BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050C21

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774502.1|  PREDICTED: uncharacterized protein LOC104224520    301   2e-98   Nicotiana sylvestris
ref|XP_009628191.1|  PREDICTED: uncharacterized protein LOC104118618    297   4e-97   
ref|XP_004233274.1|  PREDICTED: uncharacterized protein LOC101267674    291   2e-94   Solanum lycopersicum
emb|CDP01735.1|  unnamed protein product                                290   5e-94   Coffea canephora [robusta coffee]
gb|EPS70810.1|  hypothetical protein M569_03949                         273   1e-87   Genlisea aurea
ref|XP_011098004.1|  PREDICTED: uncharacterized protein LOC105176792    270   1e-86   
ref|XP_010646591.1|  PREDICTED: uncharacterized protein LOC104878242    265   1e-84   Vitis vinifera
ref|XP_009358576.1|  PREDICTED: uncharacterized protein LOC103949197    258   6e-82   Pyrus x bretschneideri [bai li]
ref|XP_008337205.1|  PREDICTED: uncharacterized protein LOC103400335    257   1e-81   
ref|XP_007203754.1|  hypothetical protein PRUPE_ppa014878mg             257   1e-81   Prunus persica
gb|KGN65221.1|  hypothetical protein Csa_1G266180                       256   7e-81   Cucumis sativus [cucumbers]
ref|XP_008444040.1|  PREDICTED: uncharacterized protein LOC103487492    254   4e-80   Cucumis melo [Oriental melon]
gb|EYU25683.1|  hypothetical protein MIMGU_mgv1a024294mg                248   6e-78   Erythranthe guttata [common monkey flower]
ref|XP_010270634.1|  PREDICTED: uncharacterized protein LOC104606904    241   4e-75   
ref|XP_011018215.1|  PREDICTED: uncharacterized protein LOC105121321    239   2e-74   Populus euphratica
gb|KDP38630.1|  hypothetical protein JCGZ_03983                         239   3e-74   Jatropha curcas
ref|XP_002324567.1|  hypothetical protein POPTR_0018s12090g             237   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011470332.1|  PREDICTED: uncharacterized protein LOC105353184    234   1e-72   Fragaria vesca subsp. vesca
ref|XP_007012013.1|  Uncharacterized protein TCM_037120                 234   2e-72   
gb|KJB65721.1|  hypothetical protein B456_010G110900                    233   3e-72   Gossypium raimondii
ref|XP_008243099.1|  PREDICTED: uncharacterized protein LOC103341364    233   4e-72   
gb|KEH41583.1|  uroporphyrinogen III synthase                           230   4e-71   Medicago truncatula
ref|XP_007138434.1|  hypothetical protein PHAVU_009G208600g             227   7e-70   Phaseolus vulgaris [French bean]
ref|XP_002523533.1|  conserved hypothetical protein                     226   2e-69   Ricinus communis
ref|XP_010047159.1|  PREDICTED: uncharacterized protein LOC104436130    225   7e-69   
ref|XP_009420479.1|  PREDICTED: uncharacterized protein LOC104000215    223   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799155.1|  PREDICTED: uncharacterized protein LOC103713881    220   5e-67   Phoenix dactylifera
ref|XP_010932696.1|  PREDICTED: uncharacterized protein LOC105053288    219   1e-66   
ref|XP_010558898.1|  PREDICTED: uncharacterized protein LOC104827422    210   3e-63   Tarenaya hassleriana [spider flower]
ref|XP_006849857.1|  hypothetical protein AMTR_s00022p00059330          205   5e-61   Amborella trichopoda
ref|XP_010681252.1|  PREDICTED: uncharacterized protein LOC104896233    203   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002462593.1|  hypothetical protein SORBIDRAFT_02g028710          195   3e-57   Sorghum bicolor [broomcorn]
ref|NP_001145235.1|  hypothetical protein                               191   5e-56   Zea mays [maize]
gb|EEC84811.1|  hypothetical protein OsI_31881                          187   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_004957231.1|  PREDICTED: uncharacterized protein LOC101779932    187   3e-54   Setaria italica
gb|KCW78980.1|  hypothetical protein EUGRSUZ_C00407                     156   3e-42   Eucalyptus grandis [rose gum]
ref|XP_006381898.1|  hypothetical protein POPTR_0006s20320g             147   2e-40   
ref|XP_002961862.1|  hypothetical protein SELMODRAFT_403240             141   4e-37   
ref|XP_002980789.1|  hypothetical protein SELMODRAFT_420371             137   1e-35   
gb|KHN20426.1|  hypothetical protein glysoja_045575                     109   2e-26   Glycine soja [wild soybean]
ref|XP_006386962.1|  hypothetical protein POPTR_2609s00200g             100   6e-23   
ref|XP_010106882.1|  hypothetical protein L484_012337                 98.6    1e-21   Morus notabilis
gb|ABA22684.1|  uroporphyrinogen-III synthase                         97.4    2e-20   Trichormus variabilis ATCC 29413
ref|WP_041456851.1|  hypothetical protein                             97.4    2e-20   
ref|XP_010106881.1|  hypothetical protein L484_012336                 92.8    4e-20   
ref|WP_010476360.1|  uroporphyrinogen III synthase                    94.7    1e-19   Acaryochloris sp. CCMEE 5410
ref|WP_012161951.1|  uroporphyrinogen III synthase                    93.2    4e-19   Acaryochloris marina
ref|XP_002959865.1|  hypothetical protein VOLCADRAFT_108778           92.0    4e-19   Volvox carteri f. nagariensis
ref|WP_015136484.1|  uroporphyrinogen-III synthase                    92.0    9e-19   Nostoc sp. PCC 7524
dbj|BAB77811.1|  uroporphyrinogen-III synthase                        92.0    1e-18   Nostoc sp. PCC 7120
ref|WP_044520556.1|  uroporphyrinogen III synthase                    92.0    1e-18   
ref|XP_005644693.1|  tetrapyrrole biosynthesis, uroporphyrinogen ...  89.4    6e-18   Coccomyxa subellipsoidea C-169
ref|WP_006562361.1|  uroporphyrinogen III synthase                    88.2    2e-17   
ref|WP_035121530.1|  uroporphyrinogen III synthase                    87.0    5e-17   Fischerella sp. PCC 9431
gb|ACC80313.1|  Uroporphyrinogen III synthase HEM4                    87.4    5e-17   Nostoc punctiforme PCC 73102
ref|WP_041566001.1|  uroporphyrinogen III synthase                    87.0    6e-17   
ref|WP_035138509.1|  uroporphyrinogen III synthase                    86.7    7e-17   Fischerella muscicola
ref|WP_033336743.1|  uroporphyrinogen III synthase                    86.7    9e-17   
ref|WP_016871394.1|  uroporphyrinogen III synthase                    84.7    4e-16   Fischerella thermalis
ref|WP_016861285.1|  uroporphyrinogen III synthase                    83.6    8e-16   Fischerella muscicola
ref|WP_009459493.1|  uroporphyrinogen III synthase                    83.6    9e-16   Fischerella thermalis
gb|KIZ07248.1|  hypothetical protein MNEG_0702                        82.4    2e-15   Monoraphidium neglectum
ref|WP_008273972.1|  uroporphyrinogen III synthase                    82.8    2e-15   Cyanothece sp. CCY0110
ref|WP_044492160.1|  uroporphyrinogen III synthase                    81.6    3e-15   
gb|EGJ34942.1|  uroporphyrinogen-III synthase                         81.6    3e-15   Moorea producens 3L
ref|WP_019488651.1|  hypothetical protein                             80.9    7e-15   Calothrix sp. PCC 7103
gb|KIE11515.1|  uroporphyrinogen III synthase                         80.5    8e-15   Tolypothrix bouteillei VB521301
ref|WP_041639822.1|  uroporphyrinogen III synthase                    79.3    3e-14   
gb|ADI64133.1|  Uroporphyrinogen III synthase HEM4                    79.0    3e-14   'Nostoc azollae' 0708
ref|WP_033364936.1|  uroporphyrinogen III synthase                    77.0    1e-13   
ref|WP_036862652.1|  uroporphyrinogen-III synthase                    70.9    2e-11   Prevotella melaninogenica
ref|WP_004349974.1|  hypothetical protein                             70.9    2e-11   Prevotella buccalis
ref|WP_036872440.1|  uroporphyrinogen-III synthase                    70.1    4e-11   Prevotella buccalis
dbj|GAK35804.1|  uroporphyrinogen-III synthase                        68.9    8e-11   Bacteroides graminisolvens DSM 19988 = JCM 15093
ref|WP_034781563.1|  hypothetical protein                             68.9    8e-11   
ref|WP_023058085.1|  MULTISPECIES: uroporphyrinogen-III synthase      68.9    8e-11   Prevotella
ref|WP_013325371.1|  uroporphyrinogen III synthase                    68.2    2e-10   Cyanothece sp. PCC 7822
ref|WP_036929938.1|  uroporphyrinogen-III synthase                    64.7    4e-09   Prevotella timonensis
ref|WP_025072433.1|  uroporphyrinogen-III synthase                    63.9    5e-09   Prevotella timonensis
ref|WP_035139400.1|  uroporphyrinogen III synthase                    63.5    1e-08   
ref|WP_008122707.1|  uroporphyrinogen-III synthase                    63.2    1e-08   Prevotella timonensis
ref|XP_003871736.1|  hypothetical protein LMXM_03_0680                63.2    2e-08   Leishmania mexicana MHOM/GT/2001/U1103
ref|WP_013548302.1|  hypothetical protein                             62.0    3e-08   Bacteroides helcogenes
gb|EGJ71981.1|  Uroporphyrinogen III synthase HEM4                    62.0    4e-08   Bacteroides coprosuis DSM 18011
ref|WP_040310401.1|  hypothetical protein                             61.2    5e-08   
ref|XP_003721744.1|  hypothetical protein LMJF_03_0680                61.2    7e-08   Leishmania major strain Friedlin
ref|XP_010701006.1|  uroporphyrinogen III synthase-like protein       60.8    9e-08   Leishmania panamensis
ref|XP_001561648.1|  hypothetical protein LBRM_03_0580                59.7    2e-07   Leishmania braziliensis MHOM/BR/75/M2904
ref|WP_016872683.1|  hypothetical protein                             59.7    3e-07   Chlorogloeopsis fritschii
ref|XP_010935672.1|  PREDICTED: uncharacterized protein LOC105055540  58.5    3e-07   
gb|EEC76546.1|  hypothetical protein OsI_14342                        55.8    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_001462798.1|  hypothetical protein LINJ_03_0660                58.5    6e-07   Leishmania infantum JPCM5
ref|WP_038315764.1|  hypothetical protein                             58.2    9e-07   
ref|WP_041041230.1|  uroporphyrinogen III synthase                    55.5    7e-06   
gb|KIJ84751.1|  uroporphyrinogen III synthase                         54.3    2e-05   Scytonema tolypothrichoides VB-61278
ref|WP_036892598.1|  uroporphyrinogen-III synthase                    53.9    2e-05   
ref|WP_028898365.1|  hypothetical protein                             53.5    3e-05   
ref|WP_027845592.1|  uroporphyrinogen III synthase                    52.4    7e-05   
ref|WP_035300941.1|  uroporphyrinogen-III synthase                    52.4    7e-05   
ref|WP_029097511.1|  uroporphyrinogen-III synthase                    51.6    2e-04   
ref|WP_031410705.1|  HemD protein                                     51.2    3e-04   Brevibacillus laterosporus
ref|WP_003338854.1|  uroporphyrin-III C-methyltransferase             51.2    3e-04   Brevibacillus laterosporus
ref|WP_018672773.1|  porphyrin biosynthesis protein HemD              51.2    3e-04   Brevibacillus laterosporus
ref|WP_003334882.1|  uroporphyrinogen-III C-methyltransferase         51.2    3e-04   Brevibacillus laterosporus
ref|WP_025746037.1|  HemD protein                                     50.8    4e-04   bacterium JKG1



>ref|XP_009774502.1| PREDICTED: uncharacterized protein LOC104224520 [Nicotiana sylvestris]
Length=310

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GEIL I+ALGKD ELLD  FI ++CENPERIR++ P IATP+GLV+ALG G+GRK VLCP
Sbjct  112  GEILTIAALGKDAELLDQDFIGKMCENPERIRILVPPIATPSGLVDALGLGQGRK-VLCP  170

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP VIGL+EPPVVP FL DLAKKGW+PVR++AYETRW G  CA EVV RS EECG DA+V
Sbjct  171  VPLVIGLDEPPVVPKFLEDLAKKGWIPVRLDAYETRWAGAKCAVEVVTRSEEECGFDAIV  230

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEGLLKSL+E+GLDWE VRR CP +VVAAHGPVTA+GAE LGVGIDVVSS F S
Sbjct  231  FTSTGEVEGLLKSLKEFGLDWEMVRRRCPRMVVAAHGPVTAAGAESLGVGIDVVSSNFGS  290

Query  131  FDGVVHALAHQWECLDS  81
            FDG+V AL+H+W+ L++
Sbjct  291  FDGIVDALSHKWKSLEN  307



>ref|XP_009628191.1| PREDICTED: uncharacterized protein LOC104118618 [Nicotiana tomentosiformis]
Length=310

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GEIL I+ALGKD ELLD  +I ++CENPERIR++ P IATP+GLV+ALG G+GRK VLCP
Sbjct  112  GEILTIAALGKDSELLDQDYIGKMCENPERIRILVPPIATPSGLVDALGLGQGRK-VLCP  170

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP VIGL+EPPVVP FL DLAK+GW+PVR++AYETRW G  CA EVV RS EECG DA+V
Sbjct  171  VPLVIGLDEPPVVPKFLEDLAKRGWIPVRLDAYETRWAGAKCAVEVVTRSEEECGFDAIV  230

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEGLLKSL+E+GLDWE VRR CP +VVAAHGPVTA+GAE LGVGIDVVSS F S
Sbjct  231  FTSTGEVEGLLKSLKEFGLDWEMVRRRCPRMVVAAHGPVTAAGAESLGVGIDVVSSNFGS  290

Query  131  FDGVVHALAHQWECLDS  81
            FDG+V AL+H+W+ L++
Sbjct  291  FDGIVDALSHKWKSLEN  307



>ref|XP_004233274.1| PREDICTED: uncharacterized protein LOC101267674 [Solanum lycopersicum]
Length=312

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GEIL I+ALG D ELLD  FI ++CENPERIRV+ P +ATP+GLVEALG G+GRK VLCP
Sbjct  114  GEILTIAALGNDAELLDRDFIRKMCENPERIRVLVPSVATPSGLVEALGLGQGRK-VLCP  172

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP VIGL EPPVVP FL DL+K+GW+P+R++AYETRW G  CA +VV +S EECG DA+V
Sbjct  173  VPLVIGLNEPPVVPKFLDDLSKRGWIPLRLDAYETRWAGATCAVDVVAKSEEECGFDAIV  232

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEGLLKSL E+GLDW  VRR CP +VVAAHGPVTA+GAE LGVGIDVVSS F S
Sbjct  233  FTSTGEVEGLLKSLEEFGLDWSMVRRRCPRMVVAAHGPVTAAGAESLGVGIDVVSSNFGS  292

Query  131  FDGVVHALAHQWECLDS  81
            FDGVV ALAH+W+ L +
Sbjct  293  FDGVVDALAHKWKSLQN  309



>emb|CDP01735.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GE   ISALGKD ELLD+SFI+++CENP RI+V+ P I+TPT L E+LG G+GRK VLCP
Sbjct  120  GETFTISALGKDSELLDESFINKLCENPRRIKVLVPPISTPTSLAESLGLGQGRK-VLCP  178

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VPSV+GLEEPPVVP FL  LA+ GW  VRVN YETRW GP CA EV  R+ EECG+D +V
Sbjct  179  VPSVLGLEEPPVVPNFLAHLARMGWTAVRVNGYETRWAGPTCAEEVAGRTDEECGLDGLV  238

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKSL+E GL+WE +R  CP ++VAAHGPVTASGAERLGVGIDVVSSRFDS
Sbjct  239  FTSTAEVEGLLKSLKELGLNWEMMRMRCPSMLVAAHGPVTASGAERLGVGIDVVSSRFDS  298

Query  131  FDGVVHALAHQWECLD  84
            FDGVV ALA++W+ LD
Sbjct  299  FDGVVDALAYRWKSLD  314



>gb|EPS70810.1| hypothetical protein M569_03949 [Genlisea aurea]
Length=299

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 156/194 (80%), Gaps = 1/194 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GEI  ISALGKD ELLDDSFI  +CEN  RIRV+ P +ATP+ L EALG GEGR+KVLCP
Sbjct  104  GEIFTISALGKDAELLDDSFIKSLCENAARIRVLVPAVATPSALAEALGSGEGRRKVLCP  163

