BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF050B05

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFW63178.1|  putative DEAD-box ATP-dependent RNA helicase fami...    131   2e-34   
ref|NP_001132565.1|  uncharacterized protein LOC100194030               128   2e-33   
gb|EPS59687.1|  hypothetical protein M569_15121                         127   2e-33   Genlisea aurea
gb|ADV04059.1|  DEAD/DEAH box helicase 8                                130   4e-33   Hevea brasiliensis [jebe]
gb|ACG29146.1|  ATP-dependent RNA helicase dhh1                         133   9e-33   Zea mays [maize]
ref|NP_001148960.1|  ATP-dependent RNA helicase dhh1                    133   9e-33   
ref|XP_008376043.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   1e-32   
ref|XP_002320116.2|  hypothetical protein POPTR_0014s07690g             133   1e-32   
ref|XP_008339750.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   1e-32   
ref|XP_011035912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   1e-32   Populus euphratica
ref|XP_011093152.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    132   1e-32   
ref|XP_011023369.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   2e-32   Populus euphratica
dbj|BAJ90747.1|  predicted protein                                      131   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT21717.1|  DEAD-box ATP-dependent RNA helicase 8                   131   2e-32   
ref|XP_004953257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   2e-32   Setaria italica
ref|XP_011091933.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    132   2e-32   Sesamum indicum [beniseed]
ref|XP_010544383.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_002987276.1|  hypothetical protein SELMODRAFT_158648             132   3e-32   
ref|XP_010540276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   3e-32   
sp|Q6H7S2.2|RH8_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA h...    130   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047552.1|  Os02g0641800                                       130   3e-32   
ref|XP_009611007.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   3e-32   Nicotiana tomentosiformis
ref|XP_009757253.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   3e-32   Nicotiana sylvestris
ref|XP_007051859.1|  RNAhelicase-like 8 isoform 2                       131   4e-32   
gb|ACL52527.1|  unknown                                                 130   4e-32   Zea mays [maize]
gb|KHG21931.1|  DEAD-box ATP-dependent RNA helicase 8                   131   4e-32   Gossypium arboreum [tree cotton]
ref|XP_006396262.1|  hypothetical protein EUTSA_v10028588mg             131   4e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009134538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    131   4e-32   Brassica rapa
ref|XP_010236834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   4e-32   
emb|CDX74342.1|  BnaA03g27050D                                          131   5e-32   
gb|KJB09834.1|  hypothetical protein B456_001G169800                    131   5e-32   Gossypium raimondii
ref|XP_010456256.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    131   5e-32   Camelina sativa [gold-of-pleasure]
dbj|BAH19526.1|  AT4G00660                                              131   5e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KHG12667.1|  DEAD-box ATP-dependent RNA helicase 8 -like protein     131   5e-32   Gossypium arboreum [tree cotton]
gb|KDP28654.1|  hypothetical protein JCGZ_14425                         131   5e-32   Jatropha curcas
gb|KHG21932.1|  DEAD-box ATP-dependent RNA helicase 8                   131   5e-32   Gossypium arboreum [tree cotton]
ref|XP_009111462.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   5e-32   Brassica rapa
emb|CDY51147.1|  BnaA09g51820D                                          129   5e-32   Brassica napus [oilseed rape]
ref|XP_006287568.1|  hypothetical protein CARUB_v10000779mg             131   5e-32   Capsella rubella
ref|XP_007051858.1|  RNAhelicase-like 8 isoform 1                       131   5e-32   
emb|CDP08841.1|  unnamed protein product                                130   6e-32   Coffea canephora [robusta coffee]
ref|XP_006445089.1|  hypothetical protein CICLE_v10019858mg             130   6e-32   Citrus clementina [clementine]
ref|XP_002511831.1|  dead box ATP-dependent RNA helicase, putative      130   6e-32   Ricinus communis
emb|CAA09199.1|  RNA helicase                                           130   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009340166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_002875020.1|  hypothetical protein ARALYDRAFT_490504             131   6e-32   
gb|KHF99913.1|  DEAD-box ATP-dependent RNA helicase 8                   130   6e-32   Gossypium arboreum [tree cotton]
gb|KGN56528.1|  Dead box ATP-dependent RNA helicase                     130   6e-32   Cucumis sativus [cucumbers]
emb|CDX91901.1|  BnaC03g32030D                                          130   6e-32   
ref|XP_010053686.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   6e-32   Eucalyptus grandis [rose gum]
gb|KJB41288.1|  hypothetical protein B456_007G097600                    130   6e-32   Gossypium raimondii
gb|KJB22343.1|  hypothetical protein B456_004G042200                    130   6e-32   Gossypium raimondii
ref|XP_008438061.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   6e-32   Cucumis melo [Oriental melon]
ref|XP_004306806.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   6e-32   Fragaria vesca subsp. vesca
ref|NP_191975.2|  DEAD-box ATP-dependent RNA helicase 8                 130   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007220665.1|  hypothetical protein PRUPE_ppa004633mg             130   7e-32   Prunus persica
ref|XP_006827696.1|  hypothetical protein AMTR_s00009p00258110          129   7e-32   Amborella trichopoda
ref|XP_010273108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008681228.1|  PREDICTED: uncharacterized protein LOC100194...    130   7e-32   
ref|XP_004133869.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   7e-32   Cucumis sativus [cucumbers]
emb|CBI40324.3|  unnamed protein product                                130   7e-32   Vitis vinifera
ref|XP_008681227.1|  PREDICTED: uncharacterized protein LOC100194...    130   7e-32   
gb|KJB22345.1|  hypothetical protein B456_004G042200                    130   7e-32   Gossypium raimondii
ref|XP_010105971.1|  DEAD-box ATP-dependent RNA helicase 8              130   7e-32   
ref|XP_007139882.1|  hypothetical protein PHAVU_008G066400g             130   7e-32   Phaseolus vulgaris [French bean]
ref|XP_002270379.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   7e-32   Vitis vinifera
ref|XP_004248580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   8e-32   Solanum lycopersicum
ref|XP_006652567.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    130   8e-32   Oryza brachyantha
gb|AAC13628.1|  similar to ATP-dependent RNA helicases                  130   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341720.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   8e-32   Solanum tuberosum [potatoes]
gb|KJB24711.1|  hypothetical protein B456_004G1574001                   130   8e-32   Gossypium raimondii
ref|XP_006587858.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   9e-32   
gb|EAY94957.1|  hypothetical protein OsI_16765                          129   9e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_002301349.1|  DEAD/DEAH box helicase family protein              130   1e-31   
gb|KHN29373.1|  DEAD-box ATP-dependent RNA helicase 8                   130   1e-31   Glycine soja [wild soybean]
ref|XP_006587857.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   1e-31   Glycine max [soybeans]
ref|XP_004976343.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   1e-31   Setaria italica
ref|XP_004240107.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   2e-31   Solanum lycopersicum
emb|CBI34696.3|  unnamed protein product                                129   2e-31   Vitis vinifera
ref|NP_001053408.1|  Os04g0533000                                       128   2e-31   
ref|XP_004510805.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   2e-31   Cicer arietinum [garbanzo]
ref|XP_010676491.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006345594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   2e-31   Solanum tuberosum [potatoes]
emb|CDY07205.1|  BnaCnng02200D                                          127   2e-31   
ref|XP_009794053.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   2e-31   Nicotiana sylvestris
ref|XP_001765911.1|  predicted protein                                  128   3e-31   
ref|XP_010255444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002271357.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   3e-31   Vitis vinifera
gb|EYU35077.1|  hypothetical protein MIMGU_mgv1a005045mg                128   3e-31   Erythranthe guttata [common monkey flower]
dbj|BAJ94923.1|  predicted protein                                      128   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_001766771.1|  predicted protein                                  128   4e-31   
gb|EMT23815.1|  DEAD-box ATP-dependent RNA helicase 6                   126   4e-31   
ref|XP_007135054.1|  hypothetical protein PHAVU_010G0977000g            128   4e-31   Phaseolus vulgaris [French bean]
ref|XP_009384494.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   4e-31   
ref|XP_003623900.1|  DEAD-box ATP-dependent RNA helicase                128   4e-31   Medicago truncatula
gb|EYU32082.1|  hypothetical protein MIMGU_mgv1a005052mg                130   4e-31   Erythranthe guttata [common monkey flower]
ref|XP_003623902.1|  DEAD-box ATP-dependent RNA helicase                128   5e-31   
ref|XP_007135053.1|  hypothetical protein PHAVU_010G0977000g            128   5e-31   Phaseolus vulgaris [French bean]
ref|XP_010671975.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   5e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006662493.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   5e-31   
ref|XP_004492712.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   5e-31   Cicer arietinum [garbanzo]
ref|XP_010940461.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   6e-31   Elaeis guineensis
gb|AES80120.2|  DEAD-box ATP-dependent RNA helicase-like protein        127   6e-31   Medicago truncatula
gb|KHN27312.1|  DEAD-box ATP-dependent RNA helicase 8                   127   6e-31   Glycine soja [wild soybean]
gb|KHN04659.1|  DEAD-box ATP-dependent RNA helicase 8                   127   7e-31   Glycine soja [wild soybean]
gb|KHN04661.1|  DEAD-box ATP-dependent RNA helicase 8                   127   7e-31   Glycine soja [wild soybean]
gb|EEC67267.1|  hypothetical protein OsI_34232                          124   7e-31   Oryza sativa Indica Group [Indian rice]
sp|Q109G2.2|RH12_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    124   7e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003623903.1|  DEAD-box ATP-dependent RNA helicase                127   7e-31   Medicago truncatula
ref|XP_003528863.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   7e-31   Glycine max [soybeans]
gb|KHN27313.1|  DEAD-box ATP-dependent RNA helicase 8                   127   8e-31   Glycine soja [wild soybean]
ref|XP_003521117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   8e-31   Glycine max [soybeans]
ref|XP_003528862.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   8e-31   Glycine max [soybeans]
ref|XP_006339542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   9e-31   Solanum tuberosum [potatoes]
ref|XP_006576347.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   9e-31   Glycine max [soybeans]
gb|ABG66172.1|  ATP-dependent RNA helicase ste13, putative, expre...    124   9e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDP09769.1|  unnamed protein product                                124   9e-31   Coffea canephora [robusta coffee]
