433



>gb|KDO77819.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=372

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 110/184 (60%), Gaps = 18/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  ++W+  DVL+F+S HWWTH+     WDYI +G    + M+ + A+ KG+ TWA+W+D
Sbjct  190  QAGKFWKDMDVLIFNSWHWWTHTGKAQPWDYIQDGQTLLKDMDRLEAFYKGMSTWARWVD  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            LNVDP +++VFF+ +SP H     W      C  E EPL   +     P    V+ +VL 
Sbjct  250  LNVDPSQTKVFFQGISPTHYTGKEWNSRKKNCLGELEPLSGSTYPGGAPPAASVVNKVLS  309

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
             +N PVYL DI+T+S  R+DAHPS Y GK  G           +DCSHWCLPG+PD  N+
Sbjct  310  SINKPVYLLDITTLSQLRKDAHPSTYSGKHSG-----------TDCSHWCLPGLPDTRNQ  358

Query  170  MLNA  159
            +L A
Sbjct  359  LLYA  362



>ref|XP_010253781.1| PREDICTED: protein PMR5-like [Nelumbo nucifera]
Length=390

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 111/187 (59%), Gaps = 12/187 (6%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WRG DVL F+S HWWTH      WDY+  G + +  M+ +VA+E+G+ TWA+W
Sbjct  200  ISGNANAWRGVDVLSFNSGHWWTHKGALQGWDYMESGGSLYEDMDRLVAFERGMRTWARW  259

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW--------KCFNEREPLEHFSRprvpq-qlvvl  363
            +D NV   K+RVFF++ SP H     W         C+ E  PL   + P     Q+ V+
Sbjct  260  VDSNVQTTKTRVFFQATSPTHYNPTEWNAAASVSKNCYRETAPLSGATYPGAYPDQMKVI  319

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVP  186
            + VLR M+ P YL DI+T+S  R+D HPS+Y G +  Q+     R   +DCSHWCLPG+P
Sbjct  320  QAVLRDMSSPAYLLDITTLSELRKDGHPSIYSGDLSPQQRANPDR--SADCSHWCLPGLP  377

Query  185  DIWNEML  165
            D WN++ 
Sbjct  378  DTWNQLF  384



>ref|XP_011024935.1| PREDICTED: protein PMR5-like [Populus euphratica]
 ref|XP_011024936.1| PREDICTED: protein PMR5-like [Populus euphratica]
Length=394

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 114/189 (60%), Gaps = 14/189 (7%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WR +DVL+F++ HWW+H  +   WDY+  G  +++ M+ +VA E+GL TWAKW
Sbjct  202  ISGNANAWRNADVLMFNTGHWWSHKGSLQGWDYMESGGTYYQDMDRLVALERGLGTWAKW  261

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGWK----------CFNEREPLEHFSR-prvpqqlv  369
            +D N+D  ++RVFF+S+SP H   + W           C+ E  PL   +     P Q+ 
Sbjct  262  VDANIDTTRTRVFFQSISPTHYNPSEWSTGTTIATSKNCYGETAPLSGSTYPGEYPDQMR  321

Query  368  vlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPG  192
            V+  V+R M  P YL DI+ +S  R+D HPS+Y G +  Q+     R   +DCSHWCLPG
Sbjct  322  VVDTVIRGMQNPAYLLDITMLSELRKDGHPSIYSGDLSPQQRASPDR--SADCSHWCLPG  379

Query  191  VPDIWNEML  165
            +PD WN++L
Sbjct  380  LPDTWNQLL  388



>ref|XP_009339560.1| PREDICTED: protein trichome birefringence-like 43 [Pyrus x bretschneideri]
Length=358

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 112/181 (62%), Gaps = 15/181 (8%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++ + W+  DVL+F++ HWW H++ +  WD+I +G    R MN +VAYEK L TWA+W+D
Sbjct  180  KDGKLWKEYDVLIFNTWHWWLHARRKQPWDFIQDGKTLHRDMNRLVAYEKALKTWARWVD  239

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSRprvpqqlvvlkqvlr  348
             NVD +K++VFF+S+SP H   + W+      C  ER+PL            V++++VL 
Sbjct  240  KNVDTKKTKVFFQSISPSHWNASHWEYPEGRNCTAERKPLVVAYPRSKHLAEVIVEKVLS  299

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             M+ PV L +++ +S  R+D HPS+YG         HL     DCSHWCLPGVPD WN++
Sbjct  300  DMSKPVVLLNVTGLSQLRKDGHPSIYG------NGAHL---GMDCSHWCLPGVPDTWNQL  350

Query  167  L  165
            L
Sbjct  351  L  351



>ref|XP_010099368.1| hypothetical protein L484_004794 [Morus notabilis]
 gb|EXB78093.1| hypothetical protein L484_004794 [Morus notabilis]
Length=370

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 107/185 (58%), Gaps = 20/185 (11%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +N   WRG D+L+F++ HWWTH+     WDY+ EG   F+ MN ++A+ KGL TWA+WI+
Sbjct  194  KNGNGWRGMDLLIFNTWHWWTHTGRSQPWDYLQEGNKLFKDMNRLIAFYKGLTTWARWIN  253

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqqlvvlkqvlrR  345
            LNVDP K++VFF+ +SP H     W      C  E  P  +F         +    V + 
Sbjct  254  LNVDPSKTKVFFQGISPTHYEGRDWNQPSRSCSGETMP--YFGARYPAGTPLAWVVVNKV  311

Query  344  MN---FPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +N    PVYL D++ +S +R+D HPS Y    G+          +DCSHWCLPG+PD WN
Sbjct  312  LNRLRKPVYLLDVTALSQYRKDGHPSGYS---GEHS-------GTDCSHWCLPGLPDTWN  361

Query  173  EMLNA  159
            E+L A
Sbjct  362  ELLYA  366



>gb|KDO77822.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=368

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 111/186 (60%), Gaps = 20/186 (11%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSS--WDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            +  ++W+  DVL+F+S HWWTH+       WDYI +G    + M+ + A+ KG+ TWA+W
Sbjct  190  QAGKFWKDMDVLIFNSWHWWTHTGKAQPRRWDYIQDGQTLLKDMDRLEAFYKGMSTWARW  249

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +DLNVDP +++VFF+ +SP H     W      C  E EPL   +     P    V+ +V
Sbjct  250  VDLNVDPSQTKVFFQGISPTHYTGKEWNSRKKNCLGELEPLSGSTYPGGAPPAASVVNKV  309

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            L  +N PVYL DI+T+S  R+DAHPS Y GK  G           +DCSHWCLPG+PD W
Sbjct  310  LSSINKPVYLLDITTLSQLRKDAHPSTYSGKHSG-----------TDCSHWCLPGLPDTW  358

Query  176  NEMLNA  159
            N++L A
Sbjct  359  NQLLYA  364



>ref|XP_002305083.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
 gb|EEE85594.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
Length=411

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 107/183 (58%), Gaps = 17/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G D+LVF+S HWW H+     WDYI +G   ++ M+ + A+ KGL TWA+W+D
Sbjct  236  EAGNAWKGMDMLVFNSWHWWLHTGKSQGWDYIRDGPALYKNMDRLEAFNKGLTTWARWVD  295

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             NVDP K++VFF+ +SP H +   W      C  E  PL   +     P  + V+ +VL 
Sbjct  296  QNVDPSKTKVFFQGISPTHYQGKDWNQPQKSCSGEAVPLSGSTYPAGAPPAVGVVSKVLS  355

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             +  PVYL DI+T+S  R+DAHPS Y             G  +DCSHWCLPG+PD WN++
Sbjct  356  SITKPVYLLDITTLSQLRKDAHPSTYSD-----------GSGTDCSHWCLPGLPDTWNQL  404

Query  167  LNA  159
            L A
Sbjct  405  LYA  407



>ref|XP_011045911.1| PREDICTED: protein trichome birefringence-like 38 [Populus euphratica]
Length=362

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 106/178 (60%), Gaps = 17/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+G D+L+F+S HWW H+     WDYI +G+  ++ M+ + A+ KGL TW +W+D N+DP
Sbjct  192  WKGMDMLIFNSWHWWVHTGRSQGWDYIRDGSALYKNMDRLTAFSKGLTTWGRWVDQNIDP  251

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H +   W      C  E  PL   +     P    V+ +VLR M  P
Sbjct  252  SKTKVFFQGISPTHYQGKDWNQPKKSCSGEAVPLSGSTYPAGAPPAAAVVNKVLRSMKKP  311

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S  R+DAHPS Y             G  +DCSHWCLPG+PD WN++L A
Sbjct  312  VYLLDITTLSQLRKDAHPSTYS-----------HGSGTDCSHWCLPGLPDTWNQLLYA  358



>gb|KDP40076.1| hypothetical protein JCGZ_02074 [Jatropha curcas]
Length=357

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 114/186 (61%), Gaps = 20/186 (11%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +N R WRG+D L+F++ HWW H+  +  WD+I +G    + M+ +VAYEK L TWA+WI 
Sbjct  178  KNGRSWRGADTLIFNTWHWWLHTGRKQPWDWIQQGKRLSKDMDRLVAYEKALSTWARWIQ  237

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPL--EHFSRprvpqqlvvlkqv  354
            L+++P K++VFF+ +SP H     W       C  E EPL  +++ R        ++++V
Sbjct  238  LSINPIKTKVFFQGVSPDHANSTDWSNSLGKNCMGETEPLFKQNYPR-GTHPAEAIVERV  296

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS-DCSHWCLPGVPDIW  177
            L  ++ P+YL +I+ +S  R+D HPS YG            G+++ DCSHWCLPGVPD W
Sbjct  297  LGTISKPIYLLNITFLSQMRKDGHPSAYG----------FGGHRTPDCSHWCLPGVPDTW  346

Query  176  NEMLNA  159
            NE+L A
Sbjct  347  NELLFA  352



>gb|KHN08449.1| hypothetical protein glysoja_014214 [Glycine soja]
Length=364

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 114/187 (61%), Gaps = 18/187 (10%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+L+F+S HWWTH+     WDYI +G N  + M+ + AY KGL TWAK
Sbjct  187  IVAGNA--WKGMDMLIFNSWHWWTHTGKSQGWDYIRDGHNLVKDMDRLEAYNKGLTTWAK  244

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkq  357
            W++ NVDP K++VFF+ +SP H +   W      C  E +P+   +    +P     L  
Sbjct  245  WVEQNVDPSKTKVFFQGISPGHYQGKDWNQPKKTCSGELQPISGSAYPAGLPPATTTLNN  304

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            VLR+M+ PVYL DI+ +S  R+DAHPS Y    G  +        +DCSHWCLPG+PD W
Sbjct  305  VLRKMSTPVYLLDITLLSQLRKDAHPSAYS---GSHK-------GNDCSHWCLPGLPDTW  354

Query  176  NEMLNAM  156
            N++L A+
Sbjct  355  NQLLYAV  361



>ref|XP_010914510.1| PREDICTED: protein trichome birefringence-like 40 [Elaeis guineensis]
Length=418

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  686  NARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTN-FFRYMNPMVAYEKGLMTWAKWID  510
            +A+ WRG+DV+VF++ HWWTH      W+Y   G +     M    A+E GL TWA+W+D
Sbjct  227  SAKSWRGADVMVFNTGHWWTHRGKMRPWNYYEHGGDQLVEDMERDKAFEMGLRTWARWVD  286

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPL--EHFSRprvpqqlvvlkqvlrRMNF  336
             NVDP K+ VFFRS+SP+H REN   C+N+  P+  E + +      +  +++ L +M  
Sbjct  287  RNVDPSKTTVFFRSISPEHKRENLHWCYNQTHPITNETYVQWFPRSMIATVEKTLTKMRT  346

Query  335  PVYLQDISTMSAFRRDAHPSVY----GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            PV   +I+ +S +RRDAH +VY    GK++  E++   + Y +DCSHWCLPG+PD WN +
Sbjct  347  PVRYLNITRLSEYRRDAHAAVYTMRRGKLLTPEQRDQPQTY-ADCSHWCLPGLPDTWNVL  405

Query  167  LNA  159
            L A
Sbjct  406  LLA  408



>emb|CDO96761.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 113/191 (59%), Gaps = 22/191 (12%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+     W+G D LVF++ HWW H  +   WDY+ +G+   + M+ +VA+ KGL TWA
Sbjct  187  DSIDRGNDAWKGMDALVFNTWHWWLHRGDSQPWDYVQDGSTVSKDMDRLVAFSKGLSTWA  246

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpq--qlvvl  363
            +W++ NVD  K++VFF+ +SP H     W      C+ E+EPL+  SR        + V+
Sbjct  247  QWVNQNVDSSKTKVFFQGISPSHYDGKEWGSDSKSCYGEQEPLQG-SRYPAGLPPAVDVV  305