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEV-VRRSGEECGIDAM  315
            VP VIGLEEPPVVP FL DL ++GW+PVRV+AYETR         V    +G EC +DA+
Sbjct  164  VPVVIGLEEPPVVPKFLTDLHRRGWIPVRVDAYETRRSHNGTGKLVEAMAAGAECKVDAI  223

Query  314  VFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFD  135
            VF+ST EVEGLLKSL+E GLDWET+RR CPG+V AA GPVTA+GAE+LGVGIDVVSSRFD
Sbjct  224  VFTSTAEVEGLLKSLQEIGLDWETIRRTCPGMVAAAQGPVTAAGAEQLGVGIDVVSSRFD  283

Query  134  SFDGVVHALAHQWE  93
            SFDGVV AL ++W+
Sbjct  284  SFDGVVDALEYKWQ  297



>ref|XP_011098004.1| PREDICTED: uncharacterized protein LOC105176792 [Sesamum indicum]
Length=301

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GE  V++ALGKD ELL +SFI ++C+NP RIRVV P +ATP+GLVE+LG G GRK VLCP
Sbjct  108  GETFVVAALGKDSELLGESFIPKLCKNPGRIRVVVPPVATPSGLVESLGMGRGRK-VLCP  166

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
             P VIGLEEPPVVP FL DL +KGWVPVRVNAYETRW   +  AE+V    EECG+DA+V
Sbjct  167  APLVIGLEEPPVVPKFLADLGRKGWVPVRVNAYETRWR--SGVAELVEMMEEECGVDAIV  224

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKSL E GLDWE VRRMCP +V AAHGPVTA+GAE+LGVGIDVVSSRFDS
Sbjct  225  FTSTAEVEGLLKSLGEVGLDWEMVRRMCPRMVAAAHGPVTAAGAEKLGVGIDVVSSRFDS  284

Query  131  FDGVVHALAHQWECLD  84
            F+GVV AL ++W+  +
Sbjct  285  FEGVVDALEYRWKSYE  300



>ref|XP_010646591.1| PREDICTED: uncharacterized protein LOC104878242 [Vitis vinifera]
Length=308

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 1/192 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GE   +SALGKD ELL++ F+S++C+  +RIRV  P +ATPTGLVE+LG G GR+ VLCP
Sbjct  114  GENFTVSALGKDAELLNEDFLSKLCKKTQRIRVTVPPVATPTGLVESLGVGRGRR-VLCP  172

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V GL EPPVVP FLRDLA + WVPV+V+AYETRW GP CA  VVRRS  E G+DA+V
Sbjct  173  VPLVAGLVEPPVVPNFLRDLALRDWVPVKVHAYETRWAGPRCAERVVRRSEGEEGLDAIV  232

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEGLLKSLRE GLDW  ++   PGLVVAAHGPVTASGAERLG+ +DVVSSRF S
Sbjct  233  FTSTGEVEGLLKSLRELGLDWRLLKERYPGLVVAAHGPVTASGAERLGIRVDVVSSRFHS  292

Query  131  FDGVVHALAHQW  96
            FDGVV ALA +W
Sbjct  293  FDGVVDALALRW  304



>ref|XP_009358576.1| PREDICTED: uncharacterized protein LOC103949197 [Pyrus x bretschneideri]
Length=289

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G++  ++ALGKD EL+DDSF+ ++C NP+R+R++ P  ATP  LV++LGDG GR+ VLCP
Sbjct  96   GDVFTVAALGKDSELIDDSFVQKLCPNPDRLRILVPLTATPNALVQSLGDGRGRR-VLCP  154

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GL EPPVVP FLRDL  K WVPVRVNAYETRW GP CA +VV +  E+  +DA+V
Sbjct  155  VPLVVGLVEPPVVPHFLRDLEAKHWVPVRVNAYETRWAGPGCAEKVVEKI-EDGALDAIV  213

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKS +E+GLDWET +R CP ++VAAHGP+TA+GA+ LGVG+D+VSS+F S
Sbjct  214  FTSTAEVEGLLKSFKEFGLDWETAKRTCPKMLVAAHGPITAAGAQMLGVGVDLVSSQFGS  273

Query  131  FDGVVHAL  108
            F GVV AL
Sbjct  274  FQGVVDAL  281



>ref|XP_008337205.1| PREDICTED: uncharacterized protein LOC103400335 [Malus domestica]
Length=289

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G++  ++ALGKD EL+DDSF+ R+C NP+RIR++ P  ATP  LV++L DG GR+ VLCP
Sbjct  96   GDVFTVAALGKDSELIDDSFVHRLCPNPDRIRILVPLTATPNALVQSLEDGRGRR-VLCP  154

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GL EPPVVP FLRDL  K WVPVRVNAYETRW GP CA EVV +  +E  +DA+V
Sbjct  155  VPLVVGLVEPPVVPHFLRDLEAKHWVPVRVNAYETRWAGPGCAEEVVEKIEDE-ALDAIV  213

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKS +E+GLDWET +R CP ++VAAHGP+TA+GA+ LGVG+D+VSS+F S
Sbjct  214  FTSTAEVEGLLKSFKEFGLDWETAKRRCPXMLVAAHGPITAAGAQMLGVGVDLVSSQFGS  273

Query  131  FDGVVHAL  108
            F GVV AL
Sbjct  274  FQGVVDAL  281



>ref|XP_007203754.1| hypothetical protein PRUPE_ppa014878mg [Prunus persica]
 gb|EMJ04953.1| hypothetical protein PRUPE_ppa014878mg [Prunus persica]
Length=287

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G+  +I+ALGKD EL+DD+F+ ++C N  R+R++ P  ATP+GLVEALGDG  R+ VLCP
Sbjct  94   GDAFIIAALGKDAELMDDNFVHKLCSNTNRVRILVPPTATPSGLVEALGDGRNRR-VLCP  152

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GL EPPVVP FLRDL  K WVPVRVNAYETRW GP CA +VV R  EE  +DAMV
Sbjct  153  VPVVVGLVEPPVVPDFLRDLEAKRWVPVRVNAYETRWAGPGCAKQVVERI-EEGALDAMV  211

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKS +E+GLDWE  ++ CP ++VAAHGP+TA+GA  LGV +D+VSS+FDS
Sbjct  212  FTSTAEVEGLLKSFKEFGLDWEIAKKRCPKMLVAAHGPITAAGAHMLGVRVDLVSSQFDS  271

Query  131  FDGVVHAL  108
            F GVV AL
Sbjct  272  FQGVVDAL  279



>gb|KGN65221.1| hypothetical protein Csa_1G266180 [Cucumis sativus]
Length=307

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G+  +I+ALGKD ELLD  F++ IC N  RIRVV P IATPTGLVEALG G  R  VLCP
Sbjct  114  GDTFLIAALGKDSELLDHEFLTTICHNTSRIRVVVPEIATPTGLVEALGVGNHRS-VLCP  172

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GL EPPVVP FLRDL  KGWVPVRV+AYETRW GP CA ++V R G++  +DA+V
Sbjct  173  VPRVVGLNEPPVVPNFLRDLEAKGWVPVRVDAYETRWAGPDCARKLVER-GKDEKLDAIV  231

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEGLLKSL   GL+W+ ++R  P +VVAAHGPVTA+GAERLGV +D+VSS+FDS
Sbjct  232  FTSTGEVEGLLKSLAHLGLEWDVMKRRWPEMVVAAHGPVTAAGAERLGVKVDLVSSKFDS  291

Query  131  FDGVVHALAHQWECLD  84
            F+GVV AL  +W+ L+
Sbjct  292  FNGVVDALHWRWQNLE  307



>ref|XP_008444040.1| PREDICTED: uncharacterized protein LOC103487492 [Cucumis melo]
Length=307

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G+  +I+ALGKD ELLD  F++ IC N  RIRVV P IATPTGLVEALG G  R+ VLCP
Sbjct  114  GDTFLIAALGKDSELLDHEFLTTICPNTSRIRVVVPEIATPTGLVEALGVGNHRR-VLCP  172

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GL EPPVVP FLRDL  KGWVPVRV+AYETRW GP CA ++V R G++  +DA+V
Sbjct  173  VPRVVGLNEPPVVPNFLRDLEAKGWVPVRVDAYETRWAGPDCARKLVER-GKDEKLDAIV  231

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEGLLKSL   GL+W+ +++  P +VVAAHGPVTA+GAERLGV +D+VS +FDS
Sbjct  232  FTSTGEVEGLLKSLEHLGLEWDMMKKRWPEMVVAAHGPVTAAGAERLGVKVDLVSPKFDS  291

Query  131  FDGVVHALAHQWECLD  84
            F+GVV +L  +W+ LD
Sbjct  292  FNGVVDSLHWRWQSLD  307



>gb|EYU25683.1| hypothetical protein MIMGU_mgv1a024294mg, partial [Erythranthe 
guttata]
Length=299

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G++  +SALGKD ELL +SF++++C NP R+RV+ P IATP+GLVEALG G GRK VLCP
Sbjct  99   GDLFTLSALGKDSELLTESFVAKLCVNPARVRVLVPPIATPSGLVEALGLGLGRK-VLCP  157

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP VIGL+EPPVVP FL  LA++GWVPVRVNAYETRW G   A  V     E CG+DA+V
Sbjct  158  VPLVIGLKEPPVVPEFLAGLARRGWVPVRVNAYETRWRGGGVAGLVAGMMEEHCGVDAIV  217

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKSL E GLDW  VRRMCP LV AAHGPVTA GAE+LGV IDVVSS+F S
Sbjct  218  FTSTAEVEGLLKSLEELGLDWGMVRRMCPRLVAAAHGPVTAVGAEQLGVEIDVVSSKFHS  277

Query  131  FDGVVHALAHQWECL  87
            F GVV AL   W+  
Sbjct  278  FYGVVDALDCWWKSF  292



>ref|XP_010270634.1| PREDICTED: uncharacterized protein LOC104606904 [Nelumbo nucifera]
Length=315

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 4/195 (2%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G++  I+ALGKD ELL ++FI+++CE+P RIRV+ P +ATP+ LVE+LG G GR+ VLCP
Sbjct  118  GDLFTIAALGKDAELLTEAFIAKLCESPGRIRVLIPPVATPSSLVESLGPGAGRR-VLCP  176

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V G+EEPPV+P FLRDL    WVPVRV AYETRW GP C+  +VR    + G+DA+V
Sbjct  177  VPLVTGIEEPPVIPNFLRDLRSNDWVPVRVAAYETRWAGPRCSEGLVR---SKEGLDAIV  233

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+STGEVEG+LKSLRE G +W  VR   PGL+V AHGPVTA+GAERLGV +DVV   FDS
Sbjct  234  FTSTGEVEGMLKSLREMGFEWGMVRERWPGLIVVAHGPVTAAGAERLGVAVDVVGFSFDS  293

Query  131  FDGVVHALAHQWECL  87
            F+G+V AL  +W  L
Sbjct  294  FEGIVDALVMKWGAL  308



>ref|XP_011018215.1| PREDICTED: uncharacterized protein LOC105121321 [Populus euphratica]
Length=304

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  668  EILVISALGKDLELLDDSFISRIC-ENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            +  +I+ LGKD EL+D +F+   C ++  R+ V+ P IATP+GLV+ LG G GRK VLCP
Sbjct  107  DTFIIATLGKDAELIDSTFLLNFCGDDISRVNVLVPTIATPSGLVQLLGTGRGRK-VLCP  165

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GLEEPPVVP FLR+L   GWVP+RV+AYETRW GP C   VV  S E   +DAMV
Sbjct  166  VPRVVGLEEPPVVPDFLRELEAAGWVPIRVDAYETRWLGPTCGKGVVELS-EGGLLDAMV  224

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+S+GEVEGLLKSLRE+G DWE VRR  P LVVAAHGPVTA+GAERLGV +DVVS RFDS
Sbjct  225  FTSSGEVEGLLKSLREFGWDWEMVRRRWPQLVVAAHGPVTAAGAERLGVTVDVVSGRFDS  284

Query  131  FDGVVHALAHQWECLDS  81
            F GVV A+  +   LDS
Sbjct  285  FQGVVDAVEAKLRGLDS  301



>gb|KDP38630.1| hypothetical protein JCGZ_03983 [Jatropha curcas]
Length=306

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 145/192 (76%), Gaps = 5/192 (3%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G+  ++ ALGKD EL+D  F+   C N +RIRV+ P  ATPTGLV+ LG G GR+ VLC 
Sbjct  104  GDSFIVGALGKDAELIDTEFLLNFCSNIDRIRVLVPPTATPTGLVQLLGAGGGRR-VLCL  162

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSG----EECGI  324
            VP V+GLEEPPVVP FLR+L    W PVRV+AY+TRW GP+CA E+V RS     E  G+
Sbjct  163  VPEVVGLEEPPVVPNFLRELQASSWSPVRVDAYQTRWLGPSCAEEIVNRSEAKTEEGNGL  222

Query  323  DAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSS  144
            DA+VF+S+ EVEGLLKSL E G DWETVRR  P LVVAAHGPVTA+GAERLGV +DVVS 
Sbjct  223  DAVVFTSSAEVEGLLKSLNELGWDWETVRRRWPDLVVAAHGPVTAAGAERLGVDVDVVSG  282

Query  143  RFDSFDGVVHAL  108
            RF SFDGVV AL
Sbjct  283  RFGSFDGVVDAL  294



>ref|XP_002324567.1| hypothetical protein POPTR_0018s12090g [Populus trichocarpa]
 gb|EEF03132.1| hypothetical protein POPTR_0018s12090g [Populus trichocarpa]
Length=302

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  668  EILVISALGKDLELLDDSFISRIC-ENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            +  +I+ALGKD+EL+D +F+   C ++   + V+ P IATP+GLV+ LG G GRK VLCP
Sbjct  105  DTFIIAALGKDVELIDSTFLLTFCGDDISWVNVLVPTIATPSGLVQLLGTGRGRK-VLCP  163

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GLEEPPVVP FLR+L   GWVP+RV+AYETRW GPAC   VV  S E   +DAMV
Sbjct  164  VPRVVGLEEPPVVPDFLRELEGAGWVPIRVDAYETRWLGPACGKGVVELS-EGGLLDAMV  222

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+S+GEVEGLLKSLRE+G DWE VRR  P LVVAAHGPVTA+GAERLGV +DVVS RFDS
Sbjct  223  FTSSGEVEGLLKSLREFGWDWEMVRRRWPHLVVAAHGPVTAAGAERLGVTVDVVSGRFDS  282

Query  131  FDGVVHALAHQWECLDS  81
            F GVV A+  +   LDS
Sbjct  283  FQGVVDAVEAKLRGLDS  299



>ref|XP_011470332.1| PREDICTED: uncharacterized protein LOC105353184 [Fragaria vesca 
subsp. vesca]
Length=284

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G +  ++ALG+D EL+DD+F+S++  +P R+R++ P  ATP+ +V +LGDG GR+ +LCP
Sbjct  94   GAVFTVAALGRDAELMDDAFVSKL--SPHRVRILVPETATPSAMVHSLGDGGGRR-ILCP  150

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP+V+GL EPPVVP FLR+L + GW PVRVNAYETRW G  CAA+VV R  +   +DA+V
Sbjct  151  VPAVLGLTEPPVVPDFLRELGESGWAPVRVNAYETRWAGSECAAQVVERI-KAGNLDAIV  209

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLLKS ++ GL WE+V+R+CP L+VAAHGPVTA+GA  LGV +DVVSS+F S
Sbjct  210  FTSTAEVEGLLKSFKKIGLRWESVKRLCPKLLVAAHGPVTAAGARMLGVEVDVVSSQFGS  269

Query  131  FDGVVHAL  108
            F GVV +L
Sbjct  270  FQGVVDSL  277



>ref|XP_007012013.1| Uncharacterized protein TCM_037120 [Theobroma cacao]
 gb|EOY29632.1| Uncharacterized protein TCM_037120 [Theobroma cacao]
Length=301

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G   +++ALGKD EL++  FIS+IC N +RI+V+ P  ATP  L  +LG G GR+ VLCP
Sbjct  100  GPTFILAALGKDSELINTPFISQICSNLQRIKVLVPPTATPNSLALSLGKGYGRR-VLCP  158

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGE-ECGIDAM  315
            VP V+GL EPPVVP FL+DL   GWVP+RV+AYETRW GP+CA EVVR+  E E  ++A+
Sbjct  159  VPKVVGLNEPPVVPDFLKDLESGGWVPIRVDAYETRWVGPSCAEEVVRKGEEHEEEVNAV  218