ref|XP_006576348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   9e-31   
ref|XP_009389244.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004229903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    126   1e-30   Solanum lycopersicum
ref|XP_006583310.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    126   1e-30   
ref|XP_006848084.1|  hypothetical protein AMTR_s00029p00205680          126   1e-30   Amborella trichopoda
ref|XP_009408278.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    126   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16163.1|  unknown                                                 126   1e-30   Picea sitchensis
ref|XP_004982679.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    123   2e-30   
gb|EMS61023.1|  DEAD-box ATP-dependent RNA helicase 8                   127   2e-30   Triticum urartu
ref|NP_001150170.1|  ATP-dependent RNA helicase dhh1                    123   2e-30   
ref|XP_002464412.1|  hypothetical protein SORBIDRAFT_01g017760          123   2e-30   
ref|XP_002464413.1|  hypothetical protein SORBIDRAFT_01g017770          123   2e-30   Sorghum bicolor [broomcorn]
ref|NP_001140760.1|  putative DEAD-box ATP-dependent RNA helicase...    122   3e-30   Zea mays [maize]
ref|XP_008794179.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   3e-30   
emb|CDY54061.1|  BnaA02g36470D                                          125   3e-30   Brassica napus [oilseed rape]
ref|XP_010905111.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   3e-30   Elaeis guineensis
ref|XP_005831668.1|  hypothetical protein GUITHDRAFT_71963              127   3e-30   Guillardia theta CCMP2712
ref|XP_010908424.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   4e-30   Elaeis guineensis
ref|XP_008794547.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    124   5e-30   Phoenix dactylifera
ref|XP_005646927.1|  cytoplasmic DExD/H-box RNA helicase                124   5e-30   Coccomyxa subellipsoidea C-169
gb|EMT21677.1|  DEAD-box ATP-dependent RNA helicase 12                  122   5e-30   
gb|EYU29737.1|  hypothetical protein MIMGU_mgv1a005117mg                124   6e-30   Erythranthe guttata [common monkey flower]
emb|CDY48935.1|  BnaA09g39020D                                          120   6e-30   Brassica napus [oilseed rape]
ref|NP_001065000.2|  Os10g0503700                                       124   6e-30   
emb|CAA09203.1|  RNA helicase                                           120   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876600.1|  hypothetical protein ARALYDRAFT_486601             120   7e-30   
ref|XP_006290970.1|  hypothetical protein CARUB_v10017085mg             120   8e-30   Capsella rubella
ref|XP_009116788.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    120   8e-30   
ref|NP_191683.1|  DEAD-box ATP-dependent RNA helicase 12                120   8e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71756.1|  BnaC08g31180D                                          120   9e-30   
ref|XP_009104295.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   9e-30   Brassica rapa
ref|XP_010413440.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    120   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010469048.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010512458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   1e-29   Camelina sativa [gold-of-pleasure]
gb|KDD74992.1|  DEAD/DEAH box helicase                                  122   1e-29   Helicosporidium sp. ATCC 50920
ref|XP_008778709.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    123   1e-29   Phoenix dactylifera
ref|XP_005849570.1|  hypothetical protein CHLNCDRAFT_56077              125   1e-29   Chlorella variabilis
ref|XP_010513761.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   1e-29   Camelina sativa [gold-of-pleasure]
dbj|BAJ95381.1|  predicted protein                                      120   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006402503.1|  hypothetical protein EUTSA_v10005922mg             119   2e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010234885.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    120   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_009400273.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    122   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|GAC99235.1|  hypothetical protein PHSY_006835                       122   3e-29   Pseudozyma hubeiensis SY62
gb|KDO28289.1|  DEAD-box ATP-dependent RNA helicase 8                   123   3e-29   Saprolegnia parasitica CBS 223.65
ref|XP_008605548.1|  DEAD-box ATP-dependent RNA helicase 8              123   3e-29   Saprolegnia diclina VS20
ref|XP_008873462.1|  DEAD-box ATP-dependent RNA helicase 6              123   3e-29   Aphanomyces invadans
ref|XP_009829781.1|  DEAD-box ATP-dependent RNA helicase 8              123   3e-29   Aphanomyces astaci
ref|XP_002769152.1|  ATP-dependent RNA helicase, putative               120   4e-29   Perkinsus marinus ATCC 50983
gb|AAK63966.1|  At2g45810/F4I18.21                                      117   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182105.1|  DEAD-box ATP-dependent RNA helicase 6                 117   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880201.1|  hypothetical protein ARALYDRAFT_483719             117   6e-29   
ref|XP_002909411.1|  DEAD/DEAH box RNA helicase, putative               122   7e-29   Phytophthora infestans T30-4
gb|EJU02445.1|  DEAD-domain-containing protein                          119   8e-29   Dacryopinax primogenitus
ref|XP_009514016.1|  hypothetical protein PHYSODRAFT_283996             122   8e-29   Phytophthora sojae
ref|XP_010506559.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010518223.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006397768.1|  hypothetical protein EUTSA_v10001405mg             116   1e-28   
ref|XP_010508105.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   1e-28   Camelina sativa [gold-of-pleasure]
emb|CDY27357.1|  BnaC04g50480D                                          115   1e-28   Brassica napus [oilseed rape]
ref|XP_006294022.1|  hypothetical protein CARUB_v10023015mg             115   1e-28   Capsella rubella
emb|CAA09198.1|  RNA helicase                                           116   1e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37067.1|  BnaA04g26450D                                          116   1e-28   Brassica napus [oilseed rape]
ref|XP_006397771.1|  hypothetical protein EUTSA_v10001405mg             115   1e-28   
emb|CDY58787.1|  BnaA07g38020D                                          115   1e-28   Brassica napus [oilseed rape]
ref|XP_009142369.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   1e-28   Brassica rapa
ref|XP_005855068.1|  hypothetical protein NGA_0350100                   116   1e-28   Nannochloropsis gaditana CCMP526
ref|XP_002769153.1|  RNA helicase, putative                             122   2e-28   Perkinsus marinus ATCC 50983
ref|XP_002771414.1|  RNA helicase, putative                             122   2e-28   Perkinsus marinus ATCC 50983
emb|CDY45702.1|  BnaCnng13670D                                          117   2e-28   Brassica napus [oilseed rape]
ref|XP_002767329.1|  RNA helicase, putative                             122   2e-28   Perkinsus marinus ATCC 50983
ref|XP_002771413.1|  RNA helicase, putative                             122   2e-28   Perkinsus marinus ATCC 50983
ref|XP_002767330.1|  DEAD box ATP-dependent RNA helicase, putative      121   2e-28   Perkinsus marinus ATCC 50983
ref|XP_008913632.1|  DEAD-box ATP-dependent RNA helicase 8              120   2e-28   Phytophthora parasitica INRA-310
ref|XP_004336605.1|  atpdependent rna helicase ddx6, putative           121   3e-28   Acanthamoeba castellanii str. Neff
ref|XP_002164714.2|  PREDICTED: probable ATP-dependent RNA helica...    118   3e-28   Hydra vulgaris
emb|CCI48817.1|  unnamed protein product                                120   3e-28   Albugo candida
ref|XP_002473400.1|  eukaryotic translation initiation factor 4A-...    120   3e-28   
emb|CCL98213.1|  predicted protein                                      120   4e-28   Fibroporia radiculosa
emb|CCA22119.1|  predicted protein putative                             120   4e-28   Albugo laibachii Nc14
emb|CEP17217.1|  hypothetical protein                                   120   4e-28   Parasitella parasitica
ref|XP_003294872.1|  hypothetical protein DICPUDRAFT_93301              120   4e-28   Dictyostelium purpureum
ref|XP_008042303.1|  DEAD-domain-containing protein                     119   5e-28   Trametes versicolor FP-101664 SS1
ref|XP_629938.1|  hypothetical protein DDB_G0291804                     120   5e-28   Dictyostelium discoideum AX4
gb|KIJ36696.1|  hypothetical protein M422DRAFT_232268                   119   6e-28   Sphaerobolus stellatus SS14
ref|XP_007719915.1|  ATP-dependent RNA helicase DHH1                    119   6e-28   Capronia coronata CBS 617.96
ref|XP_011129036.1|  putative DEAD box ATP-dependent RNA helicase       120   6e-28   Gregarina niphandrodes
gb|KIO14251.1|  hypothetical protein M404DRAFT_12103                    119   6e-28   Pisolithus tinctorius Marx 270
ref|XP_001881258.1|  predicted protein                                  119   6e-28   Laccaria bicolor S238N-H82
gb|EMD35619.1|  hypothetical protein CERSUDRAFT_96734                   119   6e-28   Gelatoporia subvermispora B
ref|XP_007731184.1|  ATP-dependent RNA helicase DHH1                    119   6e-28   Capronia epimyces CBS 606.96
dbj|GAN04011.1|  eukaryotic translation initiation factor 4A-like...    119   6e-28   Mucor ambiguus
ref|XP_007272025.1|  DEAD-domain-containing protein                     119   7e-28   Fomitiporia mediterranea MF3/22
gb|EPB84122.1|  ATP-dependent RNA helicase DHH1                         119   7e-28   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007384334.1|  DEAD-domain-containing protein                     119   7e-28   Punctularia strigosozonata HHB-11173 SS5
ref|XP_001832628.1|  ATP-dependent RNA helicase dhh1                    119   7e-28   Coprinopsis cinerea okayama7#130
ref|XP_009268120.1|  ATP-dependent RNA helicase dhh1                    119   7e-28   Wallemia ichthyophaga EXF-994
ref|XP_007301961.1|  DEAD-domain-containing protein                     119   8e-28   Stereum hirsutum FP-91666 SS1
gb|KIM70603.1|  hypothetical protein SCLCIDRAFT_156787                  119   8e-28   Scleroderma citrinum Foug A
gb|KJA23157.1|  hypothetical protein HYPSUDRAFT_138278                  119   8e-28   Hypholoma sublateritium FD-334 SS-4
emb|CDO74578.1|  hypothetical protein BN946_scf184583.g5                119   8e-28   Trametes cinnabarina
gb|KIJ98785.1|  hypothetical protein K443DRAFT_194552                   119   9e-28   Laccaria amethystina LaAM-08-1
emb|CCO29368.1|  ATP-dependent RNA helicase DDX6/DHH1                   115   9e-28   Rhizoctonia solani AG-1 IB
gb|EHA20131.1|  hypothetical protein ASPNIDRAFT_209198                  117   9e-28   Aspergillus niger ATCC 1015
emb|CEI85652.1|  Putative DEAD/DEAH box helicase                        120   1e-27   Rhizopus microsporus
ref|XP_007331967.1|  hypothetical protein AGABI1DRAFT_115242            118   1e-27   Agaricus bisporus var. burnettii JB137-S8
emb|CEG81286.1|  Putative Atp-dependent rna helicase dhh1               120   1e-27   Rhizopus microsporus
ref|XP_007367461.1|  eukaryotic translation initiation factor 4A-...    118   1e-27   Dichomitus squalens LYAD-421 SS1
ref|XP_009549682.1|  hypothetical protein HETIRDRAFT_67389              119   1e-27   Heterobasidion irregulare TC 32-1
gb|KIW14976.1|  ATP-dependent RNA helicase DHH1                         119   1e-27   Exophiala spinifera
gb|KDQ58786.1|  hypothetical protein JAAARDRAFT_34642                   119   1e-27   Jaapia argillacea MUCL 33604