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS--DCSHWCLPGV  189
            K+ L  M  PV L DI+T+S  R+DAHPS YG            G KS  DCSHWCLPGV
Sbjct  306  KKTLSSMQKPVVLLDITTLSQLRKDAHPSGYG------------GSKSGNDCSHWCLPGV  353

Query  188  PDIWNEMLNAM  156
            PD WN++L A+
Sbjct  354  PDTWNQLLYAL  364



>ref|XP_009766231.1| PREDICTED: protein PMR5-like [Nicotiana sylvestris]
Length=386

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 115/190 (61%), Gaps = 12/190 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I +N+  W+G DVL F++ HWWTH  +   WDY+  G   +  MN +VA E+GL TWA
Sbjct  192  DDISKNSNAWKGVDVLSFNTGHWWTHKGSLQGWDYMDAGGTLYEDMNRLVALERGLRTWA  251

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFSR-prvpqq  375
            +WID N+D  ++R+FF+ +SP H   + W           C+ E  P+   +     P Q
Sbjct  252  RWIDANIDKSRTRIFFQGISPTHYNPSEWNTGTSMATSRSCYGETVPMTGTAYPGTYPDQ  311

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + VL+ V+R MN P +L DI+ +SA R+DAHPS+Y   +  E++ +   + +DCSHWCL 
Sbjct  312  MKVLQAVIRDMNNPPFLLDITFLSAMRKDAHPSIYSGALTSEQRAN-PDHSADCSHWCLA  370

Query  194  GVPDIWNEML  165
            G+PD WN++ 
Sbjct  371  GLPDTWNQLF  380



>gb|EYU28072.1| hypothetical protein MIMGU_mgv1a008400mg [Erythranthe guttata]
Length=375

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 115/185 (62%), Gaps = 18/185 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +    W+G D+L+F++ HWWTH  N  SWDYI +G+   + MN ++A+ KGL TWA+W+D
Sbjct  197  QQGNAWKGMDMLIFNTWHWWTHKGNAQSWDYIQDGSTISKDMNRLMAFYKGLTTWARWVD  256

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK-------CFNEREPLEHFS-Rprvpqqlvvlkqv  354
            LN+DP K++VFF+ +SP H +   W+       C  E+ PL   +    VP ++ V+ +V
Sbjct  257  LNIDPAKTKVFFQGISPTHYQGRDWQSASSSKNCNGEQLPLTGSTYPGGVPPEVEVVSRV  316

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            + R+  PV+L DI+T+S  R+DAHPS Y    G            DCSHWCLPG+PD WN
Sbjct  317  INRIKKPVFLLDITTLSQLRKDAHPSAYS---GDHS-------GVDCSHWCLPGLPDTWN  366

Query  173  EMLNA  159
            ++L A
Sbjct  367  QLLYA  371



>gb|KHG17132.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=360

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 112/188 (60%), Gaps = 16/188 (9%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D +EE A+ W+G DVL+F++ HWW H+  +  WD+I EG +    M+ +VAYEKGL TWA
Sbjct  177  DSVEEGAKLWKGIDVLIFNTWHWWLHTGRKQPWDFIKEGNHTQVDMDRLVAYEKGLNTWA  236

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSR-prvpqqlvvl  363
            KW+D NV+  K+ V F+ +SP H   + W       C  ++EP++             V+
Sbjct  237  KWVDANVNTSKTTVLFQGVSPDHINSSDWGEPKAKNCEGQKEPIKGGDYPGGQHPAEKVV  296

Query  362  kqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPD  183
            ++VL+ M+ PVYL +++ +S  R+D HPSVYG         H      DCSHWCL GVPD
Sbjct  297  EKVLKTMSKPVYLLNVTNLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPD  347

Query  182  IWNEMLNA  159
             WN++L A
Sbjct  348  TWNQLLYA  355



>ref|XP_003608140.1| hypothetical protein MTR_4g088030 [Medicago truncatula]
Length=217

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 107/181 (59%), Gaps = 16/181 (9%)
 Frame = -2

Query  683  ARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLN  504
             + W   D+L+F+S HWW H+ +   WD+I +G+N  R M+ + A+ KGL TWA W+D N
Sbjct  43   GKAWVDMDMLIFNSWHWWIHTGDLRGWDFIRDGSNLVRDMDRLDAFYKGLTTWAGWVDAN  102

Query  503  VDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFS-RprvpqqlvvlkqvlrRM  342
            VDP K+++FF+ +SP HN+   W      C  E EPL   +    +P    V+ +VL+ M
Sbjct  103  VDPTKTKLFFQGISPTHNKGQDWNEPKKTCSGEVEPLPGTTYPAPLPPANDVVNKVLKNM  162

Query  341  NFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLN  162
               VYL DI+ +S  R+DAHPS+Y K               DCSHWCLPG+PD WN +LN
Sbjct  163  KKQVYLLDITLLSQLRKDAHPSIYTK----------DPTGIDCSHWCLPGLPDTWNILLN  212

Query  161  A  159
            A
Sbjct  213  A  213



>ref|XP_002279857.1| PREDICTED: protein trichome birefringence-like 39 [Vitis vinifera]
Length=364

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 114/183 (62%), Gaps = 15/183 (8%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++   W+G D+L+F++ HWWTH+     WDY+ EG   ++ MN ++AY KGL TWA+W++
Sbjct  187  QSGNAWKGMDMLIFNTWHWWTHTGRTQPWDYVQEGNKLYKDMNRLIAYYKGLTTWARWVN  246

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
            +NVDP K++VFF+ +SP H     W      C  E +P    S    +P   VV+ +VL 
Sbjct  247  INVDPSKTKVFFQGISPTHYEGKDWNQPSRSCDGEMQPYFGASYPAGIPMAAVVVNKVLS  306

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            R+  PVYL D++T+S +R DAHPS Y         +H  G  +DCSHWCLPG+PD WN++
Sbjct  307  RIKKPVYLLDVTTLSQYRIDAHPSDY-------SGEH--GGITDCSHWCLPGLPDTWNQL  357

Query  167  LNA  159
            L A
Sbjct  358  LYA  360



>ref|XP_006840447.1| hypothetical protein AMTR_s00045p00169080 [Amborella trichopoda]
 gb|ERN02122.1| hypothetical protein AMTR_s00045p00169080 [Amborella trichopoda]
Length=419

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 112/183 (61%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  W+ +D+LVF++AHWWTH++ ++  +Y  EG     +++ + AY + LMTWA
Sbjct  227  DTIDRGSSRWKKADILVFNTAHWWTHTKTKAGVNYYQEGDQVHHHLDVLTAYRRALMTWA  286

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +  P K++VFFR+ +P H     W     C  E +PL +++     ++L + ++V
Sbjct  287  SWVDRHAIPGKTQVFFRTSAPSHFSGGQWNAGGHCNGETQPLRNYTNGEFAEKLRLTEEV  346

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            ++ M  PV + +I+ +S  R D HPSVYG+  G      ++    DCSHWCLPGVPD WN
Sbjct  347  IKEMRTPVTVLNITDISGLRVDGHPSVYGRKPGVSPSSSVQ----DCSHWCLPGVPDTWN  402

Query  173  EML  165
            E+L
Sbjct  403  ELL  405



>ref|XP_010453963.1| PREDICTED: protein PMR5-like [Camelina sativa]
Length=409

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 114/191 (60%), Gaps = 14/191 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  NA  W  +D+L+F++ HWW+H+ N   WD I  G  +++ M+  VA EK L TWA
Sbjct  215  DEISGNANAWHDADLLIFNTGHWWSHTGNMQGWDLIQSGNTYYQDMDRFVAMEKALRTWA  274

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK---------CFNEREPLEHFS---Rprvpq  378
             W++ ++D  K++VFF S+SP H+  + W          C+ E EP+   +        Q
Sbjct  275  YWVETHIDRSKTQVFFLSISPTHDNPSDWAAPSSTGSKNCYGETEPITGAAYPVSSYTDQ  334

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCL  198
               V+ +VL+ M+ P +L DI+ +S+ R+D HPSVY  ++   ++   R  +SDCSHWCL
Sbjct  335  LRSVIVEVLQGMHNPAFLLDITLLSSLRKDGHPSVYSGLISGSQRS--RPDQSDCSHWCL  392

Query  197  PGVPDIWNEML  165
            PG+PD WN++L
Sbjct  393  PGLPDTWNQLL  403



>ref|XP_003545134.1| PREDICTED: protein YLS7-like [Glycine max]
Length=355

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 111/184 (60%), Gaps = 17/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  + W+G+ +L+FDS HWW H   +  WD+I EG   F+ MN +VAYEKGL TWAKW++
Sbjct  177  EAGKIWKGNHILIFDSWHWWLHIGRKQPWDFIQEGNRTFKDMNRLVAYEKGLKTWAKWVE  236

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             NVDP K+RVFF+ +SP H     W      C  ++ P++ F          +VL++VL 
Sbjct  237  DNVDPNKTRVFFQGVSPDHLNGAKWGEPRASCEEQKVPVDGFKYPGGSHPAELVLQKVLG  296

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS-DCSHWCLPGVPDIWNE  171
             M+  V L +I+T+S  R+D HPSVYG            G++  DCSHWCLPGVPD WN 
Sbjct  297  AMSKRVNLLNITTLSQMRKDGHPSVYG----------YGGHRDMDCSHWCLPGVPDTWNL  346

Query  170  MLNA  159
            +L A
Sbjct  347  LLYA  350



>ref|XP_011005473.1| PREDICTED: protein trichome birefringence-like 37 [Populus euphratica]
Length=359

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 106/183 (58%), Gaps = 17/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G D+LVF+S HWW H+     WDYI +G   ++ M+ + A+ KGL TW +W+D
Sbjct  184  EAGNAWKGMDMLVFNSWHWWLHTGKSQGWDYIRDGPALYKNMDRIEAFSKGLTTWGRWVD  243

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             NVDP K++VFF+ +SP H +   W      C  E  PL   +     P  + V+ +VL 
Sbjct  244  QNVDPSKTKVFFQGISPTHYQGKDWNQPQKSCSGEAVPLSGSTYPAGAPPAVGVVSKVLS  303

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             +  PVYL DI+T+S  R+DAHPS Y             G  +DCSHWCLPG+PD WN++
Sbjct  304  SITKPVYLLDITTLSQLRKDAHPSTYSD-----------GSGTDCSHWCLPGLPDTWNQL  352

Query  167  LNA  159
            L A
Sbjct  353  LYA  355



>ref|XP_003542986.1| PREDICTED: protein YLS7-like isoform X1 [Glycine max]
Length=375

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 114/187 (61%), Gaps = 18/187 (10%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+L+F+S HWWTH+     WDYI +G N  + M+ + AY KGL TWAK
Sbjct  198  IVAGNA--WKGMDMLIFNSWHWWTHTGKSQGWDYIRDGHNLVKDMDRLEAYNKGLTTWAK  255

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkq  357
            W++ NVDP K++VFF+ +SP H +   W      C  E +P+   +    +P     L  
Sbjct  256  WVEQNVDPSKTKVFFQGISPGHYQGKDWNQPKKTCSGELQPISGSAYPAGLPPATTTLNN  315

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            VLR+M+ PVYL DI+ +S  R+DAHPS Y    G  +        +DCSHWCLPG+PD W
Sbjct  316  VLRKMSTPVYLLDITLLSQLRKDAHPSAYS---GSHK-------GNDCSHWCLPGLPDTW  365

Query  176  NEMLNAM  156
            N++L A+
Sbjct  366  NQLLYAV  372



>gb|KJB08986.1| hypothetical protein B456_001G116900 [Gossypium raimondii]
 gb|KJB08987.1| hypothetical protein B456_001G116900 [Gossypium raimondii]
Length=389

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 111/190 (58%), Gaps = 12/190 (6%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   WR +DVLVF++ HWW H  +   WD I  G  +++ M+ +VA EKGL TWA
Sbjct  195  DDIAGNGNAWRMADVLVFNTGHWWGHEGSLRGWDLIQSGGKYYQDMDRLVAMEKGLRTWA  254

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFSRprvpq-q  375
             W+D NVD  ++RVFF+S SP H   N W           C+ E EP++  +       Q
Sbjct  255  NWVDSNVDITRTRVFFQSASPDHYNPNEWSAAATATTAKNCYGETEPMKGTTYTSTYADQ  314

Query  374  lvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLP  195
            + V+ +V+R M+ P YL DI+ +S  R+D HPS+Y       ++ + +   +DCSHWCLP
Sbjct  315  MGVVNEVIREMHVPTYLMDITMLSELRKDGHPSIYRGDFSPSQRANPQK-SADCSHWCLP  373