Query  314  VFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFD  135
            VF+S+GEVEG LKSLRE+G DW  VRR    LVVAAHGPVTA GA+RLGV +DVVSS FD
Sbjct  219  VFTSSGEVEGFLKSLREFGWDWGMVRRRWSRLVVAAHGPVTAVGAKRLGVDVDVVSSNFD  278

Query  134  SFDGVVHAL  108
            SF GVV AL
Sbjct  279  SFQGVVDAL  287



>gb|KJB65721.1| hypothetical protein B456_010G110900 [Gossypium raimondii]
Length=298

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G    ++ALGKD EL+D  FIS+IC N +R++++ P  ATP  L  +LG+G GRK VLCP
Sbjct  100  GHTFTLAALGKDSELIDTPFISQICSNSQRVKLLVPPTATPNSLALSLGEGYGRK-VLCP  158

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECG--IDA  318
            VP V+GL EPPVVP FL DL   GW PVR++AYETRW GP CA  VV++  E+ G    A
Sbjct  159  VPKVVGLNEPPVVPNFLDDLKSGGWFPVRIDAYETRWLGPDCAMAVVKKGEEKGGEVYAA  218

Query  317  MVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRF  138
            +VF+S+GEVEG LK L+E+G DW TVRR  PGLVVAAHGPVTA+GAERLGV +DVVSS F
Sbjct  219  IVFTSSGEVEGFLKGLKEFGWDWGTVRRRWPGLVVAAHGPVTAAGAERLGVDVDVVSSDF  278

Query  137  DSFDGVVHAL  108
             SF GVV AL
Sbjct  279  GSFQGVVDAL  288



>ref|XP_008243099.1| PREDICTED: uncharacterized protein LOC103341364 [Prunus mume]
Length=286

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 134/169 (79%), Gaps = 2/169 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G+  +I+ALGKD EL+DD+F+ ++C NP R+R++ P  ATP+GLV ALGDG  R+ VLCP
Sbjct  94   GDAFIIAALGKDAELMDDNFVHKLCSNPNRVRILVPPTATPSGLVAALGDGRNRR-VLCP  152

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GL EPPVVP FLRDL  K WVPVRVNAYETRW GP CA  VV R  EE  +DAMV
Sbjct  153  VPVVVGLVEPPVVPDFLRDLEAKRWVPVRVNAYETRWAGPRCAKHVVERI-EEGALDAMV  211

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGV  165
            F+ST EVEGLLKS +E+GLDWE  ++ CP ++VAAHGP+TA+GA RLGV
Sbjct  212  FTSTTEVEGLLKSFKEFGLDWEIAKKRCPKMLVAAHGPITAAGAHRLGV  260



>gb|KEH41583.1| uroporphyrinogen III synthase [Medicago truncatula]
Length=294

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G    ++ALGKD ELL   F+SRIC   +R++V+ P +ATP+ L   LGDG GR+ V+CP
Sbjct  99   GPTFTVAALGKDSELLHKEFLSRICAGSDRVKVLVPPVATPSSLASELGDGGGRR-VMCP  157

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+GLEEPPVVP+FL++L   GWVPVRV AYETRW GP CA  +V+   EE G+DA+V
Sbjct  158  VPLVVGLEEPPVVPSFLQELRDGGWVPVRVEAYETRWSGPRCAEGIVKAVEEE-GLDAVV  216

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+S+ EVEGLLKSL  +G+ +  +RR CPGLVVAAHGPVTA+GAERLGV +DVVSS+F S
Sbjct  217  FTSSAEVEGLLKSLDGFGMGFGDLRRKCPGLVVAAHGPVTAAGAERLGVEVDVVSSKFHS  276

Query  131  FDGVVHAL  108
            FDG++  L
Sbjct  277  FDGIIDVL  284



>ref|XP_007138434.1| hypothetical protein PHAVU_009G208600g [Phaseolus vulgaris]
 gb|ESW10428.1| hypothetical protein PHAVU_009G208600g [Phaseolus vulgaris]
Length=280

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 141/188 (75%), Gaps = 2/188 (1%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G    ++ALGKD +L+D  F+S  C N  R+ V+ P  ATP+ L  ALGDG GR  VLCP
Sbjct  88   GSTFTLAALGKDADLIDAQFLSAFCSNSNRLCVLVPPTATPSALAAALGDGCGRG-VLCP  146

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP VIG+ EPPVVP FL +L +  WVPVRV AYETRW GP CA  +VR S EE G+DA+V
Sbjct  147  VPRVIGVNEPPVVPGFLEELRRGRWVPVRVEAYETRWAGPGCAEGIVRAS-EEGGLDAVV  205

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EVEGLL+SL+++GL +  +RR CP LVVAAHGPVTA+GA+RLGV +DVVSSRF S
Sbjct  206  FTSTAEVEGLLQSLKDFGLGFADLRRRCPRLVVAAHGPVTAAGAQRLGVEVDVVSSRFGS  265

Query  131  FDGVVHAL  108
            FDGV+  L
Sbjct  266  FDGVIDVL  273



>ref|XP_002523533.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38872.1| conserved hypothetical protein [Ricinus communis]
Length=295

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = -3

Query  668  EILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPV  489
            + ++I ALGKD EL+D +F+  IC +  RIR + P+ ATP+GLV++LG G GR+ VLC V
Sbjct  102  DAMIIGALGKDAELIDSAFLLNICSSINRIRALVPQTATPSGLVQSLGAGGGRR-VLCLV  160

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVF  309
            P ++GL+EPPVVP FLR+L   GWVP+RV+AYETRW GP CA  +V+    E G+D +VF
Sbjct  161  PKIVGLKEPPVVPDFLRELEAAGWVPIRVDAYETRWLGPTCAEGIVK----EEGLDGVVF  216

Query  308  SSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSF  129
            +S+ EVEGLLKSL EY  DW+ V++  P LVVAAHGPVTA+GAERLGV +DVVS RF SF
Sbjct  217  TSSAEVEGLLKSLSEYRWDWKMVKQRWPELVVAAHGPVTAAGAERLGVDVDVVSDRFSSF  276

Query  128  DGVVHALAHQWECLDS  81
            +GVV AL  + + L S
Sbjct  277  EGVVDALYSRLQGLSS  292



>ref|XP_010047159.1| PREDICTED: uncharacterized protein LOC104436130 [Eucalyptus grandis]
Length=305

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 147/191 (77%), Gaps = 3/191 (2%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            G   V++ALG+D ELLD   +SRIC +P RI  + P++A+P GL ++LG G+GR+ +LCP
Sbjct  105  GGAFVVAALGRDSELLDADLLSRICADPRRIETLVPQVASPRGLADSLGRGDGRR-ILCP  163

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEEC-GIDAM  315
            VP V+G+EEPPVVP F+ DL   GW  VRV AYETRW G  CA  +VRR G+   G+DA+
Sbjct  164  VPRVVGIEEPPVVPEFIGDLEANGWAAVRVAAYETRWLGEDCAGAIVRRGGDGGEGLDAI  223

Query  314  VFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRF  138
            VF+S+GEVEGLL+SLRE +G +WE VRR  P LVVAAHGPVTA+GAERLGVG+DVV  +F
Sbjct  224  VFTSSGEVEGLLRSLREGFGWEWEDVRRRWPELVVAAHGPVTAAGAERLGVGVDVVGHKF  283

Query  137  DSFDGVVHALA  105
            +SF GVV AL+
Sbjct  284  ESFGGVVEALS  294



>ref|XP_009420479.1| PREDICTED: uncharacterized protein LOC104000215 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 141/192 (73%), Gaps = 5/192 (3%)
 Frame = -3

Query  671  GEILVISALGKDLELL-DDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLC  495
            GE+  I+ALGKD ELL D+ F+S+IC NP RIRV+ P IA+P GLVE+LG G GR+ +LC
Sbjct  107  GELFTIAALGKDAELLHDEGFLSKICRNPNRIRVLVPEIASPAGLVESLGAGSGRR-ILC  165

Query  494  PVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAM  315
            PVPSV+ LEEPPVVP FLRDL  +GW P RV AYETRW GP C   +V     +  +DAM
Sbjct  166  PVPSVVDLEEPPVVPDFLRDLWARGWAPERVPAYETRWTGPRCMEGLV---ALDTVLDAM  222

Query  314  VFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFD  135
            VF+S+ EVEGL+K L+  G DW  VRR  P ++V AHGPVTA G ER GV +DVV+S+F 
Sbjct  223  VFTSSAEVEGLIKGLQALGWDWGKVRRRWPKMLVCAHGPVTAKGVERFGVRVDVVNSKFS  282

Query  134  SFDGVVHALAHQ  99
            SFDG++ AL  +
Sbjct  283  SFDGLIEALTSK  294



>ref|XP_008799155.1| PREDICTED: uncharacterized protein LOC103713881 [Phoenix dactylifera]
Length=305

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 140/194 (72%), Gaps = 5/194 (3%)
 Frame = -3

Query  668  EILVISALGKDLELLDDS-FISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            E   ++ALGKD ELL +  F+SR+C N  RI+V+ P IA+P GLV ALGDG GR+ VLCP
Sbjct  111  EPFTVAALGKDAELLHEGGFLSRLCRNTSRIKVLVPEIASPAGLVAALGDGLGRR-VLCP  169

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP+V+ LEEPPV+P F+ DL   GW+PVRV AYETRW GP CA  +++  G    +DAMV
Sbjct  170  VPTVVDLEEPPVIPNFVVDLEAAGWIPVRVPAYETRWAGPGCAEGLMKLKGP---LDAMV  226

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+S+ EVEGL+K L   G DW  VRR  P ++V AHGPVTA G ER GV +DVVSSRF S
Sbjct  227  FTSSAEVEGLMKGLEAAGWDWGKVRRRWPEMLVGAHGPVTAKGVERFGVRVDVVSSRFSS  286

Query  131  FDGVVHALAHQWEC  90
            FDG++ ALA + + 
Sbjct  287  FDGILEALASKLQA  300



>ref|XP_010932696.1| PREDICTED: uncharacterized protein LOC105053288 [Elaeis guineensis]
Length=305

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 139/192 (72%), Gaps = 5/192 (3%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDS-FISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLC  495
            GE   ++ALGKD ELL +  F+SR+C N  RI+V+ P IA+P GLV ALGDG GR+ VLC
Sbjct  110  GEPFTVAALGKDAELLHEGGFLSRLCRNTSRIKVLVPEIASPAGLVAALGDGLGRR-VLC  168

Query  494  PVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAM  315
            PVP+V+ LEEPPV+P F+ DL   GW+PVRV AYETRW GP C   +++  G    +DAM
Sbjct  169  PVPTVVDLEEPPVIPTFVGDLEAAGWIPVRVPAYETRWAGPGCVEVLMKLKGT---LDAM  225

Query  314  VFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFD  135
            VF+S+ EVEGL+K L   G DWE V R  P ++V AHGPVTA G ER GV +DVVSSRF 
Sbjct  226  VFTSSAEVEGLMKGLEAAGWDWEKVIRRWPEILVGAHGPVTAKGVERFGVRVDVVSSRFS  285

Query  134  SFDGVVHALAHQ  99
            SFDG++ ALA +
Sbjct  286  SFDGILEALASK  297



>ref|XP_010558898.1| PREDICTED: uncharacterized protein LOC104827422 [Tarenaya hassleriana]
Length=302

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 138/187 (74%), Gaps = 4/187 (2%)
 Frame = -3

Query  668  EILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPV  489
            E  V++ALG+D  ++D  F+S+   + +R+RV+ P IATPTGLVE+LG G GR+ +LCPV
Sbjct  108  EGFVLAALGRDAAMIDRDFVSQFSSDEDRVRVIVPSIATPTGLVESLGSGRGRR-ILCPV  166

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVF  309
            PSV+ L EPPVVP FLRDL   GWVP+RV+AYETRW GP CA  +V    +     A+VF
Sbjct  167  PSVVELTEPPVVPRFLRDLEIAGWVPIRVDAYETRWVGPTCAEAMVAAVDDVD---AVVF  223

Query  308  SSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSF  129
            +ST EVEGLLK LRE G DW  V+R  P LV AAHGPVT +GAERLGV IDVV+ +F SF
Sbjct  224  TSTAEVEGLLKGLREMGWDWTAVKRRRPQLVTAAHGPVTEAGAERLGVRIDVVNDKFGSF  283

Query  128  DGVVHAL  108
            +GVV AL
Sbjct  284  EGVVEAL  290



>ref|XP_006849857.1| hypothetical protein AMTR_s00022p00059330 [Amborella trichopoda]
 gb|ERN11438.1| hypothetical protein AMTR_s00022p00059330 [Amborella trichopoda]
Length=308

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 134/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  671  GEILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            GE   + ALG+D ELLD  F+  +CEN +R+RV  P + TP  + E LGDG  R+ +LC 
Sbjct  116  GEPFYLCALGRDSELLDQRFVLSLCENLDRVRVFVPSVPTPKAMAEELGDGLNRE-ILCL  174

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V GL+EP VVP FL  L  + W P+R+N+YETRW G  CA  ++         DA+V
Sbjct  175  VPLVTGLDEPSVVPDFLGALKDQNWRPIRLNSYETRWAGLDCAEFLISDEAS----DAIV  230

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+ST EV+GL+K L++ G +W  VR   PGLVVAAHGPVTA GA++LGV ID+VSSRFDS
Sbjct  231  FTSTAEVQGLIKGLKKLGFEWVMVREKRPGLVVAAHGPVTALGAKKLGVDIDLVSSRFDS  290

Query  131  FDGVVHALAHQW  96
            FDGVV+ALA ++
Sbjct  291  FDGVVNALAQRF  302



>ref|XP_010681252.1| PREDICTED: uncharacterized protein LOC104896233 [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVPS  483
            L ++ALGKD +LL   FIS +  N +R+++V P   TP+GLV +LG G GRK VLCPVP 
Sbjct  97   LTLAALGKDADLLTPQFISMLSSNSDRVKIVLPSNPTPSGLVHSLGPGLGRK-VLCPVPL  155

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+GL EPPVVP FLR+L   GWV VRV+AYET W GP CA ++V        +D +VF+S
Sbjct  156  VLGLNEPPVVPDFLRELGSMGWVAVRVDAYETSWAGPDCAEKLVNAQN----LDGLVFTS  211

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGI  159
            T EVEGLLKSLREYGLDWE +R+  P LVVAAHGPVTASGAER  + I
Sbjct  212  TAEVEGLLKSLREYGLDWEDMRKRWPRLVVAAHGPVTASGAERFKIKI  259



>ref|XP_002462593.1| hypothetical protein SORBIDRAFT_02g028710 [Sorghum bicolor]
 gb|EER99114.1| hypothetical protein SORBIDRAFT_02g028710 [Sorghum bicolor]
Length=299

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 127/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENP--ERIRVVEPRIATPTGLVEALGDGEGRKKVLCPV  489
              ++ALG D +LLD +F+SR+C      R+ V+ P + TP GLVEALG G GR+ VLCPV
Sbjct  106  FTVAALGSDADLLDHAFLSRLCGAAAGTRVSVLVPDVPTPAGLVEALGRGSGRR-VLCPV  164

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVF  309
            P V+GL EPPVVP FL  L   GWV VR  AY T W GP CA  +V    +   +DA+VF
Sbjct  165  PDVVGLREPPVVPDFLAGLEAAGWVAVRAPAYTTCWAGPRCAEALV--DPDAAPLDAVVF  222

Query  308  SSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSF  129
            +ST EVEGLLK L   G  W  +   CPG+VVAAHGPVTA GA  LGV +DVVS+RF SF
Sbjct  223  TSTAEVEGLLKRLESAGWTWARLTARCPGMVVAAHGPVTAGGARSLGVEVDVVSARFSSF  282

Query  128  DGVVHALAHQWE  93
             GVV ALA  + 
Sbjct  283  HGVVDALAATFS  294



>ref|NP_001145235.1| hypothetical protein [Zea mays]
 gb|ACG46144.1| hypothetical protein [Zea mays]
 tpg|DAA40418.1| TPA: hypothetical protein ZEAMMB73_114348 [Zea mays]
Length=297

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENP-ERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVP  486
              ++ALG D +LLD +F+SR+C +   R+ V+ P + TP GLVEALG G GR+ VLCPVP
Sbjct  105  FTVAALGSDADLLDHAFLSRLCGDAGTRVSVLVPDVPTPAGLVEALGRGSGRR-VLCPVP  163