emb|CEG63343.1|  Putative Atp-dependent rna helicase dhh1               120   1e-27   Rhizopus microsporus
gb|EPS95261.1|  hypothetical protein FOMPIDRAFT_101552                  118   1e-27   Fomitopsis pinicola FP-58527 SS1
gb|KEQ91251.1|  hypothetical protein AUEXF2481DRAFT_70100               118   1e-27   Aureobasidium subglaciale EXF-2481
gb|EIE82813.1|  ATP-dependent RNA helicase dhh1                         120   1e-27   Rhizopus delemar RA 99-880
ref|XP_006463363.1|  hypothetical protein AGABI2DRAFT_194203            118   1e-27   Agaricus bisporus var. bisporus H97
gb|ESA01456.1|  hypothetical protein GLOINDRAFT_333744                  118   1e-27   
gb|KIV96660.1|  ATP-dependent RNA helicase DHH1                         118   1e-27   Exophiala mesophila
ref|XP_007869359.1|  eukaryotic translation initiation factor 4A-...    118   1e-27   Gloeophyllum trabeum ATCC 11539
gb|EPB90373.1|  ATP-dependent RNA helicase dhh1                         120   1e-27   Mucor circinelloides f. circinelloides 1006PhL
gb|KEQ69618.1|  DEAD-domain-containing protein                          118   1e-27   Aureobasidium namibiae CBS 147.97
ref|XP_009158872.1|  ATP-dependent RNA helicase dhh1                    118   1e-27   Exophiala dermatitidis NIH/UT8656
gb|KIV81870.1|  ATP-dependent RNA helicase dhh1                         118   1e-27   Exophiala sideris
ref|XP_003062040.1|  predicted protein                                  119   1e-27   Micromonas pusilla CCMP1545
ref|XP_002951166.1|  DEAD-box RNA helicase, ATP-dependent, cytopl...    119   1e-27   Volvox carteri f. nagariensis
gb|KIW61171.1|  ATP-dependent RNA helicase dhh1                         118   1e-27   Exophiala xenobiotica
gb|KEF62095.1|  ATP-dependent RNA helicase DHH1                         118   1e-27   Exophiala aquamarina CBS 119918
ref|XP_001692202.1|  cytoplasmic DExD/H-box RNA helicase                119   2e-27   Chlamydomonas reinhardtii
dbj|GAN00930.1|  conserved hypothetical protein                         119   2e-27   Mucor ambiguus
gb|KDR80281.1|  hypothetical protein GALMADRAFT_136789                  118   2e-27   Galerina marginata CBS 339.88
gb|KIK36386.1|  hypothetical protein CY34DRAFT_811305                   118   2e-27   Suillus luteus UH-Slu-Lm8-n1
gb|KIM91499.1|  hypothetical protein PILCRDRAFT_669                     118   2e-27   Piloderma croceum F 1598
gb|EST04933.1|  ATP-dependent RNA helicase                              118   2e-27   Kalmanozyma brasiliensis GHG001
gb|KII87922.1|  hypothetical protein PLICRDRAFT_54962                   118   2e-27   Plicaturopsis crispa FD-325 SS-3
dbj|GAM18218.1|  hypothetical protein SAMD00019534_013930               118   2e-27   Acytostelium subglobosum LB1
ref|XP_004350316.1|  putative RNA helicase                              118   2e-27   Cavenderia fasciculata
emb|CEJ02025.1|  Putative ATP-dependent RNA helicase DHH1               119   2e-27   Rhizopus microsporus
ref|XP_005710129.1|  unnamed protein product                            113   2e-27   Chondrus crispus [carageen]
gb|KFH66615.1|  ATP-dependent RNA helicase dhh1                         117   2e-27   Mortierella verticillata NRRL 6337
ref|XP_003027845.1|  hypothetical protein SCHCODRAFT_70659              117   2e-27   Schizophyllum commune H4-8
emb|CEG71520.1|  Putative ATP-dependent RNA helicase DHH1               119   2e-27   Rhizopus microsporus
emb|CEG82997.1|  Putative ATP-dependent RNA helicase DHH1               119   2e-27   Rhizopus microsporus
gb|KIJ61858.1|  hypothetical protein HYDPIDRAFT_137104                  117   2e-27   Hydnomerulius pinastri MD-312
emb|CEI93304.1|  Putative ATP-dependent RNA helicase DHH1               119   2e-27   Rhizopus microsporus
gb|EFA85810.1|  putative RNA helicase                                   117   2e-27   Heterostelium album PN500
emb|CDI54154.1|  probable ATP-dependent RNA helicase DHH1               117   2e-27   Melanopsichium pennsylvanicum 4
gb|KFG56064.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6             118   2e-27   Toxoplasma gondii FOU
gb|KFH64831.1|  ATP-dependent RNA helicase dhh1                         117   2e-27   Mortierella verticillata NRRL 6337
ref|XP_007850551.1|  atp-dependent rna helicase dhh1                    117   2e-27   
gb|EIE81845.1|  ATP-dependent RNA helicase DHH1                         119   2e-27   Rhizopus delemar RA 99-880
gb|EFZ13584.1|  hypothetical protein SINV_12815                         112   2e-27   
emb|CBJ26145.1|  DEAD box helicase                                      117   2e-27   Ectocarpus siliculosus
gb|EIE83902.1|  ATP-dependent RNA helicase DHH1                         119   2e-27   Rhizopus delemar RA 99-880
dbj|GAM20363.1|  hypothetical protein SAMD00019534_035380               117   2e-27   Acytostelium subglobosum LB1
gb|KIO31446.1|  hypothetical protein M407DRAFT_5062                     117   2e-27   Tulasnella calospora MUT 4182
ref|XP_661064.1|  hypothetical protein AN3460.2                         116   3e-27   Aspergillus nidulans FGSC A4
gb|KIX01138.1|  ATP-dependent RNA helicase dhh1                         117   3e-27   Rhinocladiella mackenziei CBS 650.93
emb|CEI99706.1|  Putative DEAD/DEAH box helicase                        119   3e-27   Rhizopus microsporus
ref|XP_008720081.1|  ATP-dependent RNA helicase dhh1                    119   3e-27   Cyphellophora europaea CBS 101466
gb|KDN37738.1|  putative ATP-dependent RNA helicase DHH1                117   3e-27   Tilletiaria anomala UBC 951
ref|XP_007882290.1|  hypothetical protein PFL1_06556                    117   3e-27   Anthracocystis flocculosa PF-1
gb|KDQ06910.1|  hypothetical protein BOTBODRAFT_60364                   117   3e-27   Botryobasidium botryosum FD-172 SS1
gb|EMS22443.1|  ATP-dependent rna helicase dhh1                         117   3e-27   
gb|KEQ83372.1|  DEAD-domain-containing protein                          117   3e-27   
gb|KFX41877.1|  ATP-dependent RNA helicase dhh1                         115   3e-27   
gb|EGU12280.1|  ATP-dependent RNA helicase dhh1                         117   3e-27   
ref|XP_006957352.1|  DEAD-domain-containing protein                     117   3e-27   
gb|KIL61043.1|  hypothetical protein M378DRAFT_187630                   117   3e-27   
ref|XP_007313871.1|  hypothetical protein SERLADRAFT_354128             117   3e-27   
ref|XP_002677495.1|  dead box ATP-dependent RNA helicase                120   4e-27   
gb|EGO03765.1|  hypothetical protein SERLA73DRAFT_83896                 117   4e-27   
gb|KIM47033.1|  hypothetical protein M413DRAFT_16541                    116   4e-27   
emb|CDR46917.1|  RHTO0S13e03356g1_1                                     117   4e-27   
gb|KIM24760.1|  hypothetical protein M408DRAFT_331594                   119   5e-27   
ref|XP_008883618.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6        118   5e-27   
ref|XP_003885240.1|  Eukaryotic initiation factor, related              118   5e-27   
ref|XP_002584013.1|  hypothetical protein UREG_06980                    116   5e-27   
emb|CEP14076.1|  hypothetical protein                                   118   5e-27   
ref|XP_002364513.1|  ATP-dependent RNA helicase, putative               118   5e-27   
gb|KIY70674.1|  DEAD-domain-containing protein                          116   5e-27   
gb|EPR60983.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6             118   6e-27   
dbj|GAC75080.1|  ATP-dependent RNA helicase                             118   6e-27   
gb|ETS59938.1|  hypothetical protein PaG_05919                          118   6e-27   
dbj|GAK64657.1|  eukaryotic translation initiation factor 4A-like...    118   6e-27   
ref|XP_001270568.1|  ATP dependent RNA helicase (Dhh1), putative        116   6e-27   
emb|CBQ73743.1|  probable ATP-dependent RNA helicase DHH1               118   6e-27   
gb|EFN88325.1|  Putative ATP-dependent RNA helicase me31b               110   6e-27   
ref|XP_007672754.1|  hypothetical protein BAUCODRAFT_371348             118   7e-27   
gb|KEQ62464.1|  DEAD-domain-containing protein                          118   7e-27   
ref|XP_006681354.1|  hypothetical protein BATDEDRAFT_20569              117   7e-27   
ref|XP_011389806.1|  putative DExD/H-box ATP-dependent RNA helica...    118   7e-27   
ref|XP_003237974.1|  ATP-dependent RNA helicase DHH1                    115   7e-27   
ref|XP_002508100.1|  DEAD/DEAH box helicase                             117   7e-27   
ref|XP_007352338.1|  DEAD-domain-containing protein                     116   7e-27   
emb|CCF52042.1|  probable ATP-dependent RNA helicase DHH1               117   7e-27   
ref|XP_001248331.1|  conserved hypothetical protein                     115   7e-27   
gb|EWM20640.1|  RNA helicase,ATP-dependent, DEAD-box type               117   7e-27   
gb|EFW16869.1|  ATP-dependent RNA helicase dhh1                         115   7e-27   
ref|XP_003065260.1|  ATP-dependent RNA helicase, putative               115   8e-27   
gb|EZF29913.1|  ATP-dependent RNA helicase dhh1                         115   8e-27   
emb|CCA74550.1|  probable ATP-dependent RNA helicase DHH1               118   8e-27   
gb|KDB22915.1|  ATP-dependent RNA helicase dhh1                         115   8e-27   
gb|EPZ36415.1|  putative ATP-dependent RNA helicase ddx6                117   8e-27   
gb|KEP55787.1|  ATP-dependent RNA helicase dhh1                         115   8e-27   
ref|XP_003173227.1|  ATP-dependent RNA helicase DHH1                    115   8e-27   
ref|XP_001395078.1|  ATP-dependent RNA helicase dhh1                    115   8e-27   
gb|EUC65189.1|  ATP-dependent RNA helicase dhh1                         115   9e-27   
gb|KIW74968.1|  ATP-dependent RNA helicase dhh1                         115   9e-27   
gb|KIW87364.1|  ATP-dependent RNA helicase dhh1                         115   9e-27   
gb|KIW28326.1|  ATP-dependent RNA helicase dhh1                         115   9e-27   
emb|CDJ63514.1|  ATP-dependent RNA helicase, putative                   117   1e-26   
ref|XP_007741840.1|  ATP-dependent RNA helicase DHH1                    115   1e-26   
emb|CDJ38983.1|  ATP-dependent RNA helicase, putative                   117   1e-26   
ref|XP_003010251.1|  hypothetical protein ARB_03506                     115   1e-26   
ref|XP_003018394.1|  hypothetical protein TRV_07588                     115   1e-26   
gb|EPS26561.1|  hypothetical protein PDE_01498                          115   1e-26   
ref|XP_005704518.1|  ATP-dependent RNA helicase                         113   1e-26   
emb|CDM32408.1|  ATP-dependent RNA helicase dhh1                        115   1e-26   
ref|XP_003848580.1|  hypothetical protein MYCGRDRAFT_101609             117   1e-26   
gb|EKV21927.1|  hypothetical protein PDIP_01520                         115   1e-26   
gb|EKV16720.1|  hypothetical protein PDIG_19090                         115   1e-26   
ref|XP_002563374.1|  Pc20g08510                                         115   1e-26   
ref|XP_675212.1|  ATP-dependent RNA helicase                            116   1e-26   
gb|KIY02798.1|  ATP-dependent RNA helicase dhh1                         115   1e-26   
gb|KDE02539.1|  ATP-dependent RNA helicase dhh1                         115   1e-26   
emb|CEL57930.1|  ATP-dependent RNA helicase DDX6/DHH1                   114   2e-26   
gb|KIK99181.1|  hypothetical protein PAXRUDRAFT_23846                   114   2e-26   
ref|XP_001824396.1|  ATP-dependent RNA helicase dhh1                    114   2e-26   
gb|KIJ15927.1|  hypothetical protein PAXINDRAFT_168904                  114   2e-26   
gb|EGD94532.1|  ATP-dependent RNA helicase DHH1                         114   2e-26   
ref|XP_011118775.1|  hypothetical protein AOL_s00007g573                114   2e-26   
emb|CCX07757.1|  Similar to ATP-dependent RNA helicase dhh1; acc....    114   2e-26   
ref|XP_011111674.1|  hypothetical protein H072_5868                     114   2e-26   
ref|XP_003747716.1|  PREDICTED: uncharacterized protein LOC100905154    110   2e-26   