Query  194  GVPDIWNEML  165
            G+PD WNE+ 
Sbjct  374  GLPDTWNELF  383



>ref|XP_010483461.1| PREDICTED: protein PMR5-like [Camelina sativa]
Length=405

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (60%), Gaps = 14/191 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  NA  W  +D+L+F++ HWW+H+ N   WD I  G  +++ M+  VA EK L TWA
Sbjct  211  DEISGNANAWHDADLLIFNTGHWWSHTGNMQGWDLIQSGNTYYQDMDRFVAMEKALRTWA  270

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK---------CFNEREPLEHFS---Rprvpq  378
             W++ +VD  K++VFF S+SP H+  + W          C+ E EP+   +        Q
Sbjct  271  YWVESHVDRSKTQVFFLSISPTHDNPSDWAAPSSTGSKNCYGETEPITGAAYPVSSYTDQ  330

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCL  198
               V+ +VL+ M+ P +L DI+ +S+ R+D HPSVY  ++   ++   R  +SDCSHWCL
Sbjct  331  LRSVIVEVLQGMHNPAFLLDITLLSSLRKDGHPSVYSGLISGSQRS--RPDQSDCSHWCL  388

Query  197  PGVPDIWNEML  165
            PG+PD WN++L
Sbjct  389  PGLPDTWNQLL  399



>gb|KHN40085.1| hypothetical protein glysoja_009462 [Glycine soja]
Length=397

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 113/189 (60%), Gaps = 14/189 (7%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            ++EN   WRG+DVL F++ HWW+H  +   WDYI  G  ++  M+ + A E+G+ TWA W
Sbjct  205  VDENGDAWRGADVLSFNTGHWWSHQGSLQGWDYIELGGKYYPDMDRLAALERGMKTWANW  264

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----------KCFNEREPLEHFS-Rprvpqql  372
            +D N+D  K RVFF+++SP H   N W            C+ E  P+   +     P+Q+
Sbjct  265  VDNNIDKSKIRVFFQAISPTHYNPNEWNVGQTTVMTTKNCYGETAPISGTTYPGAYPEQM  324

Query  371  vvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPG  192
             V+  V+R M  P YL DI+ +SA R+D HPS+Y   +  +++ +    ++DCSHWCLPG
Sbjct  325  RVVDMVIREMKNPAYLLDITMLSALRKDGHPSIYSGELSPQKRANPN--RADCSHWCLPG  382

Query  191  VPDIWNEML  165
            +PD WNE+ 
Sbjct  383  LPDTWNELF  391



>ref|XP_009339559.1| PREDICTED: protein trichome birefringence-like 43 [Pyrus x bretschneideri]
Length=358

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 109/180 (61%), Gaps = 15/180 (8%)
 Frame = -2

Query  686  NARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDL  507
            + + W+  DVL+FD+ HWW H+  +  WD+I +G    R MN +VAYEK L TWA+W+D 
Sbjct  181  DGKLWKEYDVLIFDTWHWWLHASRKQPWDFIQDGKTLHRDMNRLVAYEKALKTWARWVDK  240

Query  506  NVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSRprvpqqlvvlkqvlrR  345
            NVD ++++VFF+S+SP H   + W       C  ER+PL            V++++VL  
Sbjct  241  NVDTKETKVFFQSISPSHWNASQWGYPEGRNCTAERKPLVVAYPRSKHLAEVIVEKVLSD  300

Query  344  MNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            M+ PV L +++ +S  R+D HPS+YG         HL     DC+HWCLPGVPD WN++L
Sbjct  301  MSKPVVLLNVTGLSQLRKDGHPSIYG------NGAHL---GMDCTHWCLPGVPDTWNQLL  351



>gb|KHN21700.1| hypothetical protein glysoja_050079 [Glycine soja]
Length=253

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 104/184 (57%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  + W+G DV++FDS HWW H+  +  WD I  G + +R M+ +VAY   L TWAKW+D
Sbjct  74   QAGQTWKGIDVMIFDSWHWWIHTGRKQPWDLIQVGNHTYRDMDRLVAYAIALNTWAKWVD  133

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSRprvpqqlvvlkqvlr  348
             N+DP ++RVFF+ +SP H     W       C  +  P+  F  P  P    ++ + + 
Sbjct  134  YNIDPTRTRVFFQGVSPDHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELVLEKVL  193

Query  347  -RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
              M  PVYL DI+T+S  R D HPSVYG         HL     DCSHWCL GVPD WNE
Sbjct  194  RAMQKPVYLLDITTLSQLRIDGHPSVYGF------GGHL---DPDCSHWCLAGVPDTWNE  244

Query  170  MLNA  159
            +L A
Sbjct  245  LLYA  248



>ref|XP_006594557.1| PREDICTED: protein YLS7-like isoform X2 [Glycine max]
Length=390

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 114/187 (61%), Gaps = 18/187 (10%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            ++  NA  W+G D+L+F+S HWWTH+     WDYI +G N  + M+ + AY KGL TWAK
Sbjct  213  IVAGNA--WKGMDMLIFNSWHWWTHTGKSQGWDYIRDGHNLVKDMDRLEAYNKGLTTWAK  270

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkq  357
            W++ NVDP K++VFF+ +SP H +   W      C  E +P+   +    +P     L  
Sbjct  271  WVEQNVDPSKTKVFFQGISPGHYQGKDWNQPKKTCSGELQPISGSAYPAGLPPATTTLNN  330

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            VLR+M+ PVYL DI+ +S  R+DAHPS Y    G  +        +DCSHWCLPG+PD W
Sbjct  331  VLRKMSTPVYLLDITLLSQLRKDAHPSAYS---GSHK-------GNDCSHWCLPGLPDTW  380

Query  176  NEMLNAM  156
            N++L A+
Sbjct  381  NQLLYAV  387



>ref|XP_010685528.1| PREDICTED: protein PMR5-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 111/195 (57%), Gaps = 18/195 (9%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  N   W+G DVL+F++ HWWTH  +   WDY+  G   ++ M+ + A  +GL TWA
Sbjct  212  DEISGNGNAWQGVDVLIFNTGHWWTHKGSLQGWDYMESGGMLYKDMDRLTALNQGLTTWA  271

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW---------KCFNEREPLEHFSRpr------  387
            +W+D NVD  ++RVFF+S+SP H+    W          C+ E  P+             
Sbjct  272  RWVDTNVDIPRTRVFFQSISPTHSNPAEWGSVSMATTKNCYGETTPVSGMVYNTDGYPAD  331

Query  386  vpqqlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCS  210
               Q+ VL  VL+  + PVYL DI+ +SA R+DAHPS+Y G +  Q+     R   +DCS
Sbjct  332  DADQMRVLDTVLKETSVPVYLLDITMLSAMRKDAHPSIYSGDLTAQQRANPQR--SADCS  389

Query  209  HWCLPGVPDIWNEML  165
            HWCLPG+PD WN++ 
Sbjct  390  HWCLPGLPDTWNQLF  404



>ref|XP_009380697.1| PREDICTED: protein PMR5 isoform X4 [Musa acuminata subsp. malaccensis]
 ref|XP_009380698.1| PREDICTED: protein PMR5 isoform X4 [Musa acuminata subsp. malaccensis]
 ref|XP_009380699.1| PREDICTED: protein PMR5 isoform X4 [Musa acuminata subsp. malaccensis]
 ref|XP_009380701.1| PREDICTED: protein PMR5 isoform X4 [Musa acuminata subsp. malaccensis]
Length=384

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 112/184 (61%), Gaps = 8/184 (4%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  NA  WRG+DVL F+S HWWTH      WDY+ +  +F+  M+ +VA++KG+ TWA W
Sbjct  195  ITGNAEAWRGADVLCFNSGHWWTHKGALQGWDYMGDAGSFYEDMDRLVAFQKGMSTWANW  254

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFS-Rprvpqqlvvlkq  357
            +D  VD  K++VFF+S+SP H     W       CF E  P+  ++     P+Q+ V+K 
Sbjct  255  VDATVDRTKTKVFFQSISPTHYNPAEWNGAASKNCFGETAPVGGWNYTAPYPEQIQVIKG  314

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V++ M  P  L DI+ +S  R+D HPS+Y   +  E++ +     +DCSHWCLPG+PD W
Sbjct  315  VIKAMRSPAALLDITALSELRKDGHPSIYSGDLTPEQRAN-PDRSADCSHWCLPGLPDTW  373

Query  176  NEML  165
            N +L
Sbjct  374  NLLL  377



>ref|XP_004149051.1| PREDICTED: uncharacterized protein LOC101203509 [Cucumis sativus]
 ref|XP_004163473.1| PREDICTED: uncharacterized LOC101203509 [Cucumis sativus]
 gb|KGN65647.1| hypothetical protein Csa_1G478060 [Cucumis sativus]
Length=373

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 109/183 (60%), Gaps = 16/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  + W G DVLVF+S HWWTH  +  +WD I +G   ++ M+ +VA+ KGL TW +W+D
Sbjct  196  EAGKAWLGMDVLVFNSWHWWTHKGDSQAWDLIQDGATRYQDMDRLVAFYKGLTTWGRWVD  255

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLE-HFSRprvpqqlvvlkqvlr  348
            LNVDP K++VFF+ +SP H     W      C  E EPL         P    V+ +VL 
Sbjct  256  LNVDPTKTKVFFQGISPTHYLGKEWNQPKRNCNGESEPLAGSMYPGGAPPAADVVNRVLS  315

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            R+  PVYL DI+T+S  R+DAHP+ Y    G+          +DCSHWCLPG+PD WN++
Sbjct  316  RIKVPVYLLDITTLSQLRKDAHPAGYN---GEHS-------GTDCSHWCLPGLPDTWNQL  365

Query  167  LNA  159
            + A
Sbjct  366  MYA  368



>ref|XP_010443601.1| PREDICTED: protein PMR5 [Camelina sativa]
Length=407

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 113/191 (59%), Gaps = 14/191 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  NA  W  +D+L+F++ HWW+H+ N   WD I  G  +++ M+  VA EK L TWA
Sbjct  213  DEISGNANAWHDADLLIFNTGHWWSHTGNMQGWDLIQSGNTYYQDMDRFVAMEKALRTWA  272

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK---------CFNEREPLEHFS---Rprvpq  378
             W++ +VD  K++VFF S+SP H+  + W          C+ E EP+   +        Q
Sbjct  273  YWVESHVDRSKTQVFFLSISPTHDNPSDWAAPSSTGSKNCYGETEPITGAAYPVSSYTDQ  332

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCL  198
               V+ +VL  M+ P +L DI+ +S+ R+D HPSVY  ++   ++   R  +SDCSHWCL
Sbjct  333  LRSVIVEVLHGMHNPAFLLDITLLSSLRKDGHPSVYSGLISGSQRS--RPDQSDCSHWCL  390

Query  197  PGVPDIWNEML  165
            PG+PD WN++L
Sbjct  391  PGLPDTWNQLL  401



>ref|XP_006477896.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=379

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 109/180 (61%), Gaps = 17/180 (9%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+G D+L+F++ HWW H  ++  WDYI EG N  +YM+ +V + KGL TW KW+D +VDP
Sbjct  201  WKGYDMLIFNTWHWWLHKGSKQPWDYIQEGNNIQKYMDRLVVFNKGLTTWGKWVDSSVDP  260

Query  494  RKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkqvlrRMNFP  333
              ++VFF+ +SP H     W      C  + +P+   +     P  + ++K+VL  M+  
Sbjct  261  TTTKVFFQGISPTHYNGQEWNESKSTCVGQTQPINGSTYPGGSPPAVGIVKEVLSSMSTQ  320

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYK-SDCSHWCLPGVPDIWNEMLNAM  156
            V L DI+TMS  R+D HPS+YG          L G K SDCSHWCL GVPD WNE+L A+
Sbjct  321  VTLLDITTMSQMRKDGHPSIYG----------LDGQKGSDCSHWCLAGVPDTWNEILYAI  370



>gb|KEH39261.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=368

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 107/178 (60%), Gaps = 17/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG DVLVF++ HWWTH+ N   WDYI EG   ++ MN  +A+ KGL TWA+W+++NV+P
Sbjct  198  WRGMDVLVFNTWHWWTHTGNAQPWDYIQEGGKVYKDMNRFIAFYKGLTTWARWVNINVNP  257

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             +++VFF  +SP H     W      C  E EP      P       V++ +VL R+  P
Sbjct  258  AQTKVFFLGISPVHYEGRDWNQPAKSCMRETEPFFGLKYPAGTPMAWVIVNKVLSRLKKP  317