Query  485  SVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFS  306
             V+GL EPPVVP FL  L   GWV VR  AY T W GP CA  +V    +   +DA+VF+
Sbjct  164  DVVGLREPPVVPDFLAGLEAAGWVAVRAPAYTTCWAGPRCAEALV--DPDAAPLDAVVFT  221

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFD  126
            ST EVEGLLK L   G  W  +    PG+VVAAHGPVTA GA  LGV +D+VS+RF SF 
Sbjct  222  STAEVEGLLKGLEAVGWTWARLAARWPGMVVAAHGPVTAGGARSLGVEVDIVSTRFSSFH  281

Query  125  GVVHALA  105
            GVV ALA
Sbjct  282  GVVDALA  288



>gb|EEC84811.1| hypothetical protein OsI_31881 [Oryza sativa Indica Group]
Length=301

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 126/191 (66%), Gaps = 6/191 (3%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPE-RIRVVEPRIATPTGLVEALGDGEGRKKVLCPVP  486
              ++ALG D +LLD +F+SR+C +   R+ V+ P + TP GLVEALG G GR+ VLCPVP
Sbjct  114  FTVAALGSDADLLDAAFLSRLCGDAGGRVSVLVPDVPTPAGLVEALGSGSGRR-VLCPVP  172

Query  485  SVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFS  306
             V+GL EPPVVP FL  L   GWV VR  AY T W GP CA  +V    +    DA+VF+
Sbjct  173  DVVGLREPPVVPGFLSGLEAAGWVAVRAPAYVTCWAGPRCAEALV----DAAAPDAVVFT  228

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFD  126
            ST EVEGLLK L   G  W  +R   P +VVAAHGPVTA G  RLG+ +DVV +RF SF 
Sbjct  229  STAEVEGLLKGLDAAGWSWPRLRARWPRMVVAAHGPVTADGVRRLGIEVDVVGARFSSFH  288

Query  125  GVVHALAHQWE  93
            GV+ ALA + E
Sbjct  289  GVLDALAAKRE  299



>ref|XP_004957231.1| PREDICTED: uncharacterized protein LOC101779932 [Setaria italica]
Length=299

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENP-ERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVP  486
              ++ALG D +LLD +F+SR+C +   R+ V+ P + TP GLVEALG G GR+ VLCPVP
Sbjct  107  FTVAALGSDADLLDRAFLSRLCGDAGTRVAVLVPAVPTPAGLVEALGPGSGRR-VLCPVP  165

Query  485  SVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFS  306
             V+GL EPPVVP FL  L   GWV VR  AY T W GP CA  +V    +    DA+VF+
Sbjct  166  DVVGLREPPVVPDFLAGLEAAGWVAVRAPAYTTSWAGPGCAEALV--GADAAAPDAVVFT  223

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFD  126
            ST EVEGLLK L   G  W  +R   PG+VVAAHGPVTA+GA  LGV +DVVS+RF SF 
Sbjct  224  STAEVEGLLKGLDAAGWTWARLRARWPGMVVAAHGPVTAAGARSLGVEVDVVSARFSSFH  283

Query  125  GVVHALAHQWE  93
            GVV ALA  + 
Sbjct  284  GVVDALATTFS  294



>gb|KCW78980.1| hypothetical protein EUGRSUZ_C00407 [Eucalyptus grandis]
Length=301

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 127/187 (68%), Gaps = 3/187 (2%)
 Frame = +1

Query  118  TTPSKLSNLELTTSIPTPSLSAPEAVTGPWAATTSPGHILLTVSQSNPY-SLKLFSSPST  294
            TTP KLSNL  TTS PTPSLSAP AVTGP AATTS GH+LLT S S+P  SL+L S PST
Sbjct  42   TTPPKLSNLWPTTSTPTPSLSAPAAVTGPCAATTSSGHLLLTSSHSHPKPSLRLLSRPST  101

Query  295  SPVLENTIASIPHSSPLLLTTSA-AHAGPPHRVSYALTLTGTHPFFAKSRRNAGTTGGSS  471
            SP+L  TIAS P      L T A A + P HRVSYA TLT   PF ++S  N+GTTGGSS
Sbjct  102  SPLLVKTIASNPSPPSPPLLTIAPAQSSPSHRVSYAATLTAAQPFASRSPMNSGTTGGSS  161

Query  472  RPITDGTGQRTFFLPSPSPSASTRPVGVAIRGSTTLILSGFSQILEMKESSRSSRSLPRA  651
             P T GTGQR   LPSP PS S  P G+A  G++  I  G +QIL+ + +SRSS SLPRA
Sbjct  162  IPTTRGTGQR-ILLPSPRPSESASPRGLATWGTSVSIRRGSAQILDRRSASRSSESLPRA  220

Query  652  EITKISP  672
              TK  P
Sbjct  221  ATTKAPP  227



>ref|XP_006381898.1| hypothetical protein POPTR_0006s20320g [Populus trichocarpa]
 gb|ERP59695.1| hypothetical protein POPTR_0006s20320g [Populus trichocarpa]
Length=150

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 104/160 (65%), Gaps = 25/160 (16%)
 Frame = -3

Query  584  RIRVVEPRIATPTGLVEALGDGEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVR  405
            R++V+ P I T  G V  LG G  RK VLCPVP V+GLEEPPVVP FLR+L         
Sbjct  13   RVKVLVPTITTRNG-VHLLGTGRCRK-VLCPVPRVVGLEEPPVVPDFLRELE--------  62

Query  404  VNAYETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCP  225
                          A VV RS +E  +DAMVF+S+GEVEGLLKSL+E G +WE +RR  P
Sbjct  63   --------------AAVVERS-DEGLLDAMVFASSGEVEGLLKSLKELGWEWEMMRRRWP  107

Query  224  GLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALA  105
             LVV AHGPVTA+GAE LGV ++VVS RFDSF G V  L+
Sbjct  108  NLVVVAHGPVTAAGAESLGVNVNVVSERFDSFQGTVWMLS  147



>ref|XP_002961862.1| hypothetical protein SELMODRAFT_403240 [Selaginella moellendorffii]
 gb|EFJ37122.1| hypothetical protein SELMODRAFT_403240 [Selaginella moellendorffii]
Length=262

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 112/179 (63%), Gaps = 11/179 (6%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVPS  483
            LV+ ALGKD EL+ +  + +     +R+ VV PR+ATP  LVE LGDG GR ++LCPVP 
Sbjct  78   LVVGALGKDAELIQELDLFKEHREQQRLTVVVPRVATPDALVEELGDGAGR-RLLCPVPY  136

Query  482  VI-GLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFS  306
               GL EP VVP F+  L + GW   R++AY T W G A    ++        +DA+VF+
Sbjct  137  ACGGLSEPDVVPNFVAALQRHGWDVERLDAYATSWTGSASVTPLL-----AGAVDALVFT  191

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSF  129
            ST EVEGLL +L  + L   T+  + P  V+ A GPVTA GA+RLGV +DVV  RF+SF
Sbjct  192  STAEVEGLLMALHAHHL---TIASLWP-CVLVAFGPVTARGAKRLGVDVDVVGHRFNSF  246



>ref|XP_002980789.1| hypothetical protein SELMODRAFT_420371 [Selaginella moellendorffii]
 gb|EFJ17974.1| hypothetical protein SELMODRAFT_420371 [Selaginella moellendorffii]
Length=231

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 114/179 (64%), Gaps = 11/179 (6%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVPS  483
            LV+ ALGKD EL+ +  + +     +R+ VV P +ATP  LVE LGDG GR ++LCPVP 
Sbjct  47   LVVGALGKDAELIQELDLFKEHREQQRLTVVVPLVATPDALVEELGDGAGR-RLLCPVPY  105

Query  482  VI-GLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFS  306
            V  GL EP VVP F+  L + GW   R++AY T W G A    ++  +     +DA+VF+
Sbjct  106  VCGGLSEPDVVPNFVAALQRHGWDVERLDAYATSWTGSASVTPLLAGA-----VDALVFT  160

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSF  129
            ST EVEGLL +L+ + L   T+  + P ++V A GPVTA GA++LGV +DV+  RF+ F
Sbjct  161  STAEVEGLLMALQAHHL---TLASLWPCVLV-AFGPVTARGAKQLGVDVDVIGHRFNGF  215



>gb|KHN20426.1| hypothetical protein glysoja_045575 [Glycine soja]
Length=114

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -3

Query  392  ETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVV  213
            ++R     CA  +VR S EE G+DA+VF+S  +VEGLLKSLRE+GL +  +RR CP LVV
Sbjct  11   QSRGAARGCAEGIVRASEEERGLDAVVFTSIAKVEGLLKSLREFGLGFGDLRRRCPKLVV  70

Query  212  AAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHAL  108
            AAHGPVTA GA RL V +DVVSS+F SFDG V   
Sbjct  71   AAHGPVTAVGALRLSVEVDVVSSKFGSFDGFVDVF  105



>ref|XP_006386962.1| hypothetical protein POPTR_2609s00200g, partial [Populus trichocarpa]
 gb|ERP45876.1| hypothetical protein POPTR_2609s00200g, partial [Populus trichocarpa]
Length=119

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 35/145 (24%)
 Frame = -3

Query  668  EILVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPV  489
             I +I +LGK+++L+D +          R++V+ P I T  G V  LG G  RK VLCPV
Sbjct  8    NIFIIVSLGKNVQLIDTT----------RVKVLVPTITTRNG-VHLLGTGRCRK-VLCPV  55

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVF  309
            P V+GLEEPPVVP FLR+L                       A VV RS +E  +DAMVF
Sbjct  56   PRVVGLEEPPVVPDFLRELE----------------------AAVVERS-DEGLLDAMVF  92

Query  308  SSTGEVEGLLKSLREYGLDWETVRR  234
            +S+GEVEGLLKSL+E G +WE +RR
Sbjct  93   ASSGEVEGLLKSLKELGWEWEMMRR  117



>ref|XP_010106882.1| hypothetical protein L484_012337 [Morus notabilis]
 gb|EXC12523.1| hypothetical protein L484_012337 [Morus notabilis]
Length=183

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVPS  483
              I+ALGKD ELL D ++++  +N +RIRV+ P +A P+GLV +L DG  R++VLC VP 
Sbjct  92   FTIAALGKDSELLYDEYLTKFGKNRDRIRVLVPLVAMPSGLVRSLRDGR-RQRVLCTVPI  150

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYET  387
            ++ LEEPPVVP FLR+L    W+PV V  YET
Sbjct  151  IVDLEEPPVVPNFLRELESSRWIPVLVGTYET  182



>gb|ABA22684.1| uroporphyrinogen-III synthase [Anabaena variabilis ATCC 29413]
Length=276

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 100/189 (53%), Gaps = 20/189 (11%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEG--RKKVLCPVPS  483
            + ALGKD+++L   F         R+ ++ P  ++P G+V       G  R+K+L PVP 
Sbjct  101  LCALGKDIDVLLSLF--------GRVDLI-PDESSPAGIVAKFSQIHGISRQKILVPVPE  151

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            VIG+ EP +VP F++DL K G   +RV  Y T+       +  +    ++  ID + FSS
Sbjct  152  VIGIPEPNIVPNFIKDLEKLGMQVIRVPTYITQSLDKNIYSVEINLI-QQGLIDVIAFSS  210

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T E+E  LK         +   + C   VVA  GP TA+ A++LG+ + +VS+ F SF+G
Sbjct  211  TAEIESFLKMFNS-----KNEFQHC---VVACFGPYTAANAQKLGLDVSLVSTDFSSFEG  262

Query  122  VVHALAHQW  96
             V A+   +
Sbjct  263  FVEAIVKFY  271



>ref|WP_041456851.1| hypothetical protein, partial [Anabaena variabilis]
Length=290

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 100/189 (53%), Gaps = 20/189 (11%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEG--RKKVLCPVPS  483
            + ALGKD+++L   F         R+ ++ P  ++P G+V       G  R+K+L PVP 
Sbjct  120  LCALGKDIDVLLSLF--------GRVDLI-PDESSPAGIVAKFSQIHGISRQKILVPVPE  170

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            VIG+ EP +VP F++DL K G   +RV  Y T+       +  +    ++  ID + FSS
Sbjct  171  VIGIPEPNIVPNFIKDLEKLGMQVIRVPTYITQSLDKNIYSVEINLI-QQGLIDVIAFSS  229

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T E+E  LK         +   + C   VVA  GP TA+ A++LG+ + +VS+ F SF+G
Sbjct  230  TAEIESFLKMFNS-----KNEFQHC---VVACFGPYTAANAQKLGLDVSLVSTDFSSFEG  281

Query  122  VVHALAHQW  96
             V A+   +
Sbjct  282  FVEAIVKFY  290



>ref|XP_010106881.1| hypothetical protein L484_012336 [Morus notabilis]
 gb|EXC12522.1| hypothetical protein L484_012336 [Morus notabilis]
Length=119

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  314  VFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFD  135
            +F+ST EVEGLLKSLRE GLDW+ V+  C  LVVAAHGP+ A GA RL V +D+V  +FD
Sbjct  1    MFTSTAEVEGLLKSLRELGLDWKEVKARCLELVVAAHGPMMADGAARLSVEVDLVGDKFD  60

Query  134  SFDGVVHAL  108
            SF+GVV+AL
Sbjct  61   SFNGVVNAL  69



>ref|WP_010476360.1| uroporphyrinogen III synthase [Acaryochloris sp. CCMEE 5410]
Length=287

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 105/201 (52%), Gaps = 21/201 (10%)
 Frame = -3

Query  665  ILVISALGKDLELLDDSFISRICENPERIRVV------EPRIATPTGLVEALGD--GEGR  510
            +L +  L   L LL+   I  I ++ ++++ +       P+ ++P GLV  L        
Sbjct  83   MLRLQQLDIPLFLLNQCHICAIGQDADQLQALGVRVDLIPKESSPAGLVAELAQIPDIDT  142

Query  509  KKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYET-RWGGPACAAEVVR-RSGE  336
            +++L P+P V  + EP +VP FL DL + G   V V AY T R    A A EV + R G+
Sbjct  143  QRILVPIPQVERIPEPDIVPNFLADLQQLGLTVVSVPAYVTRRLEATAYAVEVEQIRQGK  202

Query  335  ECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGID  156
               +DA+ FSST E+  LL+      +D ET+ + C   V+A  GP TA  A+ LG+ +D
Sbjct  203  ---VDAIAFSSTAEISALLQM-----VDAETLMKHC---VIACFGPYTAGNAKDLGLSVD  251

Query  155  VVSSRFDSFDGVVHALAHQWE  93
            +VS  F SF G   A+A  + 
Sbjct  252  IVSQDFSSFTGFTAAIAQFFH  272



>ref|WP_012161951.1| uroporphyrinogen III synthase [Acaryochloris marina]
 gb|ABW26419.1| uroporphyrinogen-III synthase [Acaryochloris marina MBIC11017]
Length=287

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 104/201 (52%), Gaps = 21/201 (10%)
 Frame = -3

Query  665  ILVISALGKDLELLDDSFISRICENPERIRVV------EPRIATPTGLVEALGD--GEGR  510
            +L +  L   L LL+   I  I ++ ++++ +       P+ ++P GLV  L        
Sbjct  83   MLRLQQLDIPLFLLNQCHICAIGQDADQLQTLGVRVDLIPKESSPAGLVAELAQIPDIDT  142

Query  509  KKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETR-WGGPACAAEVVR-RSGE  336
            +++  P+P V  + EP +VP FL DL + G   V V AY TR     A A EV + R G+
Sbjct  143  RRIFVPIPQVERIPEPDIVPKFLADLEQLGLTVVSVPAYVTRRLEATAYAVEVEQIRQGK  202

Query  335  ECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGID  156
               +DA+ FSST E+  LL+ +     D ET+ + C   V+A  GP TA  A+ LG+ +D
Sbjct  203  ---VDAIAFSSTAEISALLQMV-----DAETLMKHC---VIACFGPYTAGNAKDLGLSVD  251

Query  155  VVSSRFDSFDGVVHALAHQWE  93
            +VS  F SF G   A+A  + 
Sbjct  252  IVSQDFSSFTGFTAAIAQFFH  272



>ref|XP_002959865.1| hypothetical protein VOLCADRAFT_108778 [Volvox carteri f. nagariensis]
 gb|EFJ39071.1| hypothetical protein VOLCADRAFT_108778 [Volvox carteri f. nagariensis]
Length=208

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 102/197 (52%), Gaps = 22/197 (11%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVLCPVP  486
            + ALG D E+L +  ++     PE         A+  GLV  L   G+ +G  +V+CPVP
Sbjct  1    MCALGADGEVLKERGLTVHVSPPE---------ASTLGLVRELVARGEAQG-ARVMCPVP  50