gb|ELU41871.1|  ATP dependent RNA helicase (Dhh1), putative             114   2e-26   
ref|XP_007393350.1|  hypothetical protein PHACADRAFT_182411             115   2e-26   
ref|XP_001263902.1|  ATP dependent RNA helicase (Dhh1), putative        114   2e-26   
gb|KIW43309.1|  ATP-dependent RNA helicase DHH1                         114   2e-26   
ref|XP_005780551.1|  hypothetical protein EMIHUDRAFT_73141              116   2e-26   
emb|CDH58577.1|  atp-dependent rna helicase dhh1                        116   2e-26   
emb|CDJ48750.1|  ATP-dependent RNA helicase, putative                   115   2e-26   
tpe|CBF82660.1|  TPA: ATP-dependent RNA helicase (Eurofung)             114   2e-26   
ref|XP_755058.1|  DEAD-box RNA helicase Dhh1/Vad1                       114   2e-26   
ref|XP_001217579.1|  hypothetical protein ATEG_08993                    114   3e-26   
ref|XP_008727205.1|  ATP-dependent RNA helicase DHH1                    114   3e-26   
ref|XP_006689634.1|  dead Box protein Dhh1p                             111   3e-26   
ref|XP_007756258.1|  ATP-dependent RNA helicase DHH1                    114   3e-26   
ref|XP_002384265.1|  DEAD-box RNA helicase Dhh1/Vad1, putative          114   3e-26   
ref|XP_008623418.1|  ATP-dependent RNA helicase ddx6                    115   3e-26   
gb|KIP07293.1|  hypothetical protein PHLGIDRAFT_105879                  115   3e-26   
gb|KIY47370.1|  eukaryotic translation initiation factor 4A-like ...    112   3e-26   
ref|XP_002843312.1|  ATP-dependent RNA helicase DHH1                    114   3e-26   
ref|XP_001730716.1|  hypothetical protein MGL_2170                      116   3e-26   
gb|KIK34946.1|  hypothetical protein CY34DRAFT_97034                    114   3e-26   
ref|XP_742509.1|  ATP-dependent RNA helicase                            115   3e-26   
ref|XP_002620701.1|  ATP-dependent RNA helicase DHH1                    113   3e-26   
ref|XP_729699.1|  ATP-dependent RNA Helicase                            115   3e-26   
gb|EPS67203.1|  hypothetical protein M569_07571                         115   3e-26   
emb|CDJ58680.1|  ATP-dependent RNA helicase, putative                   115   4e-26   
ref|XP_010761262.1|  ATP-dependent RNA helicase DHH1                    113   4e-26   
ref|XP_011166764.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_011062102.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
emb|CDS11083.1|  Putative ATP-dependent RNA helicase DHH1               115   4e-26   
dbj|GAD99861.1|  ATP-dependent RNA helicase DHH1                        113   4e-26   
ref|XP_003704663.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_011335980.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_624586.2|  PREDICTED: putative ATP-dependent RNA helicase ...    112   4e-26   
dbj|GAM83179.1|  hypothetical protein ANO11243_011650                   116   4e-26   
ref|XP_003402776.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_008815898.1|  ATP-dependent RNA helicase ddx6                    115   4e-26   
gb|EER42776.1|  ATP-dependent RNA helicase DHH1                         113   4e-26   
gb|KFM58711.1|  putative ATP-dependent RNA helicase me31b               111   4e-26   
sp|Q6BJX6.2|DHH1_DEBHA  RecName: Full=ATP-dependent RNA helicase ...    111   4e-26   
ref|XP_002486388.1|  DEAD-box RNA helicase Dhh1/Vad1, putative          113   4e-26   
ref|XP_011139072.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
gb|EFN61728.1|  Putative ATP-dependent RNA helicase me31b               112   4e-26   
ref|XP_011265969.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_009033849.1|  hypothetical protein AURANDRAFT_52587              115   4e-26   
ref|XP_008552788.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_001602897.1|  PREDICTED: putative ATP-dependent RNA helica...    112   4e-26   
ref|XP_002789230.1|  ATP-dependent RNA helicase DHH1                    113   4e-26   
gb|EEH07818.1|  ATP-dependent RNA helicase DHH1                         113   4e-26   
emb|CCU99198.1|  unnamed protein product                                115   5e-26   
dbj|GAM43589.1|  ATP-dependent RNA helicase                             113   5e-26   
ref|XP_461495.1|  DEHA2F26598p                                          111   5e-26   
gb|EZA56181.1|  Putative ATP-dependent RNA helicase me31b               111   5e-26   
ref|XP_002152684.1|  DEAD-box RNA helicase Dhh1/Vad1, putative          113   5e-26   
gb|ETW32271.1|  DEAD-box ATP-dependent RNA helicase 6                   113   5e-26   
gb|KDQ31787.1|  hypothetical protein PLEOSDRAFT_22618                   114   5e-26   
ref|XP_007802948.1|  ATP-dependent RNA helicase DHH1                    112   6e-26   
emb|CCJ28576.1|  unnamed protein product                                113   6e-26   
ref|XP_001535985.1|  hypothetical protein HCAG_09069                    113   6e-26   
ref|XP_001614505.1|  ATP-dependent RNA helicase                         114   7e-26   
gb|ETW32773.1|  DEAD-box ATP-dependent RNA helicase 6                   113   7e-26   
ref|XP_009042151.1|  hypothetical protein AURANDRAFT_39444              114   7e-26   
ref|XP_004222076.1|  ATP-dependent RNA helicase                         114   7e-26   
gb|KGO65462.1|  Helicase, C-terminal                                    115   8e-26   
gb|KEI39965.1|  hypothetical protein L969DRAFT_47510                    117   8e-26   
dbj|GAA99335.1|  hypothetical protein E5Q_06030                         117   8e-26   
ref|XP_002258841.1|  ATP-dependent RNA helicase                         114   8e-26   
gb|KGO36130.1|  Helicase, C-terminal                                    115   9e-26   
ref|XP_004195684.1|  Piso0_005086                                       110   9e-26   
ref|XP_007513343.1|  predicted protein                                  114   9e-26   
emb|CDJ30776.1|  ATP-dependent RNA helicase, putative                   114   9e-26   
gb|ERL89335.1|  hypothetical protein D910_06707                         109   1e-25   
gb|EHJ66501.1|  putative DEAD box ATP-dependent RNA helicase            109   1e-25   
ref|XP_010544718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   1e-25   
emb|CDO62632.1|  ATP-dependent RNA helicase DDX6, putative              114   1e-25   
gb|AAK85400.1|AF399934_1  RNA helicase p47                              109   1e-25   
ref|XP_007404630.1|  hypothetical protein MELLADRAFT_46659              111   1e-25   
ref|XP_002490121.1|  Cytoplasmic DExD/H-box helicase                    114   1e-25   
gb|AAB94769.1|  putative RNA helicase RCK                               109   1e-25   
ref|XP_002549673.1|  hypothetical protein CTRG_03970                    109   1e-25   
ref|XP_003646486.1|  hypothetical protein Ecym_4646                     110   1e-25   
ref|XP_001351278.1|  ATP-dependent RNA Helicase, putative               114   1e-25   
gb|EDL25604.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...    109   1e-25   
ref|XP_009906613.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
gb|KFV74826.1|  putative ATP-dependent RNA helicase DDX6                109   1e-25   
ref|NP_001102762.1|  probable ATP-dependent RNA helicase DDX6           109   1e-25   
ref|XP_007931640.1|  hypothetical protein MYCFIDRAFT_205331             114   1e-25   
ref|XP_006120991.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|XP_001418212.1|  predicted protein                                  114   1e-25   
ref|XP_007424313.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
gb|ELW63222.1|  putative ATP-dependent RNA helicase DDX6                109   1e-25   
ref|XP_003321086.1|  hypothetical protein PGTG_02128                    111   1e-25   
ref|XP_004585195.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|NP_031867.1|  probable ATP-dependent RNA helicase DDX6              109   1e-25   
ref|XP_007584628.1|  putative atp-dependent rna helicase dhh1 pro...    111   1e-25   
ref|XP_004427303.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|XP_007782284.1|  ATP-dependent RNA helicase DHH1                    111   1e-25   
ref|XP_005069498.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
gb|EKG16907.1|  RNA helicase ATP-dependent DEAD-box conserved site      111   1e-25   
gb|EKC23739.1|  Putative ATP-dependent RNA helicase DDX6                109   1e-25   
gb|KFV08299.1|  putative ATP-dependent RNA helicase DDX6                109   1e-25   
ref|XP_008936029.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|XP_010007187.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|XP_005500759.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|XP_009096029.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|XP_003418301.1|  PREDICTED: probable ATP-dependent RNA helica...    109   1e-25   
ref|NP_001006319.2|  probable ATP-dependent RNA helicase DDX6           109   1e-25   
gb|EMC78306.1|  putative ATP-dependent RNA helicase DDX6                109   1e-25   
gb|EAW67413.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...    109   1e-25   
ref|XP_010073394.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
gb|KFQ27323.1|  putative ATP-dependent RNA helicase DDX6                109   2e-25   
ref|XP_008498097.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_002722747.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_007523665.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_004016131.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_011315526.1|  PREDICTED: putative ATP-dependent RNA helica...    110   2e-25   
ref|XP_006890900.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_005142703.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_005058611.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_004667445.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_007771542.1|  DEAD-domain-containing protein                     114   2e-25   
ref|XP_009566929.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_005328395.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|NP_004388.2|  probable ATP-dependent RNA helicase DDX6              109   2e-25   
gb|KFR01415.1|  putative ATP-dependent RNA helicase DDX6                109   2e-25   
gb|KFP05525.1|  putative ATP-dependent RNA helicase DDX6                109   2e-25   
ref|NP_001137339.1|  probable ATP-dependent RNA helicase DDX6           109   2e-25   
ref|XP_006993424.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|NP_001268976.1|  probable ATP-dependent RNA helicase DDX6 iso...    109   2e-25   
ref|XP_010007469.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_009467328.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
gb|KFO81891.1|  putative ATP-dependent RNA helicase DDX6                109   2e-25   
ref|XP_003674344.1|  hypothetical protein NCAS_0A14060                  109   2e-25   
ref|XP_009579459.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_008576061.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_006833954.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_005299846.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_004385709.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_003129962.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_849975.1|  PREDICTED: probable ATP-dependent RNA helicase ...    109   2e-25   
ref|XP_007062450.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_006037671.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_005856840.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_008824161.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
gb|EMP33396.1|  Putative ATP-dependent RNA helicase DDX6                109   2e-25   
gb|KFW07901.1|  putative ATP-dependent RNA helicase DDX6                109   2e-25   
gb|KFQ45799.1|  putative ATP-dependent RNA helicase DDX6                109   2e-25   
ref|XP_010627615.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_006152352.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   
ref|XP_004636497.1|  PREDICTED: probable ATP-dependent RNA helica...    109   2e-25   