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VY  D++T+S +R+DAHP  Y  V+            +DCSHWCLPG+PD WN +L+A
Sbjct  318  VYFLDVTTLSQYRKDAHPEGYSGVM-----------PTDCSHWCLPGLPDTWNVLLHA  364



>gb|KHN19645.1| hypothetical protein glysoja_042542 [Glycine soja]
Length=288

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 102/182 (56%), Gaps = 16/182 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  + W+G D+L+FDS HWW H+  +  WD I  G    R MN +VAYE  L TWAKWID
Sbjct  109  QAGQTWKGIDILIFDSWHWWLHTGRKQPWDLIQVGNRTVRDMNRLVAYEIALNTWAKWID  168

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSR-prvpqqlvvlkqvl  351
             N+DP ++RV F+ +SP H     W       C  + +P+             VVL++VL
Sbjct  169  YNIDPTRTRVLFQGVSPDHQNPAQWGEPRANFCAGQTKPISGLRYPGGPNPAEVVLEKVL  228

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            + M  PVYL DI+T+S  R D HPSVYG         H      DCSHWCL GVPD WNE
Sbjct  229  KAMQKPVYLLDITTLSQLRIDGHPSVYG---------HGGHLDMDCSHWCLAGVPDTWNE  279

Query  170  ML  165
            +L
Sbjct  280  LL  281



>ref|XP_010259297.1| PREDICTED: protein trichome birefringence-like 6 [Nelumbo nucifera]
Length=504

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+     W+G+D+LVF++AHWW+H + ++  +Y  EG     +++  VA+ + L+TWA
Sbjct  313  DSIDRGTSRWKGADILVFNTAHWWSHYKTKAGVNYYQEGDKVHPHLDVSVAFRRALITWA  372

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++P K+RVFFRS +P H R   W     C    +PL + S    P++ ++ ++V
Sbjct  373  SWVDKHINPHKTRVFFRSSAPSHFRGGQWNSGGHCKEATQPLNNISGINYPEKNIIAEEV  432

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV L +I+ +S +R D HPSVYG+   +     ++    DCSHWCLPG+PD WN
Sbjct  433  IKQMKTPVILLNITNLSEYRIDGHPSVYGRKPDKGSSSSVQ----DCSHWCLPGIPDTWN  488

Query  173  EML  165
            E+L
Sbjct  489  ELL  491



>ref|NP_001058264.1| Os06g0659400 [Oryza sativa Japonica Group]
 dbj|BAD38346.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAD46402.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAF20178.1| Os06g0659400 [Oryza sativa Japonica Group]
 gb|EAZ37883.1| hypothetical protein OsJ_22232 [Oryza sativa Japonica Group]
Length=463

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 113/186 (61%), Gaps = 8/186 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+++A  WR  DVLVF++ HWWTH +     +Y  EG   +   +   AY + L TWA
Sbjct  267  DRIDKSASRWRKVDVLVFNTGHWWTHGKTARGINYYKEGDTLYPQFDSTEAYRRALKTWA  326

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNR----ENGWKCFNEREP-LEHFSRprvpqqlvvlkq  357
            +WID N+DP KS VF+R  S  H R    ++G  C  EREP L        P+++ ++++
Sbjct  327  RWIDKNMDPAKSVVFYRGYSTAHFRGGEWDSGGSCSGEREPTLRGAVIGSYPRKMRIVEE  386

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+ RM FPV L +++ ++ FRRD HPSVYGK    ++       K DCSHWCLPGVPD W
Sbjct  387  VIGRMRFPVRLLNVTKLTNFRRDGHPSVYGKAAAGKKVSR---RKQDCSHWCLPGVPDAW  443

Query  176  NEMLNA  159
            NE++ A
Sbjct  444  NELIYA  449



>ref|XP_009784314.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
sylvestris]
Length=360

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 104/177 (59%), Gaps = 18/177 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W+G DVL+F+S HWWTH+ N   WDYI EG    + MN MVA+ KG+ TWA+W++ N+DP
Sbjct  189  WKGMDVLIFNSWHWWTHTGNSQPWDYIQEGNKVVKDMNRMVAFYKGMTTWARWVNKNIDP  248

Query  494  RKSRVFFRSMSPKHNRENGWK-----CFNEREPL--EHFSRprvpqqlvvlkqvlrRMNF  336
             K+RVFF+ +SP H +   W      C  E +P     +      + +VV K + R    
Sbjct  249  TKTRVFFQGISPVHYQGKHWNEPSKSCKEETQPFFGTKYPAGTPQEAIVVNKVMSRIKKS  308

Query  335  PVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
              YL DI+T+S +R+DAHP  Y  + G           SDCSHWCLPG+PD WN +L
Sbjct  309  KAYLLDITTLSQYRKDAHPGFYSDMHG-----------SDCSHWCLPGLPDTWNLLL  354



>ref|XP_010272740.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=369

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 110/184 (60%), Gaps = 17/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G D+L+F++ HWW H   +  WDYI EG   ++ M+ +VA+EKGL TW+KW+D
Sbjct  186  EGGNAWKGVDMLIFNTWHWWVHKDGKQPWDYIQEGNKMYKDMDRLVAFEKGLTTWSKWVD  245

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             N+DP   +VFF+ +SP H   + W      C  + +PL   +     P  + V+K VL 
Sbjct  246  SNIDPAIRKVFFQGISPTHYNGSEWNQPKMNCNGQTQPLNGSAYPGGSPPAVAVVKNVLS  305

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYK-SDCSHWCLPGVPDIWNE  171
            +M+ PV L DI+T+S  R+D HPS+YG          L G K +DCSHWCL GVPD WN 
Sbjct  306  KMSNPVDLLDITTLSQLRKDGHPSIYG----------LDGKKGTDCSHWCLAGVPDTWNH  355

Query  170  MLNA  159
            +L A
Sbjct  356  LLYA  359



>gb|ACU18958.1| unknown [Glycine max]
Length=352

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 102/182 (56%), Gaps = 16/182 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  R W+G D+L+FDS HWW H+  +  WD I  G    R MN +VAYE  L TWAKWID
Sbjct  173  QAGRTWKGIDILIFDSWHWWLHTGRKQPWDLIQAGNRTVRDMNRLVAYEIALNTWAKWID  232

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSR-prvpqqlvvlkqvl  351
             N+DP ++RV F+ +SP H     W       C  + +P+             VVL++VL
Sbjct  233  YNIDPTRTRVLFQGVSPDHQNPAQWGEPRANFCAGQTKPISGLRYPGGPNPAEVVLEKVL  292

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            + M  PVYL DI+T+S  R D HPSVYG         H      DCSHWCL GVPD WNE
Sbjct  293  KAMQKPVYLLDITTLSQLRIDGHPSVYG---------HGGHLDMDCSHWCLAGVPDTWNE  343

Query  170  ML  165
            +L
Sbjct  344  LL  345



>ref|XP_008221187.1| PREDICTED: protein PMR5 [Prunus mume]
Length=387

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 112/187 (60%), Gaps = 12/187 (6%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I EN++ WR +DVL F++ HWW+H+     WDY+  G  ++R M+ + A EKG+ TWA W
Sbjct  197  ISENSKAWRNADVLSFNTGHWWSHNGGLQGWDYMESGGKYYRDMDRLAALEKGMRTWANW  256

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLEHFSRprvpqqlvv  366
            +D N+D  ++RVFF S+SP H   N W           C+ E  P+   S    P Q+ V
Sbjct  257  VDSNIDTARTRVFFLSISPTHYNPNEWNGGATPTTTKNCYGETAPMTT-SGVTYPDQMRV  315

Query  365  lkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVP  186
            +  V+R M+ P  L DI+ +S  R+D HPS+Y   +  +++ +   + +DCSHWCLPG+P
Sbjct  316  VDNVIRGMSNPASLLDITMLSELRKDGHPSIYSGDLSPQQRAN-PDHSADCSHWCLPGLP  374

Query  185  DIWNEML  165
            D WN++ 
Sbjct  375  DTWNQLF  381



>ref|XP_010035884.1| PREDICTED: protein trichome birefringence-like 43 [Eucalyptus 
grandis]
 gb|KCW47383.1| hypothetical protein EUGRSUZ_K01183 [Eucalyptus grandis]
Length=365

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 110/184 (60%), Gaps = 20/184 (11%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +NA+ W G DVL+F+S HWW H   +  WDYI EG   ++ MN ++AYEK L TWAKW+D
Sbjct  184  QNAKIWEGVDVLIFNSWHWWLHVGRKQPWDYIQEGNKTYKDMNRLMAYEKALNTWAKWVD  243

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPLEHFSR--prvpqqlvvlkqv  354
             +VDP K+ VF++ +SP H   + W       C ++  PL   SR         +V ++V
Sbjct  244  SSVDPSKTTVFYQGVSPDHANASDWAEPKANACLDQTRPLA-VSRYPAGPSPAELVAEKV  302

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS-DCSHWCLPGVPDIW  177
            +R M +PV L +++ +S  R D HPSVYG            G+++ DCSHWCLPGVPD W
Sbjct  303  IRSMTYPVRLLNVTYLSQLRVDGHPSVYG----------FGGHRNMDCSHWCLPGVPDTW  352

Query  176  NEML  165
            N +L
Sbjct  353  NLIL  356



>ref|XP_004489870.1| PREDICTED: uncharacterized protein LOC101510652 [Cicer arietinum]
Length=352

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 114/184 (62%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E  ++W+ SD+L+F+S HWW H+  +  WD++ EG + +R ++ +V YE+ L TWA+WID
Sbjct  173  EVGKFWKESDILIFNSWHWWLHTGKKQPWDFVKEGKHIYRDLDRLVMYEEALKTWAQWID  232

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPL-EHFSRprvpqqlvvlkqvl  351
             NVDP K++VFF+ +SP H   + W       C  ++ P+ E   +       + L+ VL
Sbjct  233  ENVDPNKTKVFFQGISPDHKNGSKWGKPESITCKGQKFPISESKYQGDPHPAELKLEGVL  292

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M  PVYL +I+++S  R+DAHPS+Y    G        G+ +DCSHWCLPGVPD WN 
Sbjct  293  RDMLKPVYLLNITSLSQMRKDAHPSIY---TGH------GGHTNDCSHWCLPGVPDTWNM  343

Query  170  MLNA  159
            +L A
Sbjct  344  LLYA  347



>ref|XP_006280567.1| hypothetical protein CARUB_v10026519mg [Capsella rubella]
 gb|EOA13465.1| hypothetical protein CARUB_v10026519mg [Capsella rubella]
Length=404

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 112/191 (59%), Gaps = 14/191 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I  NA  W  +D+L+F++ HWW+H+ N   WD I  G  +++ M+  VA EK L TWA
Sbjct  210  DEISGNANAWHDADLLIFNTGHWWSHTGNMQGWDLIQSGNTYYQDMDRFVAMEKALRTWA  269

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK---------CFNEREPLEHFS---Rprvpq  378
             W++ +VD  +++VFF S+SP H+  + W          C+ E EP+   +        Q
Sbjct  270  YWVETHVDRSRTQVFFLSISPTHDNPSDWAASSSSGSKNCYGETEPITGAAYPVSSYSDQ  329

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCL  198
               V+ +VL  M+ P +L DI+ +S+ R+D HPSVY  ++     Q  R  +SDCSHWCL
Sbjct  330  LRSVIVEVLHGMHNPAFLLDITLLSSLRKDGHPSVYSGLI--SGSQRARPDQSDCSHWCL  387

Query  197  PGVPDIWNEML  165
            PG+PD WN++L
Sbjct  388  PGLPDTWNQLL  398



>gb|ABA29157.1| unknown [Pisum sativum]
Length=371

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 107/178 (60%), Gaps = 17/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG DVL+F++ HWWTH+ N   WDYI EG   ++ MN  +A+ KGL TWA+W+++NV+P
Sbjct  201  WRGMDVLIFNTWHWWTHTGNAQPWDYIQEGGKLYKDMNRFIAFYKGLTTWARWVNINVNP  260

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             +++VFF  +SP H     W      C  E +P      P       V++ +VL R+  P
Sbjct  261  TQTKVFFLGISPVHYEGRDWNQPAKSCMRETQPFFGLKYPAGTPMAWVIVNKVLNRLKKP  320

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VY  D++T+S +R+DAHP  Y  V+            +DCSHWCLPG+PD WN +L+A
Sbjct  321  VYFLDVTTLSQYRKDAHPEGYSGVMS-----------TDCSHWCLPGLPDTWNVLLHA  367



>ref|XP_004296154.1| PREDICTED: protein trichome birefringence-like 4 [Fragaria vesca 
subsp. vesca]
Length=520