Query  485  SVIG-LEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVF  309
             V G L EPPVVP FLR L   G   VR+ AY T  G       + RR+  E G+ A+ F
Sbjct  51   LVTGGLVEPPVVPRFLRALEDAGCTAVRLPAYLTTLGCSPGDVSLERRALGEGGVAAVAF  110

Query  308  SSTGE----VEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDV--VS  147
            SST E     +GLL+ +       E V R   G+++AAHGP TA G   +  G+ V  VS
Sbjct  111  SSTAEASVSAQGLLQLMGGADAFAEAVVRH--GVLLAAHGPYTAEGVRAVTGGLQVGAVS  168

Query  146  SRFDSFDGVVHALAHQW  96
              F +FDG+V AL   +
Sbjct  169  RNFSTFDGLVTALEEHF  185



>ref|WP_015136484.1| uroporphyrinogen-III synthase [Nostoc sp. PCC 7524]
 gb|AFY46014.1| uroporphyrinogen-III synthase [Nostoc sp. PCC 7524]
Length=283

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 99/189 (52%), Gaps = 26/189 (14%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD ++L  S+  ++         V P+ ++P G+V  L    G   KKVL P P 
Sbjct  107  LCALGKDADILL-SYCGKV--------DVIPKESSPVGIVTELSQIPGISGKKVLVPAPE  157

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAA---EVVRRSGEECGIDAMV  312
            VIG+ EP VVP  + DL K G    R++ Y T+            ++R+      ID + 
Sbjct  158  VIGIPEPNVVPNLVADLQKLGMQVTRISTYITQCLDKNIYQLELNLIRQG----MIDVIA  213

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            FSST E+  LL ++ E   D E         ++A  GP TA+ A+++G+ +D+VS+ F S
Sbjct  214  FSSTAEITSLL-TMVESNNDLE-------NCLIACFGPYTAANAQQMGIKVDIVSTDFSS  265

Query  131  FDGVVHALA  105
            F+G V A+A
Sbjct  266  FEGFVQAIA  274



>dbj|BAB77811.1| uroporphyrinogen-III synthase [Nostoc sp. PCC 7120]
Length=276

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 101/190 (53%), Gaps = 22/190 (12%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD+++L   F         ++ ++ P  ++P G+V       G   +K+L PVP 
Sbjct  101  LCALGKDIDILLSLF--------GKVDLI-PDESSPAGIVAEFSQICGIREQKILVPVPE  151

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETR-WGGPACAAEVVRRSGEECGIDAMVFS  306
            VIG+ EP +VP F++DL + G   +RV AY T+       + E+     ++  ID + FS
Sbjct  152  VIGIPEPNIVPNFIKDLEELGMQVIRVPAYITQSLDKDIYSVEI--NLIQQGLIDIIAFS  209

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFD  126
            ST E+E  L          ++  + C   VVA  GP TA+ AE+LG+ + +VS+ F SF+
Sbjct  210  STAEIESFLAMFNS-----KSEFQHC---VVACFGPYTAANAEQLGLNVSIVSTDFSSFE  261

Query  125  GVVHALAHQW  96
            G V A+   +
Sbjct  262  GFVEAIVKFY  271



>ref|WP_044520556.1| uroporphyrinogen III synthase [Nostoc sp. PCC 7120]
Length=292

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 101/190 (53%), Gaps = 22/190 (12%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD+++L   F         ++ ++ P  ++P G+V       G   +K+L PVP 
Sbjct  117  LCALGKDIDILLSLF--------GKVDLI-PDESSPAGIVAEFSQICGIREQKILVPVPE  167

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETR-WGGPACAAEVVRRSGEECGIDAMVFS  306
            VIG+ EP +VP F++DL + G   +RV AY T+       + E+     ++  ID + FS
Sbjct  168  VIGIPEPNIVPNFIKDLEELGMQVIRVPAYITQSLDKDIYSVEI--NLIQQGLIDIIAFS  225

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFD  126
            ST E+E  L          ++  + C   VVA  GP TA+ AE+LG+ + +VS+ F SF+
Sbjct  226  STAEIESFLAMFNS-----KSEFQHC---VVACFGPYTAANAEQLGLNVSIVSTDFSSFE  277

Query  125  GVVHALAHQW  96
            G V A+   +
Sbjct  278  GFVEAIVKFY  287



>ref|XP_005644693.1| tetrapyrrole biosynthesis, uroporphyrinogen III synthase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE20149.1| tetrapyrrole biosynthesis, uroporphyrinogen III synthase [Coccomyxa 
subellipsoidea C-169]
Length=247

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 94/165 (57%), Gaps = 24/165 (15%)
 Frame = -3

Query  653  SALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVLCPVPS  483
            +ALG D E+L ++ +           V+ P+ A+  GLV  L   G+ EG  +VLCPVP 
Sbjct  93   AALGADAEMLAEAGVRD---------VLTPQEASTQGLVAELQRRGEAEG-ARVLCPVPL  142

Query  482  VIG-LEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPA--CAAEVVRRSGEECGIDAMV  312
            V G L EPPVVP FL  L   G   VRV+AYETR G  A  CAAE  R+   +  + A+ 
Sbjct  143  VSGGLTEPPVVPRFLASLQAAGAHAVRVDAYETRPGATAEQCAAE--RQLLADGHVYAVA  200

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCP--GLVVAAHGPVTASG  183
            F+ST E EGLL+ +       E +++M    G ++AAHGP TA+G
Sbjct  201  FTSTAEAEGLLQIMG----GREALQQMLEKWGTILAAHGPYTAAG  241



>ref|WP_006562361.1| uroporphyrinogen III synthase [Oscillochloris trichoides]
 gb|EFO80341.1| uroporphyrinogen III synthase HEM4 [Oscillochloris trichoides 
DG-6]
Length=276

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 99/193 (51%), Gaps = 25/193 (13%)
 Frame = -3

Query  650  ALGKDLELLDDSFISRICENPERIRVVEPRIA------TPTGLVEALGDGEGRK--KVLC  495
            ALG  L+ L    ++ I  + ER+R V  R++      +P G+V  L      +  ++L 
Sbjct  92   ALGLALKDLHHCHLAAIGRDAERLREVGLRVSLLPCEPSPHGIVAELAQRPASRGQRILV  151

Query  494  PVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETR---WGGPACAAEVVRRSGEECGI  324
            P P+V GLEEP V+P F+  L +   +PVRV AY TR           +++RR      +
Sbjct  152  PAPAVEGLEEPDVIPNFVAGLEEINMIPVRVPAYRTRVLEAQRYQLELDLIRRG----VV  207

Query  323  DAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSS  144
            DA+ FSS GEV G L S+ E   D         G  +   GP TA+ A R+G+   VV+S
Sbjct  208  DAIAFSSAGEVAGFL-SMIEPPTD---------GPAICCFGPYTAANARRMGLEPSVVAS  257

Query  143  RFDSFDGVVHALA  105
             F SFDG V A+A
Sbjct  258  DFSSFDGFVAAIA  270



>ref|WP_035121530.1| uroporphyrinogen III synthase [Fischerella sp. PCC 9431]
Length=274

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 96/187 (51%), Gaps = 20/187 (11%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            ISA+GKD E        R+     ++ ++ P+ A+P G++  L       ++ +L PVP 
Sbjct  98   ISAVGKDAE--------RLASFGVKVDLI-PQEASPQGIIAELAKIPDINKQTILVPVPE  148

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+G+ EP ++P FL DL   G    RV +Y TR    +   +V      +  ID + FSS
Sbjct  149  VVGIVEPNIIPNFLADLQNLGMAVTRVPSYMTRCLDKSL-YDVELNLIRQGKIDVIAFSS  207

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T E+ G L+ +    +D++         V+A  GP TA+ A+ LG+ + +V+  + SF G
Sbjct  208  TAEILGFLQMITS-KVDYQKS-------VIACFGPYTAANAKNLGMNVSIVAKNYSSFAG  259

Query  122  VVHALAH  102
               A+A+
Sbjct  260  FAEAIAN  266



>gb|ACC80313.1| Uroporphyrinogen III synthase HEM4 [Nostoc punctiforme PCC 73102]
Length=300

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 93/196 (47%), Gaps = 20/196 (10%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD E    S +S  C   + I    P  ++P G+V  L        KKVL P P 
Sbjct  123  LCALGKDAE----SLLS-FCGKVDLI----PTESSPAGIVAELAKIPQIHNKKVLIPAPE  173

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+GL EP VVP  + DL + G   +RV  Y T+ G       +      +  ID + FSS
Sbjct  174  VVGLPEPDVVPNLITDLQQLGTEVIRVPTYITQ-GLNTSIYSIELNLIHQGMIDVIAFSS  232

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T EVE  L  +     D+E       G +VA  GP T + A +LGV + +VS  + SF+G
Sbjct  233  TAEVESFLTMVNSQS-DYE-------GCIVACFGPYTTANARKLGVNVSIVSRDYSSFEG  284

Query  122  VVHALAHQWECLDS*H  75
               A+A  +    + H
Sbjct  285  FAEAIAEFFTLTSNSH  300



>ref|WP_041566001.1| uroporphyrinogen III synthase [Nostoc punctiforme]
Length=284

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 93/196 (47%), Gaps = 20/196 (10%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD E    S +S  C   + I    P  ++P G+V  L        KKVL P P 
Sbjct  107  LCALGKDAE----SLLS-FCGKVDLI----PTESSPAGIVAELAKIPQIHNKKVLIPAPE  157

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+GL EP VVP  + DL + G   +RV  Y T+ G       +      +  ID + FSS
Sbjct  158  VVGLPEPDVVPNLITDLQQLGTEVIRVPTYITQ-GLNTSIYSIELNLIHQGMIDVIAFSS  216

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T EVE  L  +     D+E       G +VA  GP T + A +LGV + +VS  + SF+G
Sbjct  217  TAEVESFLTMVNSQS-DYE-------GCIVACFGPYTTANARKLGVNVSIVSRDYSSFEG  268

Query  122  VVHALAHQWECLDS*H  75
               A+A  +    + H
Sbjct  269  FAEAIAEFFTLTSNSH  284



>ref|WP_035138509.1| uroporphyrinogen III synthase [Fischerella muscicola]
Length=273

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 100/193 (52%), Gaps = 17/193 (9%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPER-----IRV-VEPRIATPTGLVEALGD--GEGRKKV  501
            + ALG  + +L +  +S I ++ ER     ++V + P+ ++P G++  L       ++ V
Sbjct  82   LEALGISVSVLKNCRVSAIGKDAERLANFGVKVDLIPQESSPKGIIAELAKVPDINKQTV  141

Query  500  LCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGID  321
            L PVP V+G+ EP V+P F+  L K G    RV  Y TR    +   EV      +  ID
Sbjct  142  LVPVPEVVGIAEPNVIPNFVAGLKKLGMSVTRVPTYMTRCLDKSL-YEVELNLVRQGKID  200

Query  320  AMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSR  141
             + FSST E+ G  + +     D++     C   V+A  GP TA+ A++LG+ + +V+  
Sbjct  201  VIAFSSTAEISGFFQMITSKA-DYQ----QC---VIACFGPYTAANAKKLGMNVSIVAEN  252

Query  140  FDSFDGVVHALAH  102
            + SF G   A+A+
Sbjct  253  YSSFAGFAEAIAN  265



>ref|WP_033336743.1| uroporphyrinogen III synthase [Scytonema hofmanni]
Length=295

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 86/175 (49%), Gaps = 25/175 (14%)
 Frame = -3

Query  572  VEPRIATPTGLVEALG--DGEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVN  399
            + P+  +P G++  L       ++ VL PVP V+G+ EP VVP F+  L + G    RV 
Sbjct  136  IVPKEPSPAGIIAELAKISNIAKQTVLVPVPEVLGVPEPDVVPNFVAGLKQLGMNVTRVP  195

Query  398  AYETRWGGPACAAEVVR-------RSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETV  240
             Y TR     C  + V        R G+   IDA+ FSST E+ G LK       D+E  
Sbjct  196  TYMTR-----CLEKTVYDVELSLVRQGK---IDAIAFSSTAEIMGFLKMFNSKS-DYENC  246

Query  239  RRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQWECLDS*H  75
                    +A  GP TA+ A++LG+ + +VS  + SF G  +A+A  +  + S H
Sbjct  247  -------TIACFGPYTAANAKKLGLDVSIVSKDYSSFAGFTNAIASFFHPVSSAH  294



>ref|WP_016871394.1| uroporphyrinogen III synthase [Fischerella thermalis]
Length=273

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 95/194 (49%), Gaps = 20/194 (10%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            ISA+GKD E L D  I        ++ ++ P+  +P G++  L       ++ VL PVP 
Sbjct  97   ISAIGKDAERLSDFGI--------KVDLI-PQEPSPKGIIAELAKVPNINKQTVLVPVPE  147

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+G+ EP V+P F+  L K      RV  Y TR    +   EV      +  ID + FSS
Sbjct  148  VVGIAEPNVIPGFVAGLKKLRMSVTRVPTYTTRCLDKSL-YEVELNLIRQGKIDVIAFSS  206

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T E+ G L+ +     D++     C   V+A  GP TA+   +LG+ + +V+  + SF G
Sbjct  207  TAEISGFLQMVTSKA-DYQ----QC---VIACFGPYTAANGRKLGLNVSIVAENYSSFAG  258

Query  122  VVHALAHQWECLDS  81
               A+A+    L S
Sbjct  259  FAEAIANFMLLLSS  272



>ref|WP_016861285.1| uroporphyrinogen III synthase [Fischerella muscicola]
Length=274

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 93/187 (50%), Gaps = 20/187 (11%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            ISA+GKD E L  SF  ++   P+     EP   +P G++  L       ++ VL PVP 
Sbjct  98   ISAVGKDAEKLA-SFGVKVDLVPQ-----EP---SPKGIITELAKIPDINKQTVLVPVPE  148

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+G+ EP ++P FL  L   G    RV  Y TR    +   +V      +  ID + FSS
Sbjct  149  VVGIAEPNIIPNFLAGLKNLGMAVTRVPTYMTRCLDKSL-YDVELNLIRQGKIDVIAFSS  207

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T E+ G L+ L     D++         V+A  GP TA+ A+ LG+ + +V+  + SF G
Sbjct  208  TAEILGFLQMLTSKA-DYQQS-------VIACFGPYTAANAKSLGMNVSIVAKNYSSFAG  259

Query  122  VVHALAH  102
               A+A+
Sbjct  260  FAEAIAN  266



>ref|WP_009459493.1| uroporphyrinogen III synthase [Fischerella sp. JSC-11]
 gb|EHC09425.1| Uroporphyrinogen III synthase HEM4 [Fischerella sp. JSC-11]
Length=273

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 93/187 (50%), Gaps = 20/187 (11%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            ISA+GKD E L D  I        ++ ++ P+  +P G++  L       ++ VL PVP 
Sbjct  97   ISAIGKDAERLSDFGI--------KVDLI-PQEPSPKGIIAELAKVPNINKQTVLVPVPE  147

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+G+ EP V+P F+  L K      RV  Y TR    +   EV      +  ID + FSS
Sbjct  148  VVGIAEPNVIPEFVAGLKKLRMSVTRVPTYTTRCLDKSL-YEVELNLIRQGKIDVIAFSS  206

Query  302  TGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDG  123
            T E+ G L+ +     D++     C   V+A  GP TA+   +LG+ + +V+  + SF G
Sbjct  207  TAEISGFLQMVTSKA-DYQ----QC---VIACFGPYTAANGRKLGLNVSIVAENYSSFAG  258

Query  122  VVHALAH  102
               A+A+
Sbjct  259  FAEAIAN  265



>gb|KIZ07248.1| hypothetical protein MNEG_0702 [Monoraphidium neglectum]
Length=262

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 99/184 (54%), Gaps = 22/184 (12%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRK--KVLCPV  489
            + + ALG D ++L   F   +         V P+ A+  GLV  L    G +  +VL PV
Sbjct  89   MKLCALGADGDVLQREFGLTLD--------VSPQEASTQGLVAELERRGGARGARVLAPV  140

Query  488  PSVIG-LEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGP------ACAAEVVRRSGEEC  330
            P V G L EPPVVP F+  L + G    RV AY T  G P      ACAAE  R   +E 
Sbjct  141  PLVTGGLREPPVVPRFMAGLERIGAAATRVPAYLTTPGFPGQAGLEACAAE--RELLQEG  198

Query  329  GIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGA-ERLGVGIDV  153
             + A+VFSST E +GL + +    +  + VRR   G+++AAHGP TA+GA E LG+ + V
Sbjct  199  RVAAVVFSSTAEAQGLSRLMGGREVLADAVRRH--GVLLAAHGPCTAAGASEVLGLPVPV  256