>gb|AFW63178.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=109

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/64 (95%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  739  KFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQA  560
             FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQA
Sbjct  46   NFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQA  105

Query  559  IYCQ  548
            IYCQ
Sbjct  106  IYCQ  109



>ref|NP_001132565.1| uncharacterized protein LOC100194030 [Zea mays]
 gb|ACF81456.1| unknown [Zea mays]
Length=104

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  739  KFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQA  560
             FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA
Sbjct  41   NFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQA  100

Query  559  IYCQ  548
            IYCQ
Sbjct  101  IYCQ  104



>gb|EPS59687.1| hypothetical protein M569_15121, partial [Genlisea aurea]
Length=81

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  760  SSCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPI  581
             +      FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK I
Sbjct  11   QAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQI  70

Query  580  PPHIDQAIYC  551
            PP+IDQAIYC
Sbjct  71   PPYIDQAIYC  80



>gb|ADV04059.1| DEAD/DEAH box helicase 8 [Hevea brasiliensis]
Length=200

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  138  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  197

Query  556  YCQ  548
            YC+
Sbjct  198  YCR  200



>gb|ACG29146.1| ATP-dependent RNA helicase dhh1 [Zea mays]
Length=517

 Score =   133 bits (335),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  455  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  514

Query  556  YCQ  548
            YCQ
Sbjct  515  YCQ  517


 Score = 34.7 bits (78),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  440  FTRGIDIQAVNVVINFDFPKNSE  462



>ref|NP_001148960.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 gb|ACG33648.1| ATP-dependent RNA helicase dhh1 [Zea mays]
Length=517

 Score =   133 bits (335),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  455  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  514

Query  556  YCQ  548
            YCQ
Sbjct  515  YCQ  517


 Score = 34.7 bits (78),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  440  FTRGIDIQAVNVVINFDFPKNSE  462



>ref|XP_008376043.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Malus 
domestica]
Length=216

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IP
Sbjct  147  AVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIP  206

Query  577  PHIDQAIYCQ  548
            PHIDQAIYC+
Sbjct  207  PHIDQAIYCR  216



>ref|XP_002320116.2| hypothetical protein POPTR_0014s07690g [Populus trichocarpa]
 gb|EEE98431.2| hypothetical protein POPTR_0014s07690g [Populus trichocarpa]
Length=505

 Score =   133 bits (334),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  443  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  502

Query  556  YCQ  548
            YCQ
Sbjct  503  YCQ  505


 Score = 34.7 bits (78),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  428  FTRGIDIQAVNVVINFDFPKNSE  450



>ref|XP_008339750.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Malus 
domestica]
Length=266

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  204  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  263

Query  556  YCQ  548
            YC+
Sbjct  264  YCR  266



>ref|XP_011035912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Populus euphratica]
 ref|XP_011035920.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Populus euphratica]
Length=503

 Score =   133 bits (334),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  441  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  500

Query  556  YCQ  548
            YCQ
Sbjct  501  YCQ  503


 Score = 34.7 bits (78),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  426  FTRGIDIQAVNVVINFDFPKNSE  448



>ref|XP_011093152.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8-like [Sesamum indicum]
Length=489

 Score =   132 bits (333),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  427  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  486

Query  556  YCQ  548
            YCQ
Sbjct  487  YCQ  489


 Score = 34.7 bits (78),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  412  FTRGIDIQAVNVVINFDFPK  431



>ref|XP_011023369.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Populus 
euphratica]
 ref|XP_011023370.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Populus 
euphratica]
Length=500

 Score =   132 bits (333),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  438  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  497

Query  556  YCQ  548
            YCQ
Sbjct  498  YCQ  500


 Score = 34.3 bits (77),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  423  FTRGIDIQAVNVVINFDFPKNSE  445



>dbj|BAJ90747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   131 bits (329),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK+SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  456  FDFPKSSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  515

Query  556  YCQ  548
            YCQ
Sbjct  516  YCQ  518


 Score = 35.8 bits (81),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F ++ +
Sbjct  441  FTRGIDIQAVNVVINFDFPKSSE  463



>gb|EMT21717.1| DEAD-box ATP-dependent RNA helicase 8 [Aegilops tauschii]
Length=426

 Score =   131 bits (329),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK+SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY IEQELGTEIKPIPP IDQAI
Sbjct  364  FDFPKSSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYSIEQELGTEIKPIPPQIDQAI  423

Query  556  YCQ  548
            YCQ
Sbjct  424  YCQ  426


 Score = 35.8 bits (81),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F ++ +
Sbjct  349  FTRGIDIQAVNVVINFDFPKSSE  371



>ref|XP_004953257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Setaria 
italica]
Length=517

 Score =   133 bits (334),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  455  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  514

Query  556  YCQ  548
            YCQ
Sbjct  515  YCQ  517


 Score = 34.3 bits (77),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVV+N  F +  +
Sbjct  440  FTRGIDIQAVNVVVNFDFPKNSE  462



>ref|XP_011091933.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8 [Sesamum indicum]
Length=492

 Score =   132 bits (332),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  430  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  489

Query  556  YCQ  548
            YCQ
Sbjct  490  YCQ  492


 Score = 34.7 bits (78),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  415  FTRGIDIQAVNVVINFDFPK  434



>ref|XP_010544383.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Tarenaya 
hassleriana]
Length=512

 Score =   132 bits (332),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  450  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  509

Query  556  YCQ  548
            YCQ
Sbjct  510  YCQ  512


 Score = 34.3 bits (77),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  435  FTRGIDIQAVNVVINFDFPKNSE  457



>ref|XP_002987276.1| hypothetical protein SELMODRAFT_158648 [Selaginella moellendorffii]
 ref|XP_002989208.1| hypothetical protein SELMODRAFT_235717 [Selaginella moellendorffii]
 gb|EFJ09802.1| hypothetical protein SELMODRAFT_235717 [Selaginella moellendorffii]
 gb|EFJ11591.1| hypothetical protein SELMODRAFT_158648 [Selaginella moellendorffii]
Length=362

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  300  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  359

Query  556  YCQ  548
            YC+
Sbjct  360  YCR  362



>ref|XP_010540276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
 ref|XP_010540277.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
Length=497

 Score =   132 bits (332),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  435  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  494

Query  556  YCQ  548
            YCQ
Sbjct  495  YCQ  497


 Score = 34.3 bits (77),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  420  FTRGIDIQAVNVVINFDFPKNSE  442



>sp|Q6H7S2.2|RH8_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 8 [Oryza sativa 
Japonica Group]
 dbj|BAD25226.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAG92832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57460.1| hypothetical protein OsJ_07688 [Oryza sativa Japonica Group]
Length=508

 Score =   130 bits (326),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  446  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  505

Query  556  YCQ  548
            YCQ
Sbjct  506  YCQ  508


 Score = 36.6 bits (83),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  431  FTRGIDIQAVNVVINFDFPKT  451



>ref|NP_001047552.1| Os02g0641800 [Oryza sativa Japonica Group]
 dbj|BAD25227.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF09466.1| Os02g0641800 [Oryza sativa Japonica Group]
 gb|EEC73681.1| hypothetical protein OsI_08237 [Oryza sativa Indica Group]
Length=483

 Score =   130 bits (326),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  421  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  480

Query  556  YCQ  548
            YCQ
Sbjct  481  YCQ  483


 Score = 36.6 bits (83),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  406  FTRGIDIQAVNVVINFDFPKT  426



>ref|XP_009611007.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
tomentosiformis]
Length=504

 Score =   132 bits (331),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  442  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAI  501

Query  556  YCQ  548
            YCQ
Sbjct  502  YCQ  504


 Score = 34.3 bits (77),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  427  FTRGIDIQAVNVVINFDFPKNSE  449



>ref|XP_009757253.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
sylvestris]
Length=504

 Score =   132 bits (331),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  442  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAI  501

Query  556  YCQ  548
            YCQ
Sbjct  502  YCQ  504


 Score = 34.3 bits (77),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  427  FTRGIDIQAVNVVINFDFPKNSE  449



>ref|XP_007051859.1| RNAhelicase-like 8 isoform 2, partial [Theobroma cacao]
 gb|EOX96016.1| RNAhelicase-like 8 isoform 2, partial [Theobroma cacao]
Length=356

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  294  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  353