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 112/186 (60%), Gaps = 5/186 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+I  +   ++ SDVLVF++ HWWTH +      Y  EG + +  +N   AY K + TWA
Sbjct  326  DMIHRSLDNYKSSDVLVFNTGHWWTHEKTSRGQGYYQEGDHVYDQLNVKEAYGKAIATWA  385

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFS-Rprvpqqlvvlkq  357
            +W+D N++P K+ VFFR  SP H     W    +C    EP+++ + + + P ++ +L  
Sbjct  386  RWLDANINPEKTIVFFRGYSPNHFSGGRWNTGGQCHGRTEPIQYEAYKGKYPAKMRILDS  445

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+R M  P++  +I+ M+ FRRDAHPSVY K    EE + L     DCSHWCLPGVPD W
Sbjct  446  VIREMKTPIFYLNITKMTDFRRDAHPSVYRKQNLTEEDRQLSLRSQDCSHWCLPGVPDTW  505

Query  176  NEMLNA  159
            NE+L A
Sbjct  506  NELLYA  511



>gb|KHN09214.1| hypothetical protein glysoja_036442 [Glycine soja]
Length=273

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 105/184 (57%), Gaps = 17/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +N   W G DVLVF++ HWWTH+ +   WDY+      F+ MN  +AY KGL TWAKW+ 
Sbjct  98   KNGDSWMGMDVLVFNTWHWWTHTGSSQPWDYVQVNNKLFKDMNRFLAYYKGLTTWAKWVQ  157

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlr  348
             NV+P K++VFF  +SP H +   W      C  E +P      P        V+ +VL 
Sbjct  158  RNVNPAKTKVFFLGISPVHYQGKDWNRPTKSCMGETQPFFGLKYPAGTPMAWRVVSKVLN  217

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            ++  PVY  D++T+S +R+DAHP  Y  V+             DCSHWCLPG+PD WNE+
Sbjct  218  KITKPVYFLDVTTLSQYRKDAHPEGYSGVMA-----------VDCSHWCLPGLPDTWNEL  266

Query  167  LNAM  156
            L+A+
Sbjct  267  LSAV  270



>ref|XP_011002532.1| PREDICTED: protein trichome birefringence-like 39 [Populus euphratica]
Length=371

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 108/183 (59%), Gaps = 16/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
             N   W G D+L+F++ HWWTH+     WDYI EG   ++ MN ++A+ KGL TWA+W++
Sbjct  195  NNGNAWLGMDMLIFNTWHWWTHTGRSQPWDYIQEGGKLYKDMNRLIAFYKGLTTWARWVN  254

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSRprvpqql-vvlkqvlr  348
             NVDP K++VFF+ +SP H     W      C  E +P      P        V+ +VL 
Sbjct  255  RNVDPSKTKVFFQDVSPTHYVGGDWNEPSKSCAAETQPFFGTRYPAGTPLAWAVVNKVLS  314

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            R+  PVYL D++T+S +R+DAHPS YG   G           +DCSHWCLPG+PD WN++
Sbjct  315  RIQKPVYLLDVTTLSQYRKDAHPSRYGGDNG----------GTDCSHWCLPGLPDTWNQL  364

Query  167  LNA  159
            L A
Sbjct  365  LYA  367



>ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
 gb|ERN11118.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
Length=718

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 119/187 (64%), Gaps = 7/187 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D+IE +A  ++ +D++VF++ HWWTH +     DY  EG + +  +N + AY K L TWA
Sbjct  525  DIIENSASKYKNADIIVFNTGHWWTHEKTSRGKDYYQEGNHVYGELNVVDAYRKALKTWA  584

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPL-EHFSRprvpqqlvvlkq  357
            KW+D+NV+P+K++VFFR  S  H     W    +C  E EP+ +       P ++ VL+ 
Sbjct  585  KWVDINVNPKKTQVFFRGYSASHFSGGQWNSGGQCHKETEPIYKEKYLTMYPPKMRVLES  644

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
            V+R M  PV+  +I+ M+ +R+DAHPSVY  K +  EE+     ++ DCSHWCLPGVPDI
Sbjct  645  VMREMKTPVFYLNITRMTDYRKDAHPSVYRKKNLTPEERTSPERFQ-DCSHWCLPGVPDI  703

Query  179  WNEMLNA  159
            WNE+L A
Sbjct  704  WNELLYA  710



>ref|XP_003544889.2| PREDICTED: protein YLS7-like [Glycine max]
Length=460

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 113/189 (60%), Gaps = 14/189 (7%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            ++EN   WRG+DVL F++ HWW+H  +   WDYI  G  ++  M+ + A E+G+ TWA W
Sbjct  268  VDENGDAWRGADVLSFNTGHWWSHQGSLQGWDYIELGGKYYPDMDRLAALERGMKTWANW  327

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----------KCFNEREPLEHFSR-prvpqql  372
            +D N+D  K RVFF+++SP H   N W            C+ E  P+   +     P+Q+
Sbjct  328  VDNNIDKSKIRVFFQAISPTHYNPNEWNVGQTTVMTTKNCYGETAPISGTTYPGAYPEQM  387

Query  371  vvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPG  192
             V+  V+R M  P YL DI+ +SA R+D HPS+Y   +  +++ +    ++DCSHWCLPG
Sbjct  388  RVVDMVIREMKNPAYLLDITMLSALRKDGHPSIYSGELSPQKRANPN--RADCSHWCLPG  445

Query  191  VPDIWNEML  165
            +PD WNE+ 
Sbjct  446  LPDTWNELF  454



>ref|XP_010272739.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=354

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 109/183 (60%), Gaps = 15/183 (8%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G D+L+F++ HWW H+ ++  WDYI EG N ++ M+ +VA+EKG+ TWA W+D
Sbjct  177  EGGNAWKGVDMLIFNTWHWWIHTGSKQPWDYIEEGGNVYKDMDRLVAFEKGMTTWANWVD  236

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqvlr  348
             N+DP  ++VFF+ +SP H   + W      C  + +P+   +     P+   V+K VL 
Sbjct  237  SNIDPASTKVFFQGISPTHYIGSEWNQARMNCNGQTQPVSGSTYPEGSPESAAVVKNVLS  296

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            +M  PV L DI+T+S  R+D HPS YG    Q           DCSHWCL GVPD WNE+
Sbjct  297  KMLKPVDLLDITTLSQLRKDGHPSAYGPDGAQ---------GMDCSHWCLAGVPDTWNEL  347

Query  167  LNA  159
            L A
Sbjct  348  LYA  350



>ref|XP_008229144.1| PREDICTED: protein trichome birefringence-like 4 [Prunus mume]
Length=616

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 116/190 (61%), Gaps = 9/190 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +  S   Y  EG++ +  +N   A+EK L TWA
Sbjct  407  DLIERSSDNYKNADVLIFNTGHWWTHEKTSSGKGYYQEGSHVYGELNVDDAFEKALTTWA  466

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRp----rvpqqlvv  366
            +W+D N++P+K+ VFFR  SP H R   W     C  E +P  +          P  + +
Sbjct  467  RWVDTNINPKKTAVFFRGYSPSHFRGGEWNSGGHCHGETKPTTNMESTEYGGEYPSNMKI  526

Query  365  lkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVP  186
            L  V+++M  P++  +I+TM+ FR+DAHPS+Y K    EE++     + DCSHWCLPGVP
Sbjct  527  LDSVVKKMKTPIFYLNITTMTDFRKDAHPSIYRKPNLTEEERKPPMIQ-DCSHWCLPGVP  585

Query  185  DIWNEMLNAM  156
            D WNE++ A 
Sbjct  586  DTWNELIYAQ  595



>gb|KJB68384.1| hypothetical protein B456_010G242200 [Gossypium raimondii]
Length=373

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 108/183 (59%), Gaps = 18/183 (10%)
 Frame = -2

Query  686  NARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDL  507
              + W+G DVL+F+S HWWTH     +WDYI +G+   + MN ++AY KGL TWAKW+D 
Sbjct  198  GGKAWKGMDVLIFNSWHWWTHKGKSQAWDYIRDGSALHKDMNRLLAYYKGLSTWAKWVDT  257

Query  506  NVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-RprvpqqlvvlkqvlrR  345
            NVD  K++VFF+ +SP H     W      C  E +PL         P    ++  +LR+
Sbjct  258  NVDTTKTKVFFQGISPTHYEGREWNQPKRSCNGELQPLSGSKYPVGAPPASAIVNTILRK  317

Query  344  MNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            M  PVYL DI+T+S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN++
Sbjct  318  MMKPVYLLDITTLSQLRKDAHPSTYSGDHSG-----------NDCSHWCLPGLPDSWNQL  366

Query  167  LNA  159
            L A
Sbjct  367  LYA  369



>gb|KDO63324.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=368

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 109/178 (61%), Gaps = 18/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG D+L+F++ HWWTH+     +DYI EG   ++ MN +VA+ KGL TWA+W++ NVDP
Sbjct  199  WRGMDMLIFNTWHWWTHTGRSQPFDYIREGRKLYKDMNRLVAFYKGLTTWARWVNFNVDP  258

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C  + +P   +  P       VVL++V  R+  P
Sbjct  259  TKTKVFFQGISPTHYEGRDWNEPSKSCSGQTKPYFGYKYPAGTPMPWVVLQKVFSRLRKP  318

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+ +S +R+DAHPS YG            G+  DCSHWCLPG+PD WN+++ A
Sbjct  319  VYLLDITRLSQYRKDAHPSEYG------------GHSDDCSHWCLPGLPDTWNQLMYA  364



>ref|XP_002325581.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
 gb|EEE99962.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
Length=371

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 108/183 (59%), Gaps = 16/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
             N   W G D+L+F++ HWWTH+     WDYI EG   ++ MN ++A+ KGL TWA+W++
Sbjct  195  NNGNAWLGMDMLIFNTWHWWTHTGRSQPWDYIQEGGKLYKDMNRLIAFYKGLTTWARWVN  254

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSRprvpqql-vvlkqvlr  348
             NVDP K++VFF+ +SP H     W      C  E +P      P        V+ +VL 
Sbjct  255  HNVDPSKTKVFFQDVSPTHYVGGDWNEPSKSCAAETQPFFGTRYPAGTPLAWAVVNKVLS  314

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            R+  PVYL D++T+S +R+DAHPS YG   G           +DCSHWCLPG+PD WN++
Sbjct  315  RIQKPVYLLDVTTLSQYRKDAHPSHYGGDNG----------GTDCSHWCLPGLPDTWNQL  364

Query  167  LNA  159
            L A
Sbjct  365  LYA  367



>ref|XP_008363351.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 111/187 (59%), Gaps = 5/187 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +      Y  EG+  +  +N   A+   L TWA
Sbjct  356  DLIEXSSDKYKTADVLIFNTGHWWTHEKTSRGKGYYQEGSYIYDVLNVKEAFRXALTTWA  415

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPL-EHFSRprvpqqlvvlkq  357
            +W+D N++P K+ VFFR  SP H R   W    +C +  EPL +  +R +   +L +   
Sbjct  416  RWVDTNINPEKTIVFFRGFSPNHFRGGRWNSGGQCHDLIEPLAKETNRGKYASKLRIFDS  475

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+  M  P++  +I+ M+ FRRDAHPS+Y K    EE++       DCSHWCLPGVPD W
Sbjct  476  VITGMKTPIFYLNITRMTDFRRDAHPSIYRKQNFTEEERKSPLRHQDCSHWCLPGVPDTW  535

Query  176  NEMLNAM  156
            NE+L A 
Sbjct  536  NELLYAQ  542



>ref|XP_008229347.1| PREDICTED: protein trichome birefringence-like [Prunus mume]
Length=763

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 114/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +      Y  EG++ +  +N   A+ K LMTWA
Sbjct  553  DLIERSSDKYKSADVLIFNTGHWWTHEKTSRGKGYYQEGSHIYVELNVKEAFRKALMTWA  612

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNR----ENGWKCFNEREPL-EHFSRprvpqqlvvlkq  357
            +W+D+N++  K+ VFFR  SP H R     +G +C  E EP  +  ++ +   ++ +L  
Sbjct  613  RWVDININLEKTIVFFRGYSPNHFRGGRWNSGGQCHGETEPTAKEANKGKYMSKMRILDS  672

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+  M  P++  +I+ M+ FRRDAHPS+Y K    EE +       DCSHWCLPGVPD W
Sbjct  673  VIIEMKTPIFYLNITKMTDFRRDAHPSIYRKQNFTEEDRKSPLRYQDCSHWCLPGVPDTW  732

Query  176  NEMLNA  159
            NE+L A
Sbjct  733  NELLYA  738



>ref|XP_003551303.1| PREDICTED: protein YLS7-like [Glycine max]
Length=272

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 106/185 (57%), Gaps = 16/185 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  + W+  DV++FDS HWW H+  +  WD I  G   +R M+ +VAYE  L TWAKW+D
Sbjct  93   QAGQTWKDIDVMIFDSWHWWIHTGRKQPWDLIQVGNRTYRDMDRLVAYEIALNTWAKWVD  152