Query  152  VSSR  141
            VS R
Sbjct  257  VSKR  260



>ref|WP_008273972.1| uroporphyrinogen III synthase [Cyanothece sp. CCY0110]
 gb|EAZ92828.1| uroporphyrinogen-III synthase [Cyanothece sp. CCY0110]
Length=281

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 94/185 (51%), Gaps = 23/185 (12%)
 Frame = -3

Query  626  LDDSFISRICENPERIR------VVEPRIATPTGLVEALG--DGEGRKKVLCPVPSVIGL  471
            LD+  +  I ++ +R++       + P+  +P G+V  L   D   ++ +L P+P VIG+
Sbjct  96   LDNCQLIAIGKDAQRLKEMGLKVAIMPKEPSPLGIVSELAKIDNIEKQSILIPIPQVIGI  155

Query  470  EEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACA---AEVVRRSGEECGIDAMVFSST  300
             EP ++P F+  L + G     V AY+TR    +      +++++      ID + FSST
Sbjct  156  SEPDIIPNFITALERLGMKINPVYAYQTRCLETSLYDMEIDLIKQG----KIDVIAFSST  211

Query  299  GEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGV  120
             E+E  L+ +    L      + C   ++A  GP TA  A +LG+ +D+V   + SF G 
Sbjct  212  AEIESFLQLVNNTQL-----FKQC---LIACFGPYTAGNARKLGLTVDIVGKDYHSFTGF  263

Query  119  VHALA  105
            V A+A
Sbjct  264  VEAIA  268



>ref|WP_044492160.1| uroporphyrinogen III synthase [Moorea producens]
Length=277

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 26/193 (13%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEG--RKKVLCPVPS  483
            +SA+GKD E L D  ++           + P  A+PTG+V  L +     +K +L P+P 
Sbjct  105  LSAIGKDAERLSDFGVTA---------DLVPAEASPTGMVTELSNYPTIDQKTILVPIPK  155

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+G+ EP V+P F+  L + G     V  Y+TR        +V      +  ID + FSS
Sbjct  156  VVGIPEPNVIPNFISGLQELGIKVSPVLTYQTRILDKTIY-DVELNLIRQGKIDVIAFSS  214

Query  302  TGEVEGLL---KSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            T EV   L    S ++Y          C   V+A  GP TA+  E LG+ + +VS  + S
Sbjct  215  TAEVTAFLTMVNSPQDYN--------HC---VIACFGPYTAANTENLGLTVSIVSKNYRS  263

Query  131  FDGVVHALAHQWE  93
            F+G  +A+A+ + 
Sbjct  264  FEGFANAIANFFN  276



>gb|EGJ34942.1| uroporphyrinogen-III synthase [Moorea producens 3L]
Length=272

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 26/193 (13%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEG--RKKVLCPVPS  483
            +SA+GKD E L D  ++           + P  A+PTG+V  L +     +K +L P+P 
Sbjct  100  LSAIGKDAERLSDFGVTA---------DLVPAEASPTGMVTELSNYPTIDQKTILVPIPK  150

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSS  303
            V+G+ EP V+P F+  L + G     V  Y+TR        +V      +  ID + FSS
Sbjct  151  VVGIPEPNVIPNFISGLQELGIKVSPVLTYQTRILDKTIY-DVELNLIRQGKIDVIAFSS  209

Query  302  TGEVEGLL---KSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            T EV   L    S ++Y          C   V+A  GP TA+  E LG+ + +VS  + S
Sbjct  210  TAEVTAFLTMVNSPQDYN--------HC---VIACFGPYTAANTENLGLTVSIVSKNYRS  258

Query  131  FDGVVHALAHQWE  93
            F+G  +A+A+ + 
Sbjct  259  FEGFANAIANFFN  271



>ref|WP_019488651.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=265

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 35/195 (18%)
 Frame = -3

Query  650  ALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALG---DGEGRKKVLCPVPSV  480
            A+GKD ELL+ +  + +   PE     EP   +PTG++  L    D EG K +L P   V
Sbjct  97   AIGKDTELLE-ALGAEVDVIPE-----EP---SPTGIIRELAKISDIEG-KNILVPASEV  146

Query  479  IGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVR------RSGEECGIDA  318
            IG+ EP V+P F+  L K G    RV AY+TR    +   E+        R G+   +D 
Sbjct  147  IGIPEPDVIPNFIAGLEKLGMNVTRVTAYQTR----SLHKEIYNVELDLIRQGK---VDV  199

Query  317  MVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRF  138
            + FSS+ EV   L        D+++        ++A  GP T + A +LG+ + +++  F
Sbjct  200  IAFSSSAEVSAFLNMCDVS--DYQSA-------LIACFGPYTGANARKLGLNVSIIADDF  250

Query  137  DSFDGVVHALAHQWE  93
             SFDG   A+A  + 
Sbjct  251  SSFDGFAAAIASHFN  265



>gb|KIE11515.1| uroporphyrinogen III synthase [Tolypothrix bouteillei VB521301]
Length=274

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 81/167 (49%), Gaps = 25/167 (15%)
 Frame = -3

Query  566  PRIATPTGLVEALGD--GEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY  393
            P   +P G++  L       ++ VL PVP V+G+ EP VVP F+  L + G    RV  Y
Sbjct  119  PTEPSPAGIIAELAKIPNIAKQTVLVPVPEVLGVPEPDVVPNFVAGLKQLGMNVTRVPTY  178

Query  392  ETRWGGPACAAEVVR-------RSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRR  234
             TR     C  + +        R G+   +DA+ FSST E+ G LK +     D++    
Sbjct  179  MTR-----CLEKTIYEVELSLVRQGK---VDAIAFSSTAEIMGFLKMIHSKS-DYK----  225

Query  233  MCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQWE  93
                 V+A  GP TA+ AE+LG  + VV+  + SF G   A+A  + 
Sbjct  226  ---NCVIACFGPYTAANAEKLGFKVSVVAKDYSSFAGFTDAIASFFN  269



>ref|WP_041639822.1| uroporphyrinogen III synthase [Trichormus azollae]
Length=288

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 90/189 (48%), Gaps = 26/189 (14%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD E L  S   R+   PE     EP   +P G+V  L        + VL P P 
Sbjct  114  LCALGKDTESLL-SLCGRVDLIPE-----EP---SPAGIVAELSKIPNIHYQTVLVPTPE  164

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAA---EVVRRSGEECGIDAMV  312
            V+GL EP ++P  + DL K G    R++ Y T+       A    ++R+      ID + 
Sbjct  165  VVGLPEPNIIPNLINDLHKLGMQVTRLSTYMTQCIDKNIYAVELNLIRQG----MIDIIA  220

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            FSST EVE  ++       D+E         ++A  GP TA+  + LG+ + +VS+ + S
Sbjct  221  FSSTAEVESFIRMFDSRS-DYENS-------IIACFGPYTATNVQDLGLNVSIVSNDYSS  272

Query  131  FDGVVHALA  105
            F G   A+A
Sbjct  273  FAGFTAAMA  281



>gb|ADI64133.1| Uroporphyrinogen III synthase HEM4 ['Nostoc azollae' 0708]
Length=281

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 90/189 (48%), Gaps = 26/189 (14%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGD--GEGRKKVLCPVPS  483
            + ALGKD E L  S   R+   PE     EP   +P G+V  L        + VL P P 
Sbjct  107  LCALGKDTESLL-SLCGRVDLIPE-----EP---SPAGIVAELSKIPNIHYQTVLVPTPE  157

Query  482  VIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAA---EVVRRSGEECGIDAMV  312
            V+GL EP ++P  + DL K G    R++ Y T+       A    ++R+      ID + 
Sbjct  158  VVGLPEPNIIPNLINDLHKLGMQVTRLSTYMTQCIDKNIYAVELNLIRQG----MIDIIA  213

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            FSST EVE  ++       D+E         ++A  GP TA+  + LG+ + +VS+ + S
Sbjct  214  FSSTAEVESFIRMFDSRS-DYENS-------IIACFGPYTATNVQDLGLNVSIVSNDYSS  265

Query  131  FDGVVHALA  105
            F G   A+A
Sbjct  266  FAGFTAAMA  274



>ref|WP_033364936.1| uroporphyrinogen III synthase [Mastigocladopsis repens]
Length=279

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 75/156 (48%), Gaps = 11/156 (7%)
 Frame = -3

Query  566  PRIATPTGLVEALGD--GEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY  393
            P+  +P G++  L       +K VL PVP  + L EP V+P+F+  L K G    RV  Y
Sbjct  119  PKEPSPAGIIAELAKIPDIAKKSVLVPVPEFVDLPEPDVIPSFIAGLEKLGMKVTRVPTY  178

Query  392  ETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVV  213
             TR        EV      +  ID + FSST E+ G L+ +          +R     V+
Sbjct  179  RTRCLDKNI-YEVELNLIRQGNIDVIAFSSTAEIAGFLQMVNS--------KRDYEHCVI  229

Query  212  AAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALA  105
               GP TA+ A++LG+ + +V+  + SF G   A+A
Sbjct  230  GCFGPYTAANAQKLGLKVSIVAQDYSSFAGFADAIA  265



>ref|WP_036862652.1| uroporphyrinogen-III synthase [Prevotella melaninogenica]
 gb|KGF52851.1| uroporphyrinogen-III synthase [Prevotella melaninogenica DNF00666]
Length=264

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 91/200 (46%), Gaps = 39/200 (20%)
 Frame = -3

Query  650  ALGKDLELLDD------SFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVL  498
            A+GKD E L D       FIS+           EP   +P G+  AL   G  EG  ++ 
Sbjct  88   AIGKDNEYLHDVLGVTPPFISK-----------EP---SPIGIAHALKERGLNEG-CRLA  132

Query  497  CPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGE-----E  333
               P+ +G+EEP  VP F+  L++ G    RV+AY         A E+  R        +
Sbjct  133  ALAPAFVGIEEPRTVPDFMAKLSELGVQTHRVDAYVNM------ATELFARKQAYDLIID  186

Query  332  CGIDAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGID  156
              ID + F+S  EV      LRE YG D   + +    + +A  GP TA  A+R+G+ +D
Sbjct  187  KRIDCVAFTSGSEVMAFNDGLREVYGTDACCILK---DVAIACMGPYTAMQAKRIGLKVD  243

Query  155  VVSSRFDSFDGVVHALAHQW  96
             V + F+SFD     L   W
Sbjct  244  WVPAEFNSFDDFTACLVEHW  263



>ref|WP_004349974.1| hypothetical protein [Prevotella buccalis]
 gb|EFA91657.1| hypothetical protein HMPREF0650_0684 [Prevotella buccalis ATCC 
35310]
Length=264

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 90/198 (45%), Gaps = 35/198 (18%)
 Frame = -3

Query  650  ALGKDLELLDD------SFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVL  498
            A+GKD E L D       FIS+           EP   +P G+  AL   G  EG  ++ 
Sbjct  88   AIGKDNEYLHDVLGVTPPFISK-----------EP---SPIGIAHALKEHGLNEG-CRLA  132

Query  497  CPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY---ETRWGGPACAAEVVRRSGEECG  327
               P+ +G+EEP  VP F+  L++ G    RV+AY    T       A +++        
Sbjct  133  ALAPAFVGIEEPRTVPDFMAKLSELGVQAHRVDAYVNMATELSARKQAYDLIIDKR----  188

Query  326  IDAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVV  150
            ID + F+S  EV      LRE YG D   +      + +A  GP TA  A+R+G+ +D V
Sbjct  189  IDCVAFTSGSEVMAFNDGLREVYGTDACCILN---DVAIACMGPYTAMQAKRIGLKVDWV  245

Query  149  SSRFDSFDGVVHALAHQW  96
             S F+SFD     L   W
Sbjct  246  PSEFNSFDDFTACLVMHW  263



>ref|WP_036872440.1| uroporphyrinogen-III synthase [Prevotella buccalis]
 gb|KGF35076.1| uroporphyrinogen-III synthase [Prevotella buccalis DNF00853]
Length=264

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 90/198 (45%), Gaps = 35/198 (18%)
 Frame = -3

Query  650  ALGKDLELLDD------SFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVL  498
            A+GKD E L D       FIS+           EP   +P G+  AL   G  EG  ++ 
Sbjct  88   AIGKDNEYLHDVLGVTPPFISK-----------EP---SPIGIAHALKEHGLNEG-CRLA  132

Query  497  CPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY---ETRWGGPACAAEVVRRSGEECG  327
               P+ +G+EEP  VP F+  L++ G    RV+AY    T       A +++        
Sbjct  133  ALAPAFVGMEEPRTVPDFMAKLSELGVQAHRVDAYVNMATELSARKQAYDLIIDKR----  188

Query  326  IDAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVV  150
            ID + F+S  EV      LRE YG D   +      + +A  GP TA  A+R+G+ +D V
Sbjct  189  IDCVAFTSGSEVMAFNDGLREVYGTDACCILN---DVAIACMGPYTAMQAKRIGLKVDWV  245

Query  149  SSRFDSFDGVVHALAHQW  96
             + F+SFD     L   W
Sbjct  246  PAEFNSFDDFTACLVKHW  263



>dbj|GAK35804.1| uroporphyrinogen-III synthase [Bacteroides graminisolvens DSM 
19988 = JCM 15093]
Length=248

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 94/201 (47%), Gaps = 39/201 (19%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALG---DGEGRKKVLCP  492
            + + A+GKD E L            E   V+ P  A+P G+V  L    D  G K++   
Sbjct  70   ITLCAIGKDAEYLKKEL--------EISDVLLPDEASPMGIVAKLKTRPDISG-KRIAVL  120

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACA---------AEVVRRSG  339
             P V  + EP VVP F+R L        R++AY T      CA         AE++R   
Sbjct  121  APWVKDIPEPDVVPDFMRALEAIQMQVTRIDAYTT------CASEENIQNRFAELIRTKT  174

Query  338  EECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGI  159
              C    +VF+S  E+E  L++ +++ L  ++       L +A  GP TA+ A + G+ +
Sbjct  175  ASC----LVFTSGAEIEVALQTCKKHHLSTDS-------LEIACFGPYTAAYARKKGLKV  223

Query  158  DVVSSRFDSFDGVVHALAHQW  96
             +V+  F +F G+  A+ HQ+
Sbjct  224  SIVAQDFSAFTGLATAI-HQY  243



>ref|WP_034781563.1| hypothetical protein [Bacteroides graminisolvens]
Length=258

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 94/201 (47%), Gaps = 39/201 (19%)
 Frame = -3

Query  662  LVISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALG---DGEGRKKVLCP  492
            + + A+GKD E L            E   V+ P  A+P G+V  L    D  G K++   
Sbjct  80   ITLCAIGKDAEYLKKEL--------EISDVLLPDEASPMGIVAKLKTRPDISG-KRIAVL  130

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACA---------AEVVRRSG  339
             P V  + EP VVP F+R L        R++AY T      CA         AE++R   
Sbjct  131  APWVKDIPEPDVVPDFMRALEAIQMQVTRIDAYTT------CASEENIQNRFAELIRTKT  184

Query  338  EECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGI  159
              C    +VF+S  E+E  L++ +++ L  ++       L +A  GP TA+ A + G+ +
Sbjct  185  ASC----LVFTSGAEIEVALQTCKKHHLSTDS-------LEIACFGPYTAAYARKKGLKV  233

Query  158  DVVSSRFDSFDGVVHALAHQW  96
             +V+  F +F G+  A+ HQ+
Sbjct  234  SIVAQDFSAFTGLATAI-HQY  253



>ref|WP_023058085.1| MULTISPECIES: uroporphyrinogen-III synthase [Prevotella]
 gb|ERT58571.1| uroporphyrinogen-III synthase [Prevotella sp. BV3P1]
 gb|KGF38661.1| uroporphyrinogen-III synthase [Prevotella buccalis DNF00985]
Length=264

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 90/198 (45%), Gaps = 35/198 (18%)
 Frame = -3

Query  650  ALGKDLELLDD------SFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVL  498
            A+GKD E L D       FIS+           EP   +P G+  AL   G  EG  ++ 
Sbjct  88   AIGKDNEYLHDVLGVTPPFISK-----------EP---SPIGIAHALKEHGINEG-CRLA  132

Query  497  CPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY---ETRWGGPACAAEVVRRSGEECG  327
               P+ +G+EEP  VP F+  L++ G    RV+AY    T       A +++        
Sbjct  133  ALAPAFVGMEEPRTVPDFMAKLSELGVQAHRVDAYVNMATELSARKQAYDLIIDKR----  188