Query  556  YCQ  548
            YC+
Sbjct  354  YCR  356



>gb|ACL52527.1| unknown [Zea mays]
 gb|AFW72524.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=275

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  213  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAI  272

Query  556  YCQ  548
            YCQ
Sbjct  273  YCQ  275



>gb|KHG21931.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=529

 Score =   131 bits (330),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  431  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  490

Query  556  YCQ*N  542
            YC+ N
Sbjct  491  YCRVN  495


 Score = 34.7 bits (78),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  416  FTRGIDIQAVNVVINFDFPKNSE  438



>ref|XP_006396262.1| hypothetical protein EUTSA_v10028588mg [Eutrema salsugineum]
 gb|ESQ37715.1| hypothetical protein EUTSA_v10028588mg [Eutrema salsugineum]
Length=512

 Score =   131 bits (330),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  450  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  509

Query  556  YCQ  548
            YCQ
Sbjct  510  YCQ  512


 Score = 34.3 bits (77),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  435  FTRGIDIQAVNVVINFDFPK  454



>ref|XP_009134538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Brassica 
rapa]
Length=514

 Score =   131 bits (330),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  452  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  511

Query  556  YCQ  548
            YCQ
Sbjct  512  YCQ  514


 Score = 34.3 bits (77),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  437  FTRGIDIQAVNVVINFDFPK  456



>ref|XP_010236834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Brachypodium 
distachyon]
Length=313

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK+SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAI
Sbjct  251  FDFPKSSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAI  310

Query  556  YCQ  548
            YCQ
Sbjct  311  YCQ  313



>emb|CDX74342.1| BnaA03g27050D [Brassica napus]
Length=514

 Score =   131 bits (330),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  452  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  511

Query  556  YCQ  548
            YCQ
Sbjct  512  YCQ  514


 Score = 34.3 bits (77),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  437  FTRGIDIQAVNVVINFDFPK  456



>gb|KJB09834.1| hypothetical protein B456_001G169800 [Gossypium raimondii]
 gb|KJB09835.1| hypothetical protein B456_001G169800 [Gossypium raimondii]
Length=499

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  437  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  496

Query  556  YCQ  548
            YC+
Sbjct  497  YCR  499


 Score = 34.3 bits (77),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  422  FTRGIDIQAVNVVINFDFPKNSE  444



>ref|XP_010456256.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Camelina sativa]
Length=503

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  441  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  500

Query  556  YCQ  548
            YCQ
Sbjct  501  YCQ  503


 Score = 34.3 bits (77),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  426  FTRGIDIQAVNVVINFDFPK  445



>dbj|BAH19526.1| AT4G00660 [Arabidopsis thaliana]
Length=374

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  312  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  371

Query  556  YCQ  548
            YCQ
Sbjct  372  YCQ  374



>gb|KHG12667.1| DEAD-box ATP-dependent RNA helicase 8 -like protein [Gossypium 
arboreum]
Length=493

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  431  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  490

Query  556  YCQ  548
            YC+
Sbjct  491  YCR  493


 Score = 34.3 bits (77),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  416  FTRGIDIQAVNVVINFDFPKNSE  438



>gb|KDP28654.1| hypothetical protein JCGZ_14425 [Jatropha curcas]
Length=500

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  438  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  497

Query  556  YCQ  548
            YC+
Sbjct  498  YCR  500


 Score = 34.7 bits (78),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  423  FTRGIDIQAVNVVINFDFPKNSE  445



>gb|KHG21932.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=493

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  431  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  490

Query  556  YCQ  548
            YC+
Sbjct  491  YCR  493


 Score = 34.3 bits (77),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  416  FTRGIDIQAVNVVINFDFPKNSE  438



>ref|XP_009111462.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Brassica rapa]
Length=510

 Score =   129 bits (324),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  448  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  507

Query  556  YCQ  548
            YCQ
Sbjct  508  YCQ  510


 Score = 36.2 bits (82),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  433  FTRGIDIQAVNVVINFDFPKT  453



>emb|CDY51147.1| BnaA09g51820D [Brassica napus]
Length=496

 Score =   129 bits (324),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  434  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  493

Query  556  YCQ  548
            YCQ
Sbjct  494  YCQ  496


 Score = 36.2 bits (82),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  419  FTRGIDIQAVNVVINFDFPKT  439



>ref|XP_006287568.1| hypothetical protein CARUB_v10000779mg [Capsella rubella]
 gb|EOA20466.1| hypothetical protein CARUB_v10000779mg [Capsella rubella]
Length=502

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  440  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  499

Query  556  YCQ  548
            YCQ
Sbjct  500  YCQ  502


 Score = 34.3 bits (77),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  425  FTRGIDIQAVNVVINFDFPK  444



>ref|XP_007051858.1| RNAhelicase-like 8 isoform 1 [Theobroma cacao]
 gb|EOX96015.1| RNAhelicase-like 8 isoform 1 [Theobroma cacao]
Length=501

 Score =   131 bits (329),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  439  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  498

Query  556  YCQ  548
            YC+
Sbjct  499  YCR  501


 Score = 34.7 bits (78),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  424  FTRGIDIQAVNVVINFDFPKNSE  446



>emb|CDP08841.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  426  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  485

Query  556  YCQ  548
            YC+
Sbjct  486  YCR  488


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  411  FTRGIDIQAVNVVINFDFPKNSE  433



>ref|XP_006445089.1| hypothetical protein CICLE_v10019858mg [Citrus clementina]
 ref|XP_006491063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Citrus 
sinensis]
 gb|ESR58329.1| hypothetical protein CICLE_v10019858mg [Citrus clementina]
 gb|KDO86090.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
 gb|KDO86091.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
Length=494

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  432  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  491

Query  556  YCQ  548
            YC+
Sbjct  492  YCR  494


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  417  FTRGIDIQAVNVVINFDFPKNSE  439



>ref|XP_002511831.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF50500.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=507

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  445  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  504

Query  556  YCQ  548
            YC+
Sbjct  505  YCR  507


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  430  FTRGIDIQAVNVVINFDFPKNSE  452



>emb|CAA09199.1| RNA helicase [Arabidopsis thaliana]
Length=505

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  443  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  502

Query  556  YCQ  548
            YCQ
Sbjct  503  YCQ  505


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  428  FTRGIDIQAVNVVINFDFPK  447



>ref|XP_009340166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Pyrus x bretschneideri]
Length=510

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  448  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  507

Query  556  YCQ  548
            YC+
Sbjct  508  YCR  510


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  433  FTRGIDIQAVNVVINFDFPKNSE  455



>ref|XP_002875020.1| hypothetical protein ARALYDRAFT_490504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51279.1| hypothetical protein ARALYDRAFT_490504 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   131 bits (329),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  445  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  504

Query  556  YCQ  548
            YCQ
Sbjct  505  YCQ  507


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  430  FTRGIDIQAVNVVINFDFPK  449



>gb|KHF99913.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
 gb|KHF99914.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=495

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  433  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  492

Query  556  YCQ  548
            YC+
Sbjct  493  YCR  495


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  418  FTRGIDIQAVNVVINFDFPKNSE  440



>gb|KGN56528.1| Dead box ATP-dependent RNA helicase [Cucumis sativus]
Length=558

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  430  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  489

Query  556  YCQ  548
            YC+
Sbjct  490  YCR  492


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  415  FTRGIDIQAVNVVINFDFPKNSE  437



>emb|CDX91901.1| BnaC03g32030D [Brassica napus]
Length=501

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  439  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  498

Query  556  YCQ  548
            YCQ
Sbjct  499  YCQ  501


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  424  FTRGIDIQAVNVVINFDFPK  443



>ref|XP_010053686.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Eucalyptus 
grandis]
 gb|KCW78046.1| hypothetical protein EUGRSUZ_D02270 [Eucalyptus grandis]
Length=514

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  452  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  511

Query  556  YCQ  548
            YC+
Sbjct  512  YCR  514


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  437  FTRGIDIQAVNVVINFDFPKNSE  459



>gb|KJB41288.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
 gb|KJB41291.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
Length=494

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  432  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  491

Query  556  YCQ  548
            YC+
Sbjct  492  YCR  494


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  417  FTRGIDIQAVNVVINFDFPKNSE  439



>gb|KJB22343.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
 gb|KJB22344.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
Length=490

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  428  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  487

Query  556  YCQ  548
            YC+
Sbjct  488  YCR  490


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  413  FTRGIDIQAVNVVINFDFPKNSE  435



>ref|XP_008438061.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Cucumis melo]
 ref|XP_008438062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Cucumis melo]
Length=492

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  430  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  489

Query  556  YCQ  548
            YC+
Sbjct  490  YCR  492


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  415  FTRGIDIQAVNVVINFDFPKNSE  437



>ref|XP_004306806.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Fragaria vesca 
subsp. vesca]
Length=510

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  448  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  507

Query  556  YCQ  548
            YC+
Sbjct  508  YCR  510


 Score = 34.7 bits (78),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  433  FTRGIDIQAVNVVINFDFPKNSE  455



>ref|NP_191975.2| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 ref|NP_849535.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 sp|Q8RXK6.1|RH8_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis 
thaliana]
 gb|AAL87312.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAM45033.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE81915.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 gb|AEE81916.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
Length=505

 Score =   130 bits (328),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  443  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  502

Query  556  YCQ  548
            YCQ
Sbjct  503  YCQ  505


 Score = 34.3 bits (77),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  428  FTRGIDIQAVNVVINFDFPK  447



>ref|XP_007220665.1| hypothetical protein PRUPE_ppa004633mg [Prunus persica]
 ref|XP_008232788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Prunus mume]
 gb|EMJ21864.1| hypothetical protein PRUPE_ppa004633mg [Prunus persica]
Length=499

 Score =   130 bits (328),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  437  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  496

Query  556  YCQ  548
            YC+
Sbjct  497  YCR  499


 Score = 34.7 bits (78),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  422  FTRGIDIQAVNVVINFDFPKNSE  444



>ref|XP_006827696.1| hypothetical protein AMTR_s00009p00258110 [Amborella trichopoda]
 gb|ERM95112.1| hypothetical protein AMTR_s00009p00258110 [Amborella trichopoda]
Length=459

 Score =   129 bits (324),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+NSETYLHRVGRSGRFGHLGLAVNLITYEDRF+LY+IEQELGTEIKPIPP IDQAI
Sbjct  397  FDFPRNSETYLHRVGRSGRFGHLGLAVNLITYEDRFSLYRIEQELGTEIKPIPPQIDQAI  456

Query  556  YCQ  548
            YC+
Sbjct  457  YCK  459


 Score = 36.2 bits (82),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F R  +
Sbjct  382  FTRGIDIQAVNVVINFDFPRNSE  404



>ref|XP_010273108.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Nelumbo nucifera]
Length=483

 Score =   130 bits (328),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  421  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  480