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFS-Rprvpqqlvvlkqvl  351
             N+DP ++RVFF+ +SP H     W       C  +  P+  F          +VL++VL
Sbjct  153  YNIDPTRTRVFFQGVSPGHQNPAQWGEPRPNLCEGKTRPILGFRYPGGPLPAELVLEKVL  212

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M  PVYL DI+T+S  R D HPSVYG         HL     DCSHWCL GVPD WNE
Sbjct  213  RAMQKPVYLLDITTLSQLRIDGHPSVYG------FGGHL---DPDCSHWCLAGVPDTWNE  263

Query  170  MLNAM  156
            +L A+
Sbjct  264  LLYAI  268



>ref|XP_007016071.1| Uncharacterized protein TCM_041593 [Theobroma cacao]
 gb|EOY33690.1| Uncharacterized protein TCM_041593 [Theobroma cacao]
Length=394

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 111/188 (59%), Gaps = 12/188 (6%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I  N   WR +DVL+F++ HWWTH  +   WD I  G  +++ M+ +VA EKGL TWA W
Sbjct  202  IAGNGNAWRMADVLLFNTGHWWTHKGSLQGWDLIESGGKYYKDMDRLVALEKGLRTWANW  261

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGWK----------CFNEREPL-EHFSRprvpqqlv  369
            +D NVD  ++RVFF+S+SP H   + W           C+ E  P+ E       P Q+ 
Sbjct  262  VDTNVDITRTRVFFQSISPTHYDPSEWSAGATVAATKNCYGETTPMTEATYPGTYPDQMR  321

Query  368  vlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGV  189
            V+ +V+R M+ P YL DI+ +S  R+D HPS+Y   +   +K +     +DCSHWCLPG+
Sbjct  322  VVDEVIREMHVPAYLLDITMLSELRKDGHPSIYSGDLSPVQKAN-PDRSADCSHWCLPGL  380

Query  188  PDIWNEML  165
            PD WNE+ 
Sbjct  381  PDTWNELF  388



>emb|CDY30832.1| BnaC05g22080D [Brassica napus]
Length=376

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 106/185 (57%), Gaps = 17/185 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            IE  A  W+  DVLVF+S HWWTH  N   WDYI +G++  R MN + A+ KGL TW +W
Sbjct  199  IEGGANAWKNMDVLVFNSWHWWTHKGNSQGWDYIRDGSSLVRDMNRLDAFYKGLSTWGRW  258

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSR-prvpqqlvvlkqv  354
            +D NVD  K++VFF+ +SP H     W      C  + +PL   +     P    V+ +V
Sbjct  259  VDQNVDTTKTKVFFQGISPTHYEGREWNEPRKSCTGQMQPLGGSNYPSGQPASAGVVSKV  318

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            L  M   V L DI+T+S  R+DAHPS YG   G           +DCSHWCLPG+PD WN
Sbjct  319  LGAMKTRVSLLDITTLSQLRKDAHPSTYGGDGG-----------NDCSHWCLPGLPDTWN  367

Query  173  EMLNA  159
            ++L A
Sbjct  368  QLLYA  372



>ref|XP_004301795.1| PREDICTED: protein trichome birefringence-like 6 [Fragaria vesca 
subsp. vesca]
Length=508

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 114/185 (62%), Gaps = 13/185 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  W+G+D+LVF++AHWW+H + ++  +Y  EG      ++  +A+ K LMTWA
Sbjct  330  DAIDHGSSRWKGADILVFNTAHWWSHYKTKAGINYYQEGGQVHPKLDVSIAFRKALMTWA  389

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D  ++PR++RVFFRS +P H R   W     C    +PLE  S     +++V+ ++V
Sbjct  390  SWVDRYINPRRTRVFFRSSAPSHFRGGQWNSGGSCKEATKPLETLS-ASPSEKIVIAEEV  448

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  P+   +I+ +S +R D HPS+YG+      +        DCSHWCLPG+PD+WN
Sbjct  449  IKKMRTPITFLNITGLSEYRVDGHPSIYGRKSASGSQ--------DCSHWCLPGIPDVWN  500

Query  173  EMLNA  159
            E+L A
Sbjct  501  ELLYA  505



>gb|AGV54877.1| hypothetical protein [Phaseolus vulgaris]
Length=318

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 109/179 (61%), Gaps = 18/179 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W G D+L+F+S HWWTH+ N   WDYI +G++  + M+ + A+ KG+ TW +W+D N+DP
Sbjct  147  WIGLDMLIFNSWHWWTHTGNSQGWDYIRDGSSLLKDMDRLEAFNKGMSTWGEWVDENIDP  206

Query  494  RKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H +   W      C  E EPL   +    +P    ++  VL++M   
Sbjct  207  TKTKVFFQGISPTHYQGQEWNEPRKSCSGELEPLRGSTYPAGLPPAANIVNTVLKKMKNK  266

Query  332  VYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+ +S  R+DAHPS Y G   G           +DCSHWCLPG+PD WN++LNA
Sbjct  267  VYLLDITLLSQLRKDAHPSAYSGDHAG-----------NDCSHWCLPGLPDTWNQLLNA  314



>ref|XP_006301170.1| hypothetical protein CARUB_v10021567mg [Capsella rubella]
 gb|EOA34068.1| hypothetical protein CARUB_v10021567mg [Capsella rubella]
Length=358

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 105/175 (60%), Gaps = 14/175 (8%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            W GSDV++F++ HWW+H+    +WDY   G    + MN M A++  L TWAKWID N+DP
Sbjct  186  WLGSDVVIFNTFHWWSHTGRAKTWDYFQTGDQIVKEMNRMEAFKIALTTWAKWIDHNIDP  245

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqqlvvlkqvlrRMNFPV  330
             K++VF++ +SP H     W      C  E EP++  S P       ++++V+  M  PV
Sbjct  246  SKTKVFYQGVSPVHLNGGEWGKPGKTCLGETEPVKGPSNPGPNIGETIVRKVIGAMAKPV  305

Query  329  YLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
             L D++ M+  R+DAHPS+Y    G   + +      DCSHWCLPGVPD+WN++L
Sbjct  306  NLLDVTAMTELRKDAHPSIY---AGGGSRLN------DCSHWCLPGVPDVWNQLL  351



>ref|XP_007207333.1| hypothetical protein PRUPE_ppa006874mg [Prunus persica]
 gb|EMJ08532.1| hypothetical protein PRUPE_ppa006874mg [Prunus persica]
Length=392

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 111/192 (58%), Gaps = 17/192 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I EN++ WR +DVL F++ HWW+H+     WDY+  G  ++R M+ + A EKG+ TWA W
Sbjct  197  ISENSKAWRNADVLSFNTGHWWSHNGGLQGWDYMESGGKYYRDMDRLAALEKGMRTWANW  256

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLE----HFSRprvpq  378
            +D N+D  ++RVFF S+SP H   N W           C+ E  P+      +     P 
Sbjct  257  VDSNIDTTRTRVFFLSISPTHYNPNEWNGGATPATTKNCYGETAPMTISGVTYPGTTYPD  316

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWC  201
            Q+ V+  V+R M+ P  L DI+ +S  R+D HPS+Y G +  QE     R   +DCSHWC
Sbjct  317  QMRVVDNVIRGMSNPASLLDITMLSELRKDGHPSIYSGDLSPQERANPER--SADCSHWC  374

Query  200  LPGVPDIWNEML  165
            LPG+PD WN++ 
Sbjct  375  LPGLPDTWNQLF  386



>ref|XP_010052537.1| PREDICTED: protein trichome birefringence-like 39 [Eucalyptus 
grandis]
 gb|KCW89616.1| hypothetical protein EUGRSUZ_A01900 [Eucalyptus grandis]
 gb|KCW89617.1| hypothetical protein EUGRSUZ_A01900 [Eucalyptus grandis]
Length=365

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG DVLVF+S HWWTH+     WDY+ EG   ++ MN +VAY KG+ TWA+W++ NVDP
Sbjct  193  WRGMDVLVFNSWHWWTHTGRTQPWDYMQEGNKLYKDMNRLVAYYKGMTTWARWVNRNVDP  252

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             +++VFF+ +SP H     W      C  + +P   +  P        V+ +VL R+  P
Sbjct  253  SRTKVFFQGISPTHYEGKDWNAPSQSCSGQTQPYFGYRYPGGLPLSWAVVNKVLSRVKKP  312

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+T+S +R+D HP+ Y          H  G   DCSHWCLPG+PD WNE+L A
Sbjct  313  VYLLDITTLSEYRKDGHPTYY-------SGDH--GGIMDCSHWCLPGLPDTWNELLYA  361



>ref|XP_006444502.1| hypothetical protein CICLE_v100200871mg, partial [Citrus clementina]
 gb|ESR57742.1| hypothetical protein CICLE_v100200871mg, partial [Citrus clementina]
Length=402

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 112/183 (61%), Gaps = 10/183 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+L+F++AHWW+H + ++  +Y  EG      ++   A+++ LMTWA
Sbjct  217  DSIDHGSSRWRGADILIFNTAHWWSHYKTKAGINYYQEGDQVLPRLDVFTAFKRALMTWA  276

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D  ++PRK+++FFR+ +P H R   W     C    +PL   S    P++ V+++ V
Sbjct  277  SWVDKRINPRKTQIFFRNSAPSHFRGGQWNAGGHCAEATQPLNEISGFSYPEKNVIIEDV  336

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV L +I+++S +R D HPS YG+       +       DCSHWCLPGVPD WN
Sbjct  337  IKQMRTPVTLLNITSLSEYRIDGHPSTYGR------NKRYSSNIQDCSHWCLPGVPDTWN  390

Query  173  EML  165
            E+L
Sbjct  391  ELL  393



>ref|XP_009787170.1| PREDICTED: protein trichome birefringence-like 39 [Nicotiana 
sylvestris]
Length=367

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 108/176 (61%), Gaps = 17/176 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG DVL+F+S HWWTH+++   WDY+ EG   F+ MN +VAY KG+ TWA+W+D NVDP
Sbjct  197  WRGMDVLIFNSWHWWTHTKSSQPWDYMQEGNKQFKDMNRLVAYYKGMYTWARWVDRNVDP  256

Query  494  RKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSR-prvpqqlvvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C  E +P          P  ++V+ +VL R+  P
Sbjct  257  TKTKVFFQGVSPTHYEGKDWNEPTKSCKGETQPFFGIRYPAGTPTPVIVMNKVLSRIKKP  316

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEML  165
            VYL DI+T+S +R+D HP+ Y       +   L     DCSHWCLPG+PD WN +L
Sbjct  317  VYLLDITTLSQYRKDGHPTFY------SDHNTL-----DCSHWCLPGLPDTWNLLL  361



>ref|XP_006492340.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|KDO86991.1| hypothetical protein CISIN_1g009237mg [Citrus sinensis]
Length=539

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 113/183 (62%), Gaps = 10/183 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+L+F++AHWW+H + ++  +Y  EG      ++   A+++ LMTWA
Sbjct  354  DSIDHGSSRWRGADILIFNTAHWWSHYKTKAGINYYQEGDQVLPRLDVSTAFKRALMTWA  413

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D  ++PRK+++FFR+ +P H R   W     C    +PL   S    P++ V+++ V
Sbjct  414  SWVDKRINPRKTQIFFRNSAPSHFRGGQWNAGGHCAEATQPLNEISGFSYPEKNVIIEDV  473

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV L +I+++S +R D HPS+YG+       +       DCSHWCLPGVPD WN
Sbjct  474  IKQMRTPVTLLNITSLSEYRIDGHPSIYGR------NKRYSSNIQDCSHWCLPGVPDTWN  527

Query  173  EML  165
            E+L
Sbjct  528  ELL  530



>emb|CBI15933.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 115/188 (61%), Gaps = 13/188 (7%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYI-MEGTNFFRYMNPMVAYEKGLMTWAK  519
            I  N   W G DVL F++ HWW+H  +   WDYI M+GT  ++ M+ +VA+EKGL TWA+
Sbjct  111  ISGNGNAWTGVDVLSFNTGHWWSHKGSLQGWDYIEMDGT-LYQDMDRLVAFEKGLRTWAR  169

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGWK---------CFNEREPLEHFS-Rprvpqqlv  369
            W+D NVD  ++RVFF+S SP H   + W          C+ E  P+   +     P Q+ 
Sbjct  170  WVDTNVDRTRTRVFFQSTSPTHYNPSEWSAGAVTTTKNCYGETAPMSGMTYPGAYPDQMR  229