Query  326  IDAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVV  150
            ID + F+S  EV      L+E YG D   +      + +A  GP TA  A+R+G+ +D V
Sbjct  189  IDCVAFTSGSEVMAFNDGLKEVYGTDACCILN---DVAIACMGPYTAMQAKRIGLKVDWV  245

Query  149  SSRFDSFDGVVHALAHQW  96
             + F+SFD     L   W
Sbjct  246  PAEFNSFDDFTACLVKHW  263



>ref|WP_013325371.1| uroporphyrinogen III synthase [Cyanothece sp. PCC 7822]
 gb|ADN17333.1| Uroporphyrinogen III synthase HEM4 [Cyanothece sp. PCC 7822]
Length=286

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 79/159 (50%), Gaps = 17/159 (11%)
 Frame = -3

Query  566  PRIATPTGLVEALGDGEGR--KKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY  393
            P+ ++P G+V  L        +++L PVP V+G+ EP ++P F++ L +      RV AY
Sbjct  123  PQESSPQGIVNELAKMPNLLGQEILVPVPEVVGITEPDIIPNFVQSLEQLKLKVQRVPAY  182

Query  392  ET---RWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPG  222
            +T        A   E++  +G+   ID + FSS+ EVE  L+        W    +    
Sbjct  183  KTCGLDQKLYAVELELI-HTGK---IDVIAFSSSAEVEAFLQ--------WVDSPKALAA  230

Query  221  LVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALA  105
             + A  GP TA  A +LG+   +V+  + S+ G V A+A
Sbjct  231  TIPACFGPYTAKNAAKLGIIPAIVAQDYRSYAGFVKAIA  269



>ref|WP_036929938.1| uroporphyrinogen-III synthase [Prevotella timonensis]
 gb|KGI20836.1| uroporphyrinogen-III synthase [Prevotella timonensis S9-PR14]
Length=264

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 93/193 (48%), Gaps = 33/193 (17%)
 Frame = -3

Query  650  ALGKDLELLDDSFISRICENPERIRVVEPRIA---TPTGLVEALGDGEGRKK---VLCPV  489
            A+GKD + L D           ++ V  P IA   +P G+ +AL +  G  K   ++   
Sbjct  88   AIGKDNDYLQD-----------KLGVTPPFIAEESSPLGIAQAL-EARGFTKGCRIVALS  135

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGE-----ECGI  324
            P+ + LEEP  VP F++ L +      R++AY         A+E+  R        +  I
Sbjct  136  PAFVDLEEPQTVPVFIKRLKELNIDVQRIDAYVN------MASELSERKKAYDLIIDQQI  189

Query  323  DAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVS  147
              +VF+S  EV    + L E YG D ++V  +   + VA  GP TA+ A+ +G+ +D + 
Sbjct  190  STVVFTSGSEVVAFKEGLEEVYGTDADSVLEL---IDVACMGPYTAAQAKLIGLKVDKIP  246

Query  146  SRFDSFDGVVHAL  108
            ++F SFD +   L
Sbjct  247  TKFHSFDDLTAYL  259



>ref|WP_025072433.1| uroporphyrinogen-III synthase [Prevotella timonensis]
Length=264

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 92/193 (48%), Gaps = 33/193 (17%)
 Frame = -3

Query  650  ALGKDLELLDDSFISRICENPERIRVVEPRIA---TPTGLVEALGDGEGRKK---VLCPV  489
            A+GKD + L D           ++ V  P IA   +P G+ +AL +  G  K   ++   
Sbjct  88   AIGKDNDYLQD-----------KLGVTPPFIAEESSPLGIAQAL-EARGFTKGCRIVALS  135

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGE-----ECGI  324
            P+ + LEEP  VP F++ L +      R++AY         A+E+  R        +  I
Sbjct  136  PAFVDLEEPQTVPVFIKRLKELNIDVQRIDAYVN------MASELSERKKAYDLIIDQQI  189

Query  323  DAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVS  147
              +VF+S  EV    + L E YG D ++V  +   + VA  GP TA+ A  +G+ +D + 
Sbjct  190  STVVFTSGSEVVAFKEGLEEVYGTDADSVLEL---IDVACMGPYTAAQARLIGLKVDKIP  246

Query  146  SRFDSFDGVVHAL  108
            ++F SFD +   L
Sbjct  247  TKFHSFDDLTAYL  259



>ref|WP_035139400.1| uroporphyrinogen III synthase [Fischerella sp. PCC 9605]
Length=283

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 92/189 (49%), Gaps = 17/189 (9%)
 Frame = -3

Query  647  LGKDLELLDDSFISRICENPERIRV------VEPRIATPTGLVEALGDGEG--RKKVLCP  492
            LG D  LL +   S I ++ E++        + P+  +P G++  L        K +L P
Sbjct  86   LGLDPWLLKNCCFSAIGKDAEQLAAFGVKVDLIPQQPSPEGIIAELAKIPDIREKTILVP  145

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            VP V+G+ EP ++P F+  L K G    RV  Y TR     C  EV  R   +  ID + 
Sbjct  146  VPEVVGVPEPDIIPNFVASLEKLGMSVTRVPTYMTRRLD-KCFYEVELRLIRQGNIDVIA  204

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            FSST EV G L+ +     D+E          +A  GP TA+ A++LG+ + +V+  + S
Sbjct  205  FSSTAEVAGFLQMVSSKE-DYEQC-------AIACFGPYTATNAKKLGLNVSIVAKDYSS  256

Query  131  FDGVVHALA  105
            F G   A+A
Sbjct  257  FAGFAEAIA  265



>ref|WP_008122707.1| uroporphyrinogen-III synthase [Prevotella timonensis]
 gb|EFA98199.1| putative uroporphyrinogen-III synthase [Prevotella timonensis 
CRIS 5C-B1]
Length=264

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 91/193 (47%), Gaps = 33/193 (17%)
 Frame = -3

Query  650  ALGKDLELLDDSFISRICENPERIRVVEPRIA---TPTGLVEALGDGEGRKK---VLCPV  489
            A+GKD + L D           ++ V  P IA   +P G+ +AL +  G  K   +    
Sbjct  88   AIGKDNDYLQD-----------KLGVTPPFIAEESSPLGIAQAL-EARGFTKGCRIAALS  135

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGE-----ECGI  324
            P+ + LEEP  VP F++ L +      R++AY         A+E+  R        +  I
Sbjct  136  PAFVDLEEPQTVPVFIKRLKELNIDVQRIDAYVN------MASELSERKKAYDLIIDQQI  189

Query  323  DAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVS  147
              +VF+S  EV    + L E YG D ++V  +   + VA  GP TA+ A  +G+ +D + 
Sbjct  190  STVVFTSGSEVVAFKEGLEEVYGTDADSVLEL---IDVACMGPYTAAQARLIGLKVDKIP  246

Query  146  SRFDSFDGVVHAL  108
            ++F SFD +   L
Sbjct  247  TKFHSFDDLTAYL  259



>ref|XP_003871736.1| hypothetical protein LMXM_03_0680 [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ23201.1| hypothetical protein LMXM_03_0680 [Leishmania mexicana MHOM/GT/2001/U1103]
Length=286

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 85/190 (45%), Gaps = 23/190 (12%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVLCPVP  486
            ++A+GKD     D  + R+C  P    V+ P   +P G+   L   G  EGR  +    P
Sbjct  114  LAAIGKDA----DYVLERLCIRP----VICPDEPSPAGIAAKLAESGRAEGRT-IAVLAP  164

Query  485  SVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFS  306
             V G  EP VVP F+  L   G   VRV+AY TR  G   A      +     + ++ F+
Sbjct  165  CVEGFAEPDVVPRFVDQLKGMGMRVVRVDAYVTRPVGEE-AVSAAVAALTNGSVRSVAFT  223

Query  305  STGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFD  126
            S GE+  LL+   +  ++ +          VA  GP TA  A + G+ +  V+  F SFD
Sbjct  224  SAGEIAVLLRRSPQCLMNID----------VACFGPYTAGFAAKHGIKVSCVAKDFGSFD  273

Query  125  GVVHALAHQW  96
            G    +   +
Sbjct  274  GFAATIEQHF  283



>ref|WP_013548302.1| hypothetical protein [Bacteroides helcogenes]
 gb|ADV44715.1| hypothetical protein Bache_2772 [Bacteroides helcogenes P 36-108]
Length=272

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 85/190 (45%), Gaps = 15/190 (8%)
 Frame = -3

Query  650  ALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGR--KKVLCPVPSVI  477
            A+GKD E L++     +  +P  I    P   +P G+V       G   K+V    P V 
Sbjct  96   AIGKDNEFLEEC----LGIHPSFI----PDEPSPAGIVRKFSKIAGIEGKRVAVLAPLVT  147

Query  476  GLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSSTG  297
            G+EEP  VP F++ L   G V  R+ AY TR    +   ++ +          + FSS  
Sbjct  148  GMEEPDTVPLFMKALHDIGMVADRIPAYITRATIHSKQKQIHQLILSR-HFRCIAFSSGA  206

Query  296  EVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVV  117
            E++ LL+SL       E++     G+ +A  GP TA  A + G+ + + +  F SF G  
Sbjct  207  EIKALLESLS----PEESITDFFFGIDIACFGPYTADYARKQGLPVCLTAKDFSSFHGFA  262

Query  116  HALAHQWECL  87
              L   +  L
Sbjct  263  LILEDFYTSL  272



>gb|EGJ71981.1| Uroporphyrinogen III synthase HEM4 [Bacteroides coprosuis DSM 
18011]
Length=291

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 79/164 (48%), Gaps = 12/164 (7%)
 Frame = -3

Query  578  RVVEPRIATPTGLVEALGDGEGR--KKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVR  405
             ++ P   +P G+   L   E    K +   VP V  ++EP VVP F+  L K G   +R
Sbjct  136  HIIVPSEPSPAGIANELAKQENIQGKTIAVWVPRVEEIKEPYVVPDFMDRLEKIGLKVIR  195

Query  404  VNAYETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCP  225
               Y TR    +   +VV ++ +   +  + F+S+ E++ LLK+ +         + +  
Sbjct  196  NEVYITRPARQSNLNDVV-QNIQAGKVQCIAFTSSAEIDVLLKAYQ---------KPLPE  245

Query  224  GLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQWE  93
             LV+A  GP T + A+  G+ + + ++ F SF G V A+   ++
Sbjct  246  ELVIACFGPYTTAFAQEKGLHVAITATNFSSFLGFVEAIEAYYD  289



>ref|WP_040310401.1| hypothetical protein, partial [Bacteroides coprosuis]
Length=256

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 78/163 (48%), Gaps = 12/163 (7%)
 Frame = -3

Query  578  RVVEPRIATPTGLVEALGDGEGR--KKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVR  405
             ++ P   +P G+   L   E    K +   VP V  ++EP VVP F+  L K G   +R
Sbjct  104  HIIVPSEPSPAGIANELAKQENIQGKTIAVWVPRVEEIKEPYVVPDFMDRLEKIGLKVIR  163

Query  404  VNAYETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCP  225
               Y TR    +   +VV ++ +   +  + F+S+ E++ LLK+ +         + +  
Sbjct  164  NEVYITRPARQSNLNDVV-QNIQAGKVQCIAFTSSAEIDVLLKAYQ---------KPLPE  213

Query  224  GLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQW  96
             LV+A  GP T + A+  G+ + + ++ F SF G V A+   +
Sbjct  214  ELVIACFGPYTTAFAQEKGLHVAITATNFSSFLGFVEAIEAYY  256



>ref|XP_003721744.1| hypothetical protein LMJF_03_0680 [Leishmania major strain Friedlin]
 emb|CBZ12030.1| hypothetical protein LMJF_03_0680 [Leishmania major strain Friedlin]
Length=286

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 85/192 (44%), Gaps = 27/192 (14%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEAL---GDGEGRKKVLCPVP  486
            ++A+GKD + + +    R    P+     EP   +P G+   L   G  EGR  +    P
Sbjct  114  LAAIGKDADYVFERLRIRTTICPD-----EP---SPAGIAAKLAESGRAEGRT-IAVLAP  164

Query  485  SVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETR--WGGPACAAEVVRRSGEECGIDAMV  312
             V G  EP VVP F+  L   G   VRV+AY TR        AA    ++G   G+    
Sbjct  165  CVEGFTEPDVVPRFVDQLKGMGMKVVRVDAYMTRPVSEEAVSAAVTALKNGSVRGV---A  221

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
            F+S GE+  LL+   +  ++ +          VA  GP TA  A + GV +  V+  F S
Sbjct  222  FTSAGEIAVLLRRSPQCLMNID----------VACFGPYTAGFAAKHGVKVSCVAKDFRS  271

Query  131  FDGVVHALAHQW  96
            FDG    +   +
Sbjct  272  FDGFAATIEQHY  283



>ref|XP_010701006.1| uroporphyrinogen III synthase-like protein [Leishmania panamensis]
 gb|AIN95298.1| uroporphyrinogen III synthase-like protein [Leishmania panamensis]
Length=285

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 76/172 (44%), Gaps = 22/172 (13%)
 Frame = -3

Query  587  ERIRV---VEPRIATPTGLVEALGDG---EGRKKVLCPVPSVIGLEEPPVVPAFLRDLAK  426
            ER+R+   + P   +P G+   L +G   EGR  +    P V G  EP VVP F+  L  
Sbjct  125  ERLRILPGICPDEPSPAGIAAKLAEGGRAEGRT-IAVLAPCVGGFAEPDVVPRFVDQLKG  183

Query  425  KGWVPVRVNAYETR--WGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLD  252
             G   VRV+AY TR        AA     SG    +  + F+S  E+  LL    +   +
Sbjct  184  MGMRVVRVDAYVTRPVSEEAVSAAVTALTSG---SVHCVAFTSASEISVLLSRSPQCLAN  240

Query  251  WETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQW  96
             +          VA  GP TA  A + GV +  V+  F SFDG   A+A  +
Sbjct  241  ID----------VACFGPYTAGFAAQHGVTVSCVAKDFSSFDGFAAAIAQHY  282



>ref|XP_001561648.1| hypothetical protein LBRM_03_0580 [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM36794.1| hypothetical protein LBRM_03_0580 [Leishmania braziliensis MHOM/BR/75/M2904]
Length=285

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 73/172 (42%), Gaps = 22/172 (13%)
 Frame = -3

Query  587  ERIRV---VEPRIATPTGLVEAL---GDGEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAK  426
            ER+R+   + P   +P G+   L   G  EGR  +    P V G  EP VVP F+  L  
Sbjct  125  ERLRILPGICPDEPSPAGIAAKLAESGRAEGRT-IAVLAPCVGGFAEPDVVPRFVNQLKG  183

Query  425  KGWVPVRVNAYETR--WGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLD  252
             G   VRV+AY TR        AA     SG    +  + F+S  E+  LL         
Sbjct  184  MGMRVVRVDAYVTRPVSEEAVSAAVTALTSG---SVHCVAFTSASEIAVLLSR-------  233

Query  251  WETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQW  96
                 R    + VA  GP TA  A   GV +  V+  F SFDG   A+A  +
Sbjct  234  ---SPRCLANIDVACFGPYTAGFAAEHGVTVSCVAKDFSSFDGFAAAIAQHY  282



>ref|WP_016872683.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=313

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 97/193 (50%), Gaps = 19/193 (10%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIRV--VE----PRIATPTGLVEALG---DGEGRKK  504
            + +LG +  +L +  +S I ++ ER+    VE    P+  +P G++  L    + +G KK
Sbjct  109  LESLGLNHRVLKNCRLSAIGKDAERLAAFGVEVDLIPQQPSPQGIIAELAQIPNIQG-KK  167

Query  503  VLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGI  324
            +L PVP V+G+ EP VVP F+  L   G    RV  Y TR    +   EV      +  +
Sbjct  168  ILVPVPEVVGVPEPDVVPNFVAGLKNLGMSVTRVPTYLTRCLDKSF-YEVELNLIRQGKV  226

Query  323  DAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSS  144
            D + FSST EV   L+       D++     C   V+A  GP TA+ A +LGV + +++ 
Sbjct  227  DVIAFSSTAEVASFLQMFTAKA-DYQ----QC---VIACFGPYTAANANKLGVNVSIIAQ  278

Query  143  RFDSFDGVVHALA  105
             + SF G   A+A
Sbjct  279  DYSSFAGFAEAIA  291



>ref|XP_010935672.1| PREDICTED: uncharacterized protein LOC105055540 [Elaeis guineensis]
Length=237