Query  556  YCQ  548
            YC+
Sbjct  481  YCR  483


 Score = 34.3 bits (77),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  406  FTRGIDIQAVNVVINFDFPKNSE  428



>ref|XP_008681228.1| PREDICTED: uncharacterized protein LOC100194030 isoform X2 [Zea 
mays]
 gb|ACL54546.1| unknown [Zea mays]
Length=525

 Score =   130 bits (327),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  463  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAI  522

Query  556  YCQ  548
            YCQ
Sbjct  523  YCQ  525


 Score = 34.7 bits (78),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  448  FTRGIDIQAVNVVINFDFPKNSE  470



>ref|XP_004133869.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis 
sativus]
 ref|XP_004155819.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis 
sativus]
Length=492

 Score =   130 bits (328),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  430  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  489

Query  556  YCQ  548
            YC+
Sbjct  490  YCR  492


 Score = 34.7 bits (78),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  415  FTRGIDIQAVNVVINFDFPKNSE  437



>emb|CBI40324.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   130 bits (328),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  410  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  469

Query  556  YCQ  548
            YC+
Sbjct  470  YCR  472


 Score = 34.7 bits (78),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  395  FTRGIDIQAVNVVINFDFPKNSE  417



>ref|XP_008681227.1| PREDICTED: uncharacterized protein LOC100194030 isoform X1 [Zea 
mays]
Length=536

 Score =   130 bits (327),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  474  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAI  533

Query  556  YCQ  548
            YCQ
Sbjct  534  YCQ  536


 Score = 34.7 bits (78),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  459  FTRGIDIQAVNVVINFDFPKNSE  481



>gb|KJB22345.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
Length=362

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  300  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  359

Query  556  YCQ  548
            YC+
Sbjct  360  YCR  362



>ref|XP_010105971.1| DEAD-box ATP-dependent RNA helicase 8 [Morus notabilis]
 gb|EXC06853.1| DEAD-box ATP-dependent RNA helicase 8 [Morus notabilis]
Length=436

 Score =   130 bits (328),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  332  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  391

Query  556  YCQ  548
            YC+
Sbjct  392  YCR  394


 Score = 34.3 bits (77),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  317  FTRGIDIQAVNVVINFDFPKNSE  339



>ref|XP_007139882.1| hypothetical protein PHAVU_008G066400g [Phaseolus vulgaris]
 gb|ESW11876.1| hypothetical protein PHAVU_008G066400g [Phaseolus vulgaris]
Length=512

 Score =   130 bits (328),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  450  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  509

Query  556  YCQ  548
            YC+
Sbjct  510  YCR  512


 Score = 34.3 bits (77),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  435  FTRGIDIQAVNVVINFDFPKNSE  457



>ref|XP_002270379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 ref|XP_010661748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 ref|XP_010661749.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 emb|CAN75439.1| hypothetical protein VITISV_000835 [Vitis vinifera]
Length=491

 Score =   130 bits (327),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  429  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  488

Query  556  YCQ  548
            YC+
Sbjct  489  YCR  491


 Score = 34.7 bits (78),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  414  FTRGIDIQAVNVVINFDFPKNSE  436



>ref|XP_004248580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
lycopersicum]
 ref|XP_010327321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
lycopersicum]
Length=491

 Score =   130 bits (327),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  429  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  488

Query  556  YC  551
            YC
Sbjct  489  YC  490


 Score = 34.7 bits (78),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  414  FTRGIDIQAVNVVINFDFPKNSE  436



>ref|XP_006652567.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
6-like [Oryza brachyantha]
Length=507

 Score =   130 bits (327),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AI
Sbjct  445  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAI  504

Query  556  YCQ  548
            YCQ
Sbjct  505  YCQ  507


 Score = 34.3 bits (77),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  430  FTRGIDIQAVNVVINFDFPK  449



>gb|AAC13628.1| similar to ATP-dependent RNA helicases [Arabidopsis thaliana]
 emb|CAB80875.1| putative RNA helicase [Arabidopsis thaliana]
Length=499

 Score =   130 bits (327),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  437  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  496

Query  556  YCQ  548
            YCQ
Sbjct  497  YCQ  499


 Score = 34.3 bits (77),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  422  FTRGIDIQAVNVVINFDFPK  441



>ref|XP_006341720.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341721.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Solanum tuberosum]
Length=488

 Score =   130 bits (327),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  426  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  485

Query  556  YC  551
            YC
Sbjct  486  YC  487


 Score = 34.3 bits (77),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  411  FTRGIDIQAVNVVINFDFPKNSE  433



>gb|KJB24711.1| hypothetical protein B456_004G1574001, partial [Gossypium raimondii]
Length=382

 Score =   130 bits (327),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  320  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  379

Query  556  YCQ  548
            YC+
Sbjct  380  YCR  382


 Score = 34.3 bits (77),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  305  FTRGIDIQAVNVVINFDFPKNSE  327



>ref|XP_006587858.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=504

 Score =   130 bits (327),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  442  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  501

Query  556  YCQ  548
            YC+
Sbjct  502  YCR  504


 Score = 34.3 bits (77),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  427  FTRGIDIQAVNVVINFDFPKNSE  449



>gb|EAY94957.1| hypothetical protein OsI_16765 [Oryza sativa Indica Group]
Length=484

 Score =   129 bits (325),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK++ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AI
Sbjct  422  FDFPKSAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAI  481

Query  556  YCQ  548
            YCQ
Sbjct  482  YCQ  484


 Score = 35.0 bits (79),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F ++
Sbjct  407  FTRGIDIQAVNVVINFDFPKS  427



>ref|XP_002301349.1| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80622.1| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=499

 Score =   130 bits (327),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQ I
Sbjct  437  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQTI  496

Query  556  YCQ  548
            YCQ
Sbjct  497  YCQ  499


 Score = 34.3 bits (77),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  422  FTRGIDIQAVNVVINFDFPK  441



>gb|KHN29373.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=368

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  300  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  359

Query  556  YCQ  548
            YC+
Sbjct  360  YCR  362



>ref|XP_006587857.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=539

 Score =   130 bits (326),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAI
Sbjct  477  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAI  536

Query  556  YCQ  548
            YC+
Sbjct  537  YCR  539


 Score = 34.7 bits (78),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  462  FTRGIDIQAVNVVINFDFPKNSE  484



>ref|XP_004976343.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Setaria 
italica]
Length=501

 Score =   130 bits (326),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AI
Sbjct  439  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAI  498

Query  556  YCQ  548
            YCQ
Sbjct  499  YCQ  501


 Score = 34.3 bits (77),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  424  FTRGIDIQAVNVVINFDFPK  443



>ref|XP_004240107.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Solanum lycopersicum]
Length=487

 Score =   129 bits (324),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQA+
Sbjct  425  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAV  484

Query  556  YC  551
            YC
Sbjct  485  YC  486


 Score = 34.7 bits (78),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  410  FTRGIDIQAVNVVINFDFPKNSE  432



>emb|CBI34696.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   129 bits (324),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELG EIK IPPHIDQAI
Sbjct  376  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGAEIKQIPPHIDQAI  435

Query  556  YCQ  548
            YC+
Sbjct  436  YCR  438


 Score = 34.7 bits (78),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  361  FTRGIDIQAVNVVINFDFPKNSE  383



>ref|NP_001053408.1| Os04g0533000 [Oryza sativa Japonica Group]
 sp|Q7XMK8.1|RH6_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 6 [Oryza sativa 
Japonica Group]
 emb|CAE04571.1| OSJNBb0039L24.10 [Oryza sativa Japonica Group]
 dbj|BAF15322.1| Os04g0533000 [Oryza sativa Japonica Group]
 gb|EAZ31443.1| hypothetical protein OsJ_15580 [Oryza sativa Japonica Group]
 dbj|BAG92597.1| unnamed protein product [Oryza sativa Japonica Group]
Length=498

 Score =   128 bits (322),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK++ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AI
Sbjct  436  FDFPKSAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAI  495

Query  556  YCQ  548
            YCQ
Sbjct  496  YCQ  498


 Score = 35.4 bits (80),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F ++
Sbjct  421  FTRGIDIQAVNVVINFDFPKS  441



>ref|XP_004510805.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cicer 
arietinum]
Length=530

 Score =   129 bits (324),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQA 
Sbjct  468  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAF  527

Query  556  YCQ  548
            YC+
Sbjct  528  YCR  530


 Score = 34.3 bits (77),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  453  FTRGIDIQAVNVVINFDFPKNSE  475



>ref|XP_010676491.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676492.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   129 bits (323),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGR+GHLGLAVNLITYEDRFNLYKIEQELGTEIK IPPHIDQ I
Sbjct  461  FDFPKNSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYKIEQELGTEIKQIPPHIDQGI  520

Query  556  YCQ  548
            YC+
Sbjct  521  YCR  523


 Score = 34.7 bits (78),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  446  FTRGIDIQAVNVVINFDFPKNSE  468



>ref|XP_006345594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
tuberosum]
Length=478

 Score =   129 bits (323),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQA+
Sbjct  416  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAV  475

Query  556  YC  551
            YC
Sbjct  476  YC  477


 Score = 34.7 bits (78),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  401  FTRGIDIQAVNVVINFDFPKNSE  423



>emb|CDY07205.1| BnaCnng02200D [Brassica napus]
Length=491

 Score =   127 bits (319),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQ I
Sbjct  429  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQTI  488

Query  556  YCQ  548
            YCQ
Sbjct  489  YCQ  491


 Score = 36.2 bits (82),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  414  FTRGIDIQAVNVVINFDFPKT  434



>ref|XP_009794053.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Nicotiana sylvestris]
Length=493

 Score =   129 bits (323),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  431  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPQIDQAI  490

Query  556  YCQ  548
            YCQ
Sbjct  491  YCQ  493


 Score = 34.7 bits (78),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  416  FTRGIDIQAVNVVINFDFPKNSE  438



>ref|XP_001765911.1| predicted protein [Physcomitrella patens]
 gb|EDQ69232.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   128 bits (322),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ I
Sbjct  344  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRGI  403

Query  556  YCQ  548
            YC+
Sbjct  404  YCR  406


 Score = 34.3 bits (77),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  329  FTRGIDIQAVNVVINFDFPKNSE  351



>ref|XP_010255444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nelumbo 
nucifera]
 ref|XP_010255445.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nelumbo 
nucifera]
Length=481

 Score =   128 bits (322),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  419  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  478

Query  556  YCQ  548
            YC+
Sbjct  479  YCR  481


 Score = 34.3 bits (77),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  404  FTRGIDIQAVNVVINFDFPKNSE  426



>ref|XP_002271357.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
Length=480

 Score =   128 bits (322),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELG EIK IPPHIDQAI
Sbjct  418  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGAEIKQIPPHIDQAI  477

Query  556  YCQ  548
            YC+
Sbjct  478  YCR  480


 Score = 34.7 bits (78),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  403  FTRGIDIQAVNVVINFDFPKNSE  425