Query  368  vlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGV  189
            V+++V+ +M+ PVYL DI+ +S  R+D HPS+Y   +   ++ +     +DCSHWCLPG+
Sbjct  230  VVEEVMSQMSGPVYLLDITLLSEMRKDGHPSIYSGDLSPAQRAN-PDRSADCSHWCLPGL  288

Query  188  PDIWNEML  165
            PD WN++ 
Sbjct  289  PDTWNQLF  296



>ref|XP_008352661.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 111/187 (59%), Gaps = 5/187 (3%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +      Y  EG+  +  +N   A+   L TWA
Sbjct  356  DLIEXSSDKYKTADVLIFNTGHWWTHEKTSRGKGYYQEGSYIYDVLNVKEAFRXALTTWA  415

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNR----ENGWKCFNEREPL-EHFSRprvpqqlvvlkq  357
            +W+D N++P K+ VFFR  SP H R     +G +C +  EPL +  +R +   +L +   
Sbjct  416  RWVDTNINPEKTIVFFRGFSPNHFRGGRWNSGGQCHDLIEPLAKETNRGKYASKLRIXDS  475

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            V+  M  P++  +I+ M+ FRRDAHPS+Y K    EE+        DCSHWCLPGVPD W
Sbjct  476  VITGMKTPIFYLNITRMTDFRRDAHPSIYRKQNFTEEEXKSPLRHQDCSHWCLPGVPDTW  535

Query  176  NEMLNAM  156
            NE+L A 
Sbjct  536  NELLYAQ  542



>ref|XP_010679388.1| PREDICTED: protein trichome birefringence-like 6 [Beta vulgaris 
subsp. vulgaris]
Length=537

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 111/183 (61%), Gaps = 10/183 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+ ++R WRG+D+L+F++ +WWTH + ++  +Y  +G   + +++ + AY K L TWA
Sbjct  346  DSIDRDSRKWRGADILIFNTGNWWTHFKTKAGINYYQDGNQVYPHLDALTAYRKALSTWA  405

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D  VD RK+ VFFRS +P H R   W     C   R PL        P++ V+ ++V
Sbjct  406  TWVDKFVDARKTHVFFRSTAPAHFRGGQWNTGGHCREARRPLNEM-YINDPEKDVIAQEV  464

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +  M  PV   +I+ +S++R D HPS YGK+ G++          DCSHWCLPGVPD WN
Sbjct  465  ISSMKTPVTFMNITGLSSYRIDGHPSKYGKIPGKKGSP-----VEDCSHWCLPGVPDAWN  519

Query  173  EML  165
            EM+
Sbjct  520  EMI  522



>ref|XP_004487169.1| PREDICTED: uncharacterized protein LOC101503983 [Cicer arietinum]
Length=363

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 108/178 (61%), Gaps = 17/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG DVLVF++ HWWTH+ N   WDYI EG   ++ MN  +A+ KGL TWA+W+++NV+P
Sbjct  191  WRGMDVLVFNTWHWWTHTGNAQPWDYIEEGNKLYKDMNRFIAFYKGLTTWARWVNINVNP  250

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             +++VFF  +SP H     W      C +E +P      P       VV+ +VL R+  P
Sbjct  251  TQTKVFFLGISPVHYEGRDWNQPAKSCMSETQPFFGLKYPGGTPMAWVVVNKVLSRLKKP  310

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            V+  D++T+S +R+DAHP  Y  V+            +DCSHWCLPG+PD WN +L+A
Sbjct  311  VFFLDVTTLSQYRKDAHPEGYSGVMS-----------TDCSHWCLPGLPDTWNVLLHA  357



>ref|XP_006469036.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|KDO63325.1| hypothetical protein CISIN_1g017063mg [Citrus sinensis]
Length=378

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 109/178 (61%), Gaps = 18/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG D+L+F++ HWWTH+     +DYI EG   ++ MN +VA+ KGL TWA+W++ NVDP
Sbjct  209  WRGMDMLIFNTWHWWTHTGRSQPFDYIREGRKLYKDMNRLVAFYKGLTTWARWVNFNVDP  268

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C  + +P   +  P       VVL++V  R+  P
Sbjct  269  TKTKVFFQGISPTHYEGRDWNEPSKSCSGQTKPYFGYKYPAGTPMPWVVLQKVFSRLRKP  328

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+ +S +R+DAHPS YG            G+  DCSHWCLPG+PD WN+++ A
Sbjct  329  VYLLDITRLSQYRKDAHPSEYG------------GHSDDCSHWCLPGLPDTWNQLMYA  374



>ref|XP_010921490.1| PREDICTED: protein trichome birefringence-like 6 [Elaeis guineensis]
Length=580

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 115/183 (63%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+ ++  WRG+D+LVF++AHWW+H + ++  +Y  EG     +++   A+ K LMTWA
Sbjct  385  DTIDRSSSKWRGADILVFNTAHWWSHHKTKAGVNYYQEGDQVLPHLDVSTAFRKTLMTWA  444

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +V P K+RVFFR+ +P H     W     C    +PL   S  ++ ++ ++L+QV
Sbjct  445  SWVDQHVAPGKTRVFFRTSAPSHFSGGEWNSGGHCRESTQPLNDTSGRQISEKNMILEQV  504

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M  PV + +I+ +S  R D HPS+YG+   + E     G + DCSHWCLPGVPD WN
Sbjct  505  VKQMKTPVTILNITNLSGLRIDGHPSIYGR---KPESGSPTGIQ-DCSHWCLPGVPDTWN  560

Query  173  EML  165
            E+L
Sbjct  561  ELL  563



>ref|XP_006344054.1| PREDICTED: uncharacterized protein LOC102598924 [Solanum tuberosum]
Length=399

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 115/191 (60%), Gaps = 13/191 (7%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I +N+  WRG DVL F++ HWWTH      WDY+  G   ++ M+ +VA E+GL TWA
Sbjct  204  DDITKNSNAWRGVDVLSFNTGHWWTHKGALQGWDYVELGGKLYQDMDRLVALERGLRTWA  263

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW-----------KCFNEREPLEHFSR-prvpq  378
            +WID N+D  ++++FF+ +SP H   + W            C+ E  P+   +     P 
Sbjct  264  RWIDANIDKSRTKLFFQGISPTHYNPSDWTTGTSTASSARTCYGETVPMTGTAYPGTFPD  323

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCL  198
            Q+ VL +V+R MN P ++ DI+ +SA R+DAHPS+Y   +  E+K +   + +DCSHWCL
Sbjct  324  QMGVLNEVIRDMNNPPFILDITFLSAMRKDAHPSIYSGALTSEQKAN-PDHSADCSHWCL  382

Query  197  PGVPDIWNEML  165
             G+PD WN++ 
Sbjct  383  AGLPDTWNQLF  393



>ref|XP_008342760.1| PREDICTED: protein trichome birefringence-like 43 [Malus domestica]
 ref|XP_008362403.1| PREDICTED: protein trichome birefringence-like 43 [Malus domestica]
Length=239

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 114/186 (61%), Gaps = 20/186 (11%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E+ + W  SDVL+F+S HWW H+  +  WD I EG+  ++ M+ +VAYEK LMTWA+W+ 
Sbjct  48   ESGKLWMNSDVLIFNSWHWWLHTGRKQPWDLIQEGSRTYKDMDRLVAYEKALMTWARWVA  107

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW------KCFNEREPL---EHFSRprvpqqlvvlkq  357
             N +  K+RVFF+ +SP HN  + W      +C  + +P+   E+ +        VV+++
Sbjct  108  TNSESTKTRVFFQGVSPDHNNGSEWGEATSNQCEGQTQPMAGNEYLA--GSHPAEVVVER  165

Query  356  vlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIW  177
            VLR ++ PV+L +++T+S  R+D HPSVYG         H      DCSHWCL GVPD W
Sbjct  166  VLRSISNPVHLLNVTTLSQLRKDGHPSVYG---------HGGHRDMDCSHWCLAGVPDTW  216

Query  176  NEMLNA  159
            N++L A
Sbjct  217  NQLLYA  222



>ref|XP_010038289.1| PREDICTED: protein trichome birefringence-like 6 [Eucalyptus 
grandis]
 gb|KCW50113.1| hypothetical protein EUGRSUZ_K03547 [Eucalyptus grandis]
Length=536

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 110/183 (60%), Gaps = 8/183 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D ++     WRG+DVLVF++AHWW+H + ++  +Y  EG      ++   A+ K LMTWA
Sbjct  345  DTMDRGTSRWRGADVLVFNTAHWWSHYKTKAGINYYQEGRQVLPQLDVSTAFRKALMTWA  404

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D +++P K++VFFRS +P H R   W     C     PL   S     ++  +L+ V
Sbjct  405  SWVDRHINPAKTQVFFRSSAPSHFRGGQWNSGGHCQEATRPLNTSSINWYSEKNAILEDV  464

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +R M  PV L +IS +SA+R D HPS+YG  + +    +++    DCSHWCLPGVPD WN
Sbjct  465  MRHMKTPVTLLNISGLSAYRIDGHPSIYGGRMRKGRSSNIQ----DCSHWCLPGVPDTWN  520

Query  173  EML  165
            E+L
Sbjct  521  ELL  523



>ref|XP_003552076.2| PREDICTED: protein YLS7-like [Glycine max]
Length=372

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 106/184 (58%), Gaps = 16/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  + W+G DV++FDS HWW H+  +  WD I  G   +R M+ +VAYE  L TWAKW+D
Sbjct  193  QAGQMWKGIDVMIFDSWHWWIHTGRKQPWDLIQVGNRTYRDMDRLVAYEIALNTWAKWVD  252

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK------CFNEREPLEHFSR-prvpqqlvvlkqvl  351
             N+DP ++RVFF+ +SP H     W       C  +  P+  F          +VL++VL
Sbjct  253  YNIDPTRTRVFFQGVSPDHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELVLEKVL  312

Query  350  rRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNE  171
            R M  PVYL DI+T+S  R D HPSVYG         HL     DCSHWCL GVPD WNE
Sbjct  313  RAMQKPVYLLDITTLSQLRIDGHPSVYGF------GGHL---DPDCSHWCLAGVPDTWNE  363

Query  170  MLNA  159
            +L A
Sbjct  364  LLYA  367



>ref|XP_006446762.1| hypothetical protein CICLE_v10015634mg [Citrus clementina]
 gb|ESR60002.1| hypothetical protein CICLE_v10015634mg [Citrus clementina]
Length=375

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 109/178 (61%), Gaps = 18/178 (10%)
 Frame = -2

Query  674  WRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWIDLNVDP  495
            WRG D+L+F++ HWWTH+     +DYI EG   ++ MN +VA+ KGL TWA+W++ NVDP
Sbjct  206  WRGMDMLIFNTWHWWTHTGRSQPFDYIREGRKLYKDMNRLVAFYKGLTTWARWVNFNVDP  265

Query  494  RKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFSRprvpqql-vvlkqvlrRMNFP  333
             K++VFF+ +SP H     W      C  + +P   +  P       VVL++V  R+  P
Sbjct  266  TKTKVFFQGISPTHYEGRDWNEPSKSCSGQTKPYFGYKYPAGTPMPWVVLQKVFSRLRKP  325

Query  332  VYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEMLNA  159
            VYL DI+ +S +R+DAHPS YG            G+  DCSHWCLPG+PD WN+++ A
Sbjct  326  VYLLDITRLSQYRKDAHPSEYG------------GHSDDCSHWCLPGLPDTWNQLMYA  371



>ref|XP_009395765.1| PREDICTED: protein trichome birefringence-like 42 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 115/187 (61%), Gaps = 7/187 (4%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D + E+A  W G+DV+VF++ HWWTH     +W+Y          M    A+ + L TWA
Sbjct  327  DKLPESANRWLGADVMVFNTGHWWTHRGKMRAWNYFERREQLTEAMEANEAFNRALRTWA  386

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWKCFNEREPLEH--FSRprvpqqlvvlkqvlr  348
            +W+D +VDP K+ VFFRS+SP+H REN   C+NE  P+ H  + +      + ++++ +R
Sbjct  387  RWVDGSVDPAKTTVFFRSVSPEHKRENLHWCYNETHPITHQRYVQLFPRSMVELVERTIR  446

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVY----GKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
            +M  PV   +I+ +S +RRDAH +VY    GK++   ++Q    Y +DCSHWCLPG+PD 
Sbjct  447  KMRTPVTYLNITRLSEYRRDAHTAVYTSKQGKLLTAGQRQEPARY-ADCSHWCLPGLPDT  505

Query  179  WNEMLNA  159
            WN +L A
Sbjct  506  WNVLLFA  512



>ref|XP_008385046.1| PREDICTED: protein PMR5-like, partial [Malus domestica]
Length=212