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 45/134 (34%)
 Frame = -3

Query  668  EILVISALGKDLELLDDS-FISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCP  492
            E   ++ LGKD ELL +  F+S++  N              TGLV  L DG GR+  LCP
Sbjct  87   EPFTVATLGKDAELLHEGGFLSQLHWNT-------------TGLVAVLRDGLGRR-ALCP  132

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMV  312
            +P  + L+E PV+P F  DL           A E+                    +D MV
Sbjct  133  MPIAVNLKESPVIPNFFWDLV----------ALES--------------------LDVMV  162

Query  311  FSSTGEVEGLLKSL  270
            F+S+ EVEGL+K L
Sbjct  163  FTSSTEVEGLMKGL  176



>gb|EEC76546.1| hypothetical protein OsI_14342 [Oryza sativa Indica Group]
Length=103

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = -3

Query  311  FSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDS  132
             S  GEVEGLLK L   G  W  +    P + VA  GPVT  G  RLG+ ++ V  RF S
Sbjct  4    ISLPGEVEGLLKGLDAVGWRWLQLHTRWPRMAVAMQGPVTVDGVRRLGIEVN-VGVRFSS  62

Query  131  FDGVVHAL  108
            F GV+ AL
Sbjct  63   FHGVLDAL  70



>ref|XP_001462798.1| hypothetical protein LINJ_03_0660 [Leishmania infantum JPCM5]
 ref|XP_003858031.1| hypothetical protein LDBPK_030660 [Leishmania donovani]
 emb|CAM60019.1| hypothetical protein LINJ_03_0660 [Leishmania infantum JPCM5]
 emb|CBZ31307.1| hypothetical protein LDBPK_030660 [Leishmania donovani]
Length=286

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 84/191 (44%), Gaps = 25/191 (13%)
 Frame = -3

Query  656  ISALGKDLELLDDSFISRICENPERIR-VVEPRIATPTGLVEAL---GDGEGRKKVLCPV  489
            ++A+GKD     D  + R+     RIR  + P   +P G+   L   G  EGR  +    
Sbjct  114  LAAIGKDA----DYVLERL-----RIRPAICPDEPSPAGIAAKLAESGRAEGRT-IAVLA  163

Query  488  PSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVF  309
            P V G  EP VVP F+  L   G   VRV+AY TR       +  V  + +   +  + F
Sbjct  164  PCVEGFAEPDVVPRFVDQLKGMGMKVVRVDAYVTRPVSEEAVSTAV-TALKNGSVRGVAF  222

Query  308  SSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSF  129
            +S GE+  LL+      ++ +          VA  GP TA  A + GV +  V+  F SF
Sbjct  223  ASAGEIAVLLRRSPRCLMNID----------VACFGPYTAGFAAKHGVKVSCVAKDFRSF  272

Query  128  DGVVHALAHQW  96
            DG    +   +
Sbjct  273  DGFAATIEQHY  283



>ref|WP_038315764.1| hypothetical protein, partial [cyanobacterium PCC 7702]
Length=294

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 96/195 (49%), Gaps = 21/195 (11%)
 Frame = -3

Query  647  LGKDLELLDDSFISRICENPERIRVVE------PRIATPTGLVEALG--DGEGRKKVLCP  492
            LG D  +L +  +  I  + ER+   E      P+ ++P G++  L    G G KKVL P
Sbjct  110  LGLDCRVLKNCRLIAIGNDAERLAAFEVKVDLVPQKSSPEGIIAELAKISGIGGKKVLVP  169

Query  491  VPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETR-WGGPACAAEV-VRRSGEECGIDA  318
            VP V+G+ +P V+P F+  L   G     V  Y T+         E+ + R G+   ID 
Sbjct  170  VPEVVGVPQPDVIPNFVTGLKNLGMNTTCVPVYRTQCLDKKLYGVELDLIRQGK---IDV  226

Query  317  MVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRF  138
            + FSST EV G L+ +     D++         V+A  GP TA  A++LGV + +V+  +
Sbjct  227  IAFSSTAEVAGFLQMVTSKA-DYQHC-------VIACFGPYTAVNAKKLGVNVAIVAKDY  278

Query  137  DSFDGVVHALAHQWE  93
             SF G   A+A  ++
Sbjct  279  SSFAGFAKAIALFFQ  293



>ref|WP_041041230.1| uroporphyrinogen III synthase [Tolypothrix campylonemoides]
 gb|KIJ74024.1| uroporphyrinogen III synthase [Tolypothrix campylonemoides VB511288]
Length=270

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 78/156 (50%), Gaps = 11/156 (7%)
 Frame = -3

Query  566  PRIATPTGLVEALGD--GEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY  393
            P   +P G++  L       ++ VL PVP V+G+ EP V+P F+  L K G    RV  Y
Sbjct  119  PTQPSPAGIITELAKIPNIAKQSVLVPVPEVVGVPEPDVIPNFIAGLEKLGMNVTRVPTY  178

Query  392  ETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVV  213
             TR        EV      +  ID + FSST EV G L     + LD ++  + C    +
Sbjct  179  RTRCLDKNI-YEVELNLIRQGKIDVIAFSSTVEVAGFL-----HMLDAKSDYQHC---AI  229

Query  212  AAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALA  105
            A  GP TA+ A++LG+ + +V+  + SF G   A+A
Sbjct  230  ACFGPYTAANAQKLGLNVSIVAQDYSSFAGFAEAIA  265



>gb|KIJ84751.1| uroporphyrinogen III synthase [Scytonema tolypothrichoides VB-61278]
Length=269

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 11/156 (7%)
 Frame = -3

Query  566  PRIATPTGLVEALGD--GEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY  393
            P+  +P G++  L       +K +L PVP V+G+ EP V+P F+  L   G    RV  Y
Sbjct  119  PKEPSPAGVIAELAKIPDIAQKNILVPVPEVVGVPEPDVIPNFVTGLENLGMKVTRVPTY  178

Query  392  ETRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVV  213
             TR        EV      +  I+ + FSST EV G L+ + +   D+E          +
Sbjct  179  RTRCLDKDI-YEVELNLIRQGKINVIAFSSTAEVTGFLQ-MVDSKRDYERC-------AI  229

Query  212  AAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALA  105
            A  GP TA+ A++LG+ + +V+  + SF G   AL+
Sbjct  230  ACFGPYTAANAKKLGLNVSIVAQDYSSFAGFAEALS  265



>ref|WP_036892598.1| uroporphyrinogen-III synthase, partial [Prevotella sp. S7-1-8]
Length=264

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 69/158 (44%), Gaps = 13/158 (8%)
 Frame = -3

Query  554  TPTGLVEALG--DGEGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAY---E  390
            +P G+ + L   D    K+V    P+  G+EEP  VP FL +L + G    R  AY    
Sbjct  112  SPMGIAKELERRDMARGKRVAVVGPAFKGMEEPRTVPDFLDELERLGAKTKRFGAYLNMP  171

Query  389  TRWGGPACAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLRE-YGLDWETVRRMCPGLVV  213
            T       A E+++       +  + F+S  EV      L+E YG D      +   L +
Sbjct  172  TELRLRKKAYELIKNKD----LTGIAFTSGSEVVAFSDGLKEVYGKD---AHNLLGELTL  224

Query  212  AAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHALAHQ  99
               GP TA  A   G+  D+VS+ F+SFD     LA  
Sbjct  225  CYLGPYTAKQANLTGLKTDIVSTCFNSFDDFTAYLAEN  262



>ref|WP_028898365.1| hypothetical protein [Prevotella sp. HUN102]
Length=271

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 79/189 (42%), Gaps = 12/189 (6%)
 Frame = -3

Query  653  SALGKDLELLDDSFISRICENPERIRVVEPRIATPTGLVEALGDGEGRKKVLCPVPSVIG  474
            +++GKD+E +  +        P      EP +      +E  G+  G K+V    P V G
Sbjct  95   ASIGKDVEYMKSAL-----NLPPCFANSEPSLMGIAKELEKTGNHIG-KRVAVLGPRVEG  148

Query  473  LEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPACAAEVVRRSGEECGIDAMVFSSTGE  294
            + EP  VP F+  L      P  ++ Y+T         +V  R      ID + F+S  E
Sbjct  149  IREPSTVPDFIASLRHIDTKPTFISVYKTCKANATALNKV--RHAITSKIDCVAFTSGAE  206

Query  293  VEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVH  114
             + + + L E GL     + M P L  A  GP TA  AE  G+ ID +S  F SF+    
Sbjct  207  AQ-VYRELME-GLPVNK-KEMKPTLT-ACFGPYTAKCAEEEGLQIDFISKDFGSFEAFAT  262

Query  113  ALAHQWECL  87
             L      L
Sbjct  263  NLKSYLSSL  271



>ref|WP_027845592.1| uroporphyrinogen III synthase [Mastigocoleus testarum]
Length=271

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 92/199 (46%), Gaps = 28/199 (14%)
 Frame = -3

Query  647  LGKDLELLDDSFISRICENPERIRV---------VEPRIATPTGLVEALGD--GEGRKKV  501
            LG +  +L ++ +  I ++ E++           +EP   +P+G++  L +      + +
Sbjct  86   LGVNFSVLKNNCLCAIGKDAEKLTALGLEVDLIPIEP---SPSGIIAELAEIPDIAEQSI  142

Query  500  LCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRW---GGPACAAEVVRRSGEEC  330
            L PVP V+ + EP VVP F+  L K G     +  Y+T            +++R+     
Sbjct  143  LVPVPEVVSVPEPDVVPNFIAGLKKLGMEVTPIPTYKTSCLDKNFYQVELDLIRQGK---  199

Query  329  GIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVV  150
             ID + FSST E+   L+        ++     C    +A  GP TAS A +LG+ + +V
Sbjct  200  -IDLIAFSSTAEIAAFLRM-------FDDCPDNCQNSAIACFGPYTASNARKLGLKVSIV  251

Query  149  SSRFDSFDGVVHALAHQWE  93
            +  + SF G   A+A  ++
Sbjct  252  AEDYSSFAGFAQAIAKFYK  270



>ref|WP_035300941.1| uroporphyrinogen-III synthase [Brevibacillus thermoruber]
Length=263

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 12/112 (11%)
 Frame = -3

Query  437  DLAKKGWVPVRVNAYETRWGGPAC--AAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLRE  264
            +L + G     V+AYET   G     AAE +RR GE   IDA+ F+S+  V+  ++ +  
Sbjct  149  ELRRMGLQVTEVDAYETVIDGEGAPEAAERLRR-GE---IDAIAFTSSSTVQHFMQVMAP  204

Query  263  YGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHAL  108
            YGLD      +   + +A  GPVTA  A+RLG+ +  V+  + + DG++ AL
Sbjct  205  YGLDG-----LLASVRIACIGPVTAETAKRLGLPVHAVAREY-TVDGLLQAL  250



>ref|WP_029097511.1| uroporphyrinogen-III synthase [Brevibacillus thermoruber]
Length=263

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 16/114 (14%)
 Frame = -3

Query  437  DLAKKGWVPVRVNAYETRWGGPAC--AAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLRE  264
            +L + G     V+AYET   G     AAE +RR GE   IDA+ F+S+  V+  ++ +  
Sbjct  149  ELRRMGLQVTEVDAYETVIDGEGAPEAAERLRR-GE---IDAIAFTSSSTVQHFMQVMAP  204

Query  263  YGLD--WETVRRMCPGLVVAAHGPVTASGAERLGVGIDVVSSRFDSFDGVVHAL  108
            YGLD    +VR +C        GPVTA  A+RLG+ +  V+  + + DG++ AL
Sbjct  205  YGLDGLLVSVRIVCI-------GPVTAETAKRLGLPVHAVAREY-TVDGLLQAL  250



>ref|WP_031410705.1| HemD protein [Brevibacillus laterosporus]
Length=502

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 73/147 (50%), Gaps = 16/147 (11%)
 Frame = -3

Query  545  GLVEALGDG-EGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPA  369
            GLVE+L D  +   KVL P    I  E  P      R+L   G     V+ Y+T      
Sbjct  368  GLVESLKDELQPGSKVLLPRAD-IARETLP------RELRTLGMEVTEVDTYDTVIDAQN  420

Query  368  CAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTA  189
                V     EE  I  + F+S+  V+  +++L+EY L      ++  G+ +A  GP+TA
Sbjct  421  IGETVSLL--EEKAIQIITFTSSSTVKNFVEALKEYDLT-----QLLQGVQIACIGPITA  473

Query  188  SGAERLGVGIDVVSSRFDSFDGVVHAL  108
              A + G+ +D+++S + + +G+V+AL
Sbjct  474  DTARQAGLQVDIMASEY-TIEGLVNAL  499



>ref|WP_003338854.1| uroporphyrin-III C-methyltransferase [Brevibacillus laterosporus]
 emb|CCF12138.1| uroporphyrin-III C-methyltransferase [Brevibacillus laterosporus 
GI-9]
Length=502

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 73/147 (50%), Gaps = 16/147 (11%)
 Frame = -3

Query  545  GLVEALGDG-EGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPA  369
            GLVE+L D  +   KVL P    I  E  P      R+L   G     V+ Y+T      
Sbjct  368  GLVESLKDELQPGSKVLLPRAD-IARETLP------RELRTLGMEVTEVDTYDTVIDAQN  420

Query  368  CAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTA  189
                V     EE  I  + F+S+  V+  +++L+EY L      ++  G+ +A  GP+TA
Sbjct  421  IGETVSLL--EEKAIQIITFTSSSTVKNFVEALKEYDLT-----QLLQGVQIACIGPITA  473

Query  188  SGAERLGVGIDVVSSRFDSFDGVVHAL  108
              A + G+ +D+++S + + +G+V+AL
Sbjct  474  DTARQAGLQVDIMASEY-TIEGLVNAL  499



>ref|WP_018672773.1| porphyrin biosynthesis protein HemD [Brevibacillus laterosporus]
Length=502

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 73/147 (50%), Gaps = 16/147 (11%)
 Frame = -3

Query  545  GLVEALGDG-EGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPA  369
            GLVE+L D  +   KVL P    I  E  P      R+L   G     V+ Y+T      
Sbjct  368  GLVESLKDELQPGSKVLLPRAD-IARETLP------RELRTLGMEVTEVDTYDTVIDAQN  420

Query  368  CAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTA  189
                V     EE  I  + F+S+  V+  +++L+EY L      ++  G+ +A  GP+TA
Sbjct  421  IGETVSLL--EEKAIQIITFTSSSTVKNFVEALKEYDLT-----QLLQGVQIACIGPITA  473

Query  188  SGAERLGVGIDVVSSRFDSFDGVVHAL  108
              A + G+ +D+++S + + +G+V+AL
Sbjct  474  DTARQAGLQVDIMASEY-TIEGLVNAL  499



>ref|WP_003334882.1| uroporphyrinogen-III C-methyltransferase [Brevibacillus laterosporus]
 gb|ERM19923.1| porphyrin biosynthesis protein HemD [Brevibacillus laterosporus 
PE36]
 gb|AIG25565.1| uroporphyrinogen-III C-methyltransferase [Brevibacillus laterosporus 
LMG 15441]
Length=502

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 73/147 (50%), Gaps = 16/147 (11%)
 Frame = -3

Query  545  GLVEALGDG-EGRKKVLCPVPSVIGLEEPPVVPAFLRDLAKKGWVPVRVNAYETRWGGPA  369
            GLVE+L D  +   KVL P    I  E  P      R+L   G     V+ Y+T      
Sbjct  368  GLVESLKDELQPGSKVLLPRAD-IARETLP------RELRTLGMEVTEVDTYDTVIDAQN  420

Query  368  CAAEVVRRSGEECGIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTA  189
                V     EE  I  + F+S+  V+  +++L+EY L      ++  G+ +A  GP+TA
Sbjct  421  IGETVSLL--EEKAIQIITFTSSSTVKNFVEALKEYDLT-----QLLQGVQIACIGPITA  473

Query  188  SGAERLGVGIDVVSSRFDSFDGVVHAL  108
              A + G+ +D+++S + + +G+V+AL
Sbjct  474  DTARQAGLQVDIMASEY-TIEGLVNAL  499



>ref|WP_025746037.1| HemD protein [bacterium JKG1]
Length=524

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  329  GIDAMVFSSTGEVEGLLKSLREYGLDWETVRRMCPGLVVAAHGPVTASGAERLGVGIDVV  150
             IDA+ F+S+  V   L+ L   G+  +  RR+    VVAA GP+TA  A   G+ + VV
Sbjct  440  AIDAITFTSSSTVSNFLERLARSGVTPDEARRLLAAPVVAAIGPITARRAREAGLPVTVV  499

Query  149  SSRFDSFDGVVHAL  108
            + R+ + DG+V AL
Sbjct  500  AERY-TLDGLVEAL  512



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600