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 110/192 (57%), Gaps = 17/192 (9%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            I EN++ WR +DVL F++ HWW+H      WDY+  G  +++ M+ + A EKG+ TWA W
Sbjct  17   ISENSKVWRNADVLSFNTGHWWSHKGGLQGWDYMESGGYYYQDMDRLAALEKGMKTWANW  76

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW----------KCFNEREPLE----HFSRprvpq  378
            ID N+D  ++RVFF S+SP H   N W           C+ E  P++     +     P 
Sbjct  77   IDSNIDTTRTRVFFLSISPTHYDPNEWNGGATPTTTKNCYGETAPMKVSGVTYPGITYPD  136

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVY-GKVVGQEEKQHLRGYKSDCSHWC  201
            Q+ V+  V+R M  P  L DI+ +S  R+D HPS+Y G +  Q+     R   +DCSHWC
Sbjct  137  QMRVMDSVIRGMRNPPSLLDITMLSELRKDGHPSIYSGDLSPQQRANPDR--SADCSHWC  194

Query  200  LPGVPDIWNEML  165
            LPG+PD WN++ 
Sbjct  195  LPGLPDTWNQLF  206



>ref|XP_003607565.1| hypothetical protein MTR_4g079700 [Medicago truncatula]
 gb|AES89762.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=365

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 112/183 (61%), Gaps = 17/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++   WRG DVL+F++ HWWTH+ +   WDYI E    ++ MN  VA+ KGL TWA+W++
Sbjct  190  KSGEAWRGMDVLIFNTWHWWTHTGSSQPWDYIQENKKLYKDMNRFVAFYKGLQTWARWVE  249

Query  509  LNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPLEHFSRprvpqql-vvlkqvlr  348
            +NV+P +++VFF  +SP H +   W      C +E+ P      P       +V+ +VLR
Sbjct  250  MNVNPAQTKVFFLGISPVHYQGRDWNQPTKSCMSEKVPYFGLKYPGGTPMAWMVVNKVLR  309

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            +M+ PVY  D++T+S +R+DAHP  Y  V+            +DCSHWCLPG+PD WN++
Sbjct  310  KMSKPVYFLDVTTLSQYRKDAHPEGYSGVMA-----------TDCSHWCLPGLPDTWNQL  358

Query  167  LNA  159
            L A
Sbjct  359  LYA  361



>ref|XP_007207689.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
 gb|EMJ08888.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
Length=541

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 113/190 (59%), Gaps = 9/190 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            DLIE ++  ++ +DVL+F++ HWWTH +  S   Y  EG++ +  +N   A+EK L TWA
Sbjct  332  DLIERSSDNYKNADVLIFNTGHWWTHEKTSSGKGYYQEGSHVYGELNVDDAFEKALTTWA  391

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGWK----CFNEREPLEHFSRprvp----qqlvv  366
            +W+D NV+P K+ VFFR  SP H R   W     C  E +P                + +
Sbjct  392  RWVDTNVNPNKTAVFFRGYSPSHFRGGEWNSGGHCHGETKPTTKMESTEYGGEYPSNMKI  451

Query  365  lkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVP  186
            L  V+++M  P++  +I+TM+ FR+DAHPS+Y K    EE++     + DCSHWCLPGVP
Sbjct  452  LDSVVKKMKTPIFYLNITTMTDFRKDAHPSIYRKPNLTEEERKPPMIQ-DCSHWCLPGVP  510

Query  185  DIWNEMLNAM  156
            D WNE++ A 
Sbjct  511  DTWNELIYAQ  520



>ref|XP_008443074.1| PREDICTED: protein trichome birefringence-like 37 [Cucumis melo]
Length=442

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 16/183 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            +  + W G DVLVF+S HWWTH  +  +WD I +G   ++ M+ +VA+ KGL TW +W+D
Sbjct  265  QAGKAWLGMDVLVFNSWHWWTHKGDSQAWDLIQDGATRYQDMDRLVAFYKGLTTWGRWVD  324

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLE-HFSRprvpqqlvvlkqvlr  348
            LNVDP K++VFF+ +SP H     W      C  E EPL         P  + V+ +VL 
Sbjct  325  LNVDPTKTKVFFQGISPTHYLGKEWNQPKKNCNGESEPLAGSMYPGGAPPAVDVVNRVLS  384

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
            R+  PVYL DI+T+S  R+DAHP+ Y    G+          +DCSHWCLPG+PD WN++
Sbjct  385  RIKVPVYLLDITTLSQLRKDAHPAGYS---GEHS-------GTDCSHWCLPGLPDTWNQL  434

Query  167  LNA  159
            + A
Sbjct  435  MYA  437



>ref|XP_006348847.1| PREDICTED: uncharacterized protein LOC102593679 [Solanum tuberosum]
Length=362

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 111/185 (60%), Gaps = 21/185 (11%)
 Frame = -2

Query  698  LIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAK  519
            +I  NA  WRG DVL+F+S HWWTH+++   WDY+ EG   F+ MN +VAY KG+ TWAK
Sbjct  186  IISGNA--WRGMDVLIFNSWHWWTHTKSSQPWDYMQEGNKVFKDMNRLVAYYKGMYTWAK  243

Query  518  WIDLNVDPRKSRVFFRSMSPKHNRENGWK-----CFNEREPL--EHFSRprvpqqlvvlk  360
            W+D NVD  K++VFF+ +SP H     W      C NE++P     +        +VV K
Sbjct  244  WVDRNVDSSKTKVFFQGISPTHYEGKDWNDPTKSCKNEKQPFFGIRYPAGTTQASIVVNK  303

Query  359  qvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDI  180
             + R   F V+L DI+T+S +R+DAHP+ Y       +   L     DCSHWCLPG+PD 
Sbjct  304  VLSRIKKF-VHLLDITTLSQYRKDAHPTSY------SDHNTL-----DCSHWCLPGLPDT  351

Query  179  WNEML  165
            WN +L
Sbjct  352  WNLLL  356



>ref|XP_002862622.1| hypothetical protein ARALYDRAFT_333274 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38880.1| hypothetical protein ARALYDRAFT_333274 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 107/184 (58%), Gaps = 19/184 (10%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
             +   W+ +DVLVF+S HWW H+  +  WD IM G    + M+ +VAYEK +MTWAKWID
Sbjct  186  SSGSLWKTADVLVFNSWHWWLHTGRKQPWDAIMSGNVTVKDMDRLVAYEKAMMTWAKWID  245

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-------KCFNEREPLEHFSR-prvpqqlvvlkqv  354
             N+DP K++VFF+ +SP H R + W        C  E +P+          +  +V+ +V
Sbjct  246  QNIDPSKTKVFFQGVSPDHGRASEWSKQGGKGSCIGETKPIMGSKYWAGPHRAEMVVAKV  305

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYK-SDCSHWCLPGVPDIW  177
            ++ M  P  L D++ MS  R+D HPSVYG            G+K  DCSHWCL GVPD W
Sbjct  306  IKTMKNPARLMDVTLMSQLRKDGHPSVYG----------FGGHKMPDCSHWCLSGVPDSW  355

Query  176  NEML  165
            N++L
Sbjct  356  NQLL  359



>ref|XP_008342494.1| PREDICTED: protein trichome birefringence-like 43 [Malus domestica]
Length=373

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 109/181 (60%), Gaps = 15/181 (8%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            ++ + W+  DVL+F++ HWW H++ +  WD+I +G    R MN +VAYEK L TWA W+D
Sbjct  195  KDGKSWKEYDVLIFNTWHWWLHARRKQPWDFIQDGKTLHRDMNRLVAYEKALKTWAXWVD  254

Query  509  LNVDPRKSRVFFRSMSPKH------NRENGWKCFNEREPLEHFSRprvpqqlvvlkqvlr  348
             NVD +K++VFF+S+SP H         +G  C  EREPL            V++++VL 
Sbjct  255  KNVDTKKTKVFFQSISPSHWNASHWGYPDGRNCTAEREPLVVAYPRSKDPAEVIVEKVLG  314

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWNEM  168
             M+  V L +++ +S  R+D HPS+YG         HL     DCSHWCLPGVPD WN++
Sbjct  315  DMSKQVLLLNVTGLSQLRKDGHPSIYG------NGAHL---GMDCSHWCLPGVPDTWNQL  365

Query  167  L  165
            L
Sbjct  366  L  366



>ref|XP_010273483.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=365

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 109/184 (59%), Gaps = 17/184 (9%)
 Frame = -2

Query  689  ENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKWID  510
            E    W+G+D+L+F++ HWW H+ ++  WDYI  G N ++ M+ +VA+EKGL TWA W+D
Sbjct  188  EGGNAWKGTDMLIFNTWHWWIHTGSKQPWDYIELGGNVYKDMDRLVAFEKGLTTWANWVD  247

Query  509  LNVDPRKSRVFFRSMSPKHNRENGW-----KCFNEREPLEHFS-Rprvpqqlvvlkqvlr  348
             N+DP  ++VFF+ +SP H     W      C  + +P+   +     P    V+K VL 
Sbjct  248  SNIDPASTKVFFQGISPTHYDGREWNQPKMSCNAQTQPVSGSTYPGGSPAPAAVVKNVLG  307

Query  347  RMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKS-DCSHWCLPGVPDIWNE  171
            +M+ PV L DI+T+S  R+D HPS YG            G K  DCSHWCL GVPD WNE
Sbjct  308  KMSKPVNLLDITTLSQLRKDGHPSAYGP----------GGAKGMDCSHWCLAGVPDTWNE  357

Query  170  MLNA  159
            +L A
Sbjct  358  LLYA  361



>ref|XP_003551258.1| PREDICTED: protein YLS7-like [Glycine max]
Length=388

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 112/191 (59%), Gaps = 15/191 (8%)
 Frame = -2

Query  695  IEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWAKW  516
            ++ N   WR +DVL F++ HWW H  +   WDY+  G  +++ M+ + A E+G+ TWA W
Sbjct  193  VDGNGDAWRSADVLSFNTGHWWDHQGSLQGWDYMELGGKYYQDMDRLAALERGIKTWANW  252

Query  515  IDLNVDPRKSRVFFRSMSPKHNRENGW-----------KCFNEREPLEHFSRp---rvpq  378
            +D N+D  +++VFF  +SP H   N W            C+ E  P+           P+
Sbjct  253  VDSNIDSSRTKVFFLGISPSHTNPNEWNSGVTAGLTTKNCYGETSPIISTGTAYPGVYPE  312

Query  377  qlvvlkqvlrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCL  198
            Q+ V+  V+R M+ P YL DI+ +SAFR+DAHPS+Y   +  +++ +   Y +DCSHWCL
Sbjct  313  QMRVVDMVIREMSNPAYLLDITMLSAFRKDAHPSIYSGDLNPQQRAN-PTYSADCSHWCL  371

Query  197  PGVPDIWNEML  165
            PG+PD WNE+ 
Sbjct  372  PGLPDTWNELF  382



>ref|XP_007201163.1| hypothetical protein PRUPE_ppa004056mg [Prunus persica]
 gb|EMJ02362.1| hypothetical protein PRUPE_ppa004056mg [Prunus persica]
Length=532

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 114/185 (62%), Gaps = 9/185 (5%)
 Frame = -2

Query  701  DLIEENARYWRGSDVLVFDSAHWWTHSQNRSSWDYIMEGTNFFRYMNPMVAYEKGLMTWA  522
            D I+  +  WRG+D+LVF++AHWW+H + ++  +Y  EG      ++   A+ K LMTWA
Sbjct  350  DSIDHGSSRWRGADILVFNTAHWWSHYKTKAGINYYQEGGQIHPQLDVSTAFRKALMTWA  409

Query  521  KWIDLNVDPRKSRVFFRSMSPKHNRENGW----KCFNEREPLEHFSRprvpqqlvvlkqv  354
             W+D  ++PRK++VFFRS +P H R   W     C    +PL+  S     ++ V+ ++V
Sbjct  410  SWVDKRINPRKTQVFFRSSAPSHFRGGQWNSGGSCKEATQPLQT-SSFSYSEKNVIAEEV  468

Query  353  lrRMNFPVYLQDISTMSAFRRDAHPSVYGKVVGQEEKQHLRGYKSDCSHWCLPGVPDIWN  174
            +++M   V   +I+ +S +R D HPS+YG+  G+     ++    DCSHWCLPG+PD+WN
Sbjct  469  IKQMKTRVTFLNITGLSEYRIDGHPSIYGRKSGKHSSSGIQ----DCSHWCLPGIPDLWN  524

Query  173  EMLNA  159
            E+L A
Sbjct  525  ELLYA  529



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335