>gb|EYU35077.1| hypothetical protein MIMGU_mgv1a005045mg [Erythranthe guttata]
 gb|EYU35078.1| hypothetical protein MIMGU_mgv1a005045mg [Erythranthe guttata]
Length=499

 Score =   128 bits (321),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP+IDQAI
Sbjct  437  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPNIDQAI  496

Query  556  YC  551
            YC
Sbjct  497  YC  498


 Score = 34.7 bits (78),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  422  FTRGIDIQAVNVVINFDFPKNSE  444



>dbj|BAJ94923.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   128 bits (322),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ I
Sbjct  433  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTI  492

Query  556  YCQ  548
            YCQ
Sbjct  493  YCQ  495


 Score = 34.7 bits (78),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  418  FTRGIDIQAVNVVINFDFPK  437



>ref|XP_003580213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Brachypodium 
distachyon]
Length=495

 Score =   128 bits (321),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ I
Sbjct  433  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTI  492

Query  556  YCQ  548
            YCQ
Sbjct  493  YCQ  495


 Score = 34.7 bits (78),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  418  FTRGIDIQAVNVVINFDFPK  437



>ref|XP_001766771.1| predicted protein [Physcomitrella patens]
 gb|EDQ68402.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   128 bits (322),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ I
Sbjct  344  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRGI  403

Query  556  YCQ  548
            YC+
Sbjct  404  YCR  406


 Score = 34.3 bits (77),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  329  FTRGIDIQAVNVVINFDFPKNSE  351



>gb|EMT23815.1| DEAD-box ATP-dependent RNA helicase 6 [Aegilops tauschii]
Length=522

 Score =   126 bits (316),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ I
Sbjct  460  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTI  519

Query  556  YCQ  548
            YCQ
Sbjct  520  YCQ  522


 Score = 36.6 bits (83),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  445  FTRGIDIQAVNVVINFDFPKT  465



>ref|XP_007135054.1| hypothetical protein PHAVU_010G0977000g, partial [Phaseolus vulgaris]
 gb|ESW07048.1| hypothetical protein PHAVU_010G0977000g, partial [Phaseolus vulgaris]
Length=402

 Score =   128 bits (322),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  340  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  399

Query  556  YCQ  548
            YC+
Sbjct  400  YCR  402


 Score = 34.3 bits (77),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  325  FTRGIDIQAVNVVINFDFPKNSE  347



>ref|XP_009384494.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   128 bits (321),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  426  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  485

Query  556  YCQ  548
            YC+
Sbjct  486  YCR  488


 Score = 34.7 bits (78),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  411  FTRGIDIQAVNVVINFDFPKNSE  433



>ref|XP_003623900.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES80118.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=514

 Score =   128 bits (321),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  452  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPFIDQAI  511

Query  556  YCQ  548
            YC+
Sbjct  512  YCR  514


 Score = 34.3 bits (77),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  437  FTRGIDIQAVNVVINFDFPKNSE  459



>gb|EYU32082.1| hypothetical protein MIMGU_mgv1a005052mg [Erythranthe guttata]
Length=499

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IP
Sbjct  430  SVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIP  489

Query  577  PHIDQAIYCQ  548
            P IDQAIYCQ
Sbjct  490  PQIDQAIYCQ  499



>ref|XP_003623902.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=586

 Score =   128 bits (321),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNL+TYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  524  FDFPKNSETYLHRVGRSGRFGHLGLAVNLVTYEDRFNLYRIEQELGTEIKQIPPFIDQAI  583

Query  556  YCQ  548
            YC+
Sbjct  584  YCR  586


 Score = 34.3 bits (77),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  509  FTRGIDIQAVNVVINFDFPKNSE  531



>ref|XP_007135053.1| hypothetical protein PHAVU_010G0977000g [Phaseolus vulgaris]
 gb|ESW07047.1| hypothetical protein PHAVU_010G0977000g [Phaseolus vulgaris]
Length=362

 Score =   128 bits (321),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  300  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  359

Query  556  YCQ  548
            YC+
Sbjct  360  YCR  362


 Score = 34.3 bits (77),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  285  FTRGIDIQAVNVVINFDFPKNSE  307



>ref|XP_010671975.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671984.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=519

 Score =   127 bits (320),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIK IPPHIDQA 
Sbjct  457  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKQIPPHIDQAY  516

Query  556  YC  551
            YC
Sbjct  517  YC  518


 Score = 34.3 bits (77),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  442  FTRGIDIQAVNVVINFDFPK  461



>ref|XP_006662493.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Oryza 
brachyantha]
Length=510

 Score =   125 bits (313),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIP  ID A+
Sbjct  448  FDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPSQIDLAV  507

Query  556  YCQ  548
            YCQ
Sbjct  508  YCQ  510


 Score = 37.0 bits (84),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  433  FTRGIDIQAVNVVINFDFPKTSE  455



>ref|XP_004492712.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cicer 
arietinum]
Length=499

 Score =   127 bits (320),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  437  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPFIDQAI  496

Query  556  YCQ  548
            YC+
Sbjct  497  YCR  499


 Score = 34.3 bits (77),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  422  FTRGIDIQAVNVVINFDFPKNSE  444



>ref|XP_010940461.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Elaeis guineensis]
Length=490

 Score =   127 bits (320),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  428  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  487

Query  556  YCQ  548
            YC+
Sbjct  488  YCR  490


 Score = 34.3 bits (77),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  413  FTRGIDIQAVNVVINFDFPKNSE  435



>gb|AES80120.2| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=523

 Score =   127 bits (320),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNL+TYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  461  FDFPKNSETYLHRVGRSGRFGHLGLAVNLVTYEDRFNLYRIEQELGTEIKQIPPFIDQAI  520

Query  556  YCQ  548
            YC+
Sbjct  521  YCR  523


 Score = 34.3 bits (77),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  446  FTRGIDIQAVNVVINFDFPKNSE  468



>gb|KHN27312.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=406

 Score =   127 bits (320),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  344  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  403

Query  556  YCQ  548
            YC+
Sbjct  404  YCR  406


 Score = 34.3 bits (77),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  329  FTRGIDIQAVNVVINFDFPK  348



>gb|KHN04659.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=484

 Score =   127 bits (319),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  422  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  481

Query  556  YCQ  548
            YC+
Sbjct  482  YCR  484


 Score = 34.3 bits (77),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  407  FTRGIDIQAVNVVINFDFPK  426



>gb|KHN04661.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=484

 Score =   127 bits (319),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  422  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  481

Query  556  YCQ  548
            YC+
Sbjct  482  YCR  484


 Score = 34.3 bits (77),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  407  FTRGIDIQAVNVVINFDFPK  426



>gb|EEC67267.1| hypothetical protein OsI_34232 [Oryza sativa Indica Group]
Length=524

 Score =   124 bits (312),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  462  FDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  521

Query  556  YCQ  548
            YCQ
Sbjct  522  YCQ  524


 Score = 37.0 bits (84),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  447  FTRGIDIQAVNVVINFDFPKTSE  469



>sp|Q109G2.2|RH12_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 12 [Oryza sativa 
Japonica Group]
 gb|AAG13612.1|AC078840_3 putative RNA helicase [Oryza sativa Japonica Group]
 gb|ABB47852.2| ATP-dependent RNA helicase ste13, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG93281.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51233.1| hypothetical protein OsJ_32082 [Oryza sativa Japonica Group]
Length=521

 Score =   124 bits (312),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  459  FDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  518

Query  556  YCQ  548
            YCQ
Sbjct  519  YCQ  521


 Score = 37.0 bits (84),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  444  FTRGIDIQAVNVVINFDFPKTSE  466



>ref|XP_003623903.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES80121.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=516

 Score =   127 bits (319),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA+
Sbjct  454  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPFIDQAV  513

Query  556  YCQ  548
            YC+
Sbjct  514  YCR  516


 Score = 34.3 bits (77),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  439  FTRGIDIQAVNVVINFDFPKNSE  461



>ref|XP_003528863.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Glycine 
max]
Length=500

 Score =   127 bits (319),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  438  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  497

Query  556  YCQ  548
            YC+
Sbjct  498  YCR  500


 Score = 34.3 bits (77),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  423  FTRGIDIQAVNVVINFDFPK  442



>gb|KHN27313.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=499

 Score =   127 bits (318),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  437  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  496

Query  556  YCQ  548
            YC+
Sbjct  497  YCR  499


 Score = 34.7 bits (78),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  422  FTRGIDIQAVNVVINFDFPK  441



>ref|XP_003521117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=499

 Score =   127 bits (318),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  437  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  496

Query  556  YCQ  548
            YC+
Sbjct  497  YCR  499


 Score = 34.7 bits (78),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  422  FTRGIDIQAVNVVINFDFPK  441



>ref|XP_003528862.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=503

 Score =   127 bits (319),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  441  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  500

Query  556  YCQ  548
            YC+
Sbjct  501  YCR  503


 Score = 34.3 bits (77),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  426  FTRGIDIQAVNVVINFDFPK  445



>ref|XP_006339542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
tuberosum]
Length=497

 Score =   127 bits (318),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAV+LIT+EDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  435  FDFPKNSETYLHRVGRSGRFGHLGLAVSLITFEDRFNLYRIEQELGTEIKQIPPQIDQAI  494

Query  556  YCQ  548
            YCQ
Sbjct  495  YCQ  497


 Score = 34.7 bits (78),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  420  FTRGIDIQAVNVVINFDFPKNSE  442



>ref|XP_006576347.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=502

 Score =   127 bits (319),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  440  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  499

Query  556  YCQ  548
            YC+
Sbjct  500  YCR  502


 Score = 34.3 bits (77),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  425  FTRGIDIQAVNVVINFDFPK  444



>gb|ABG66172.1| ATP-dependent RNA helicase ste13, putative, expressed [Oryza 
sativa Japonica Group]
Length=362

 Score =   124 bits (312),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  300  FDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  359

Query  556  YCQ  548
            YCQ
Sbjct  360  YCQ  362


 Score = 36.6 bits (83),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  285  FTRGIDIQAVNVVINFDFPKTSE  307



>emb|CDP09769.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   124 bits (312),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  442  FDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPLIDQAI  501

Query  556  YCQ  548
            YC+
Sbjct  502  YCR  504


 Score = 37.0 bits (84),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  427  FTRGIDIQAVNVVINFDFPKTSE  449



>ref|XP_006576348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X3 [Glycine max]
Length=499

 Score =   127 bits (318),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  437  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  496

Query  556  YCQ  548
            YC+
Sbjct  497  YCR  499


 Score = 34.7 bits (78),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  422  FTRGIDIQAVNVVINFDFPK  441



>ref|XP_009389244.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   127 bits (318),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  424  FDFPKNSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  483

Query  556  YCQ  548
            YC+
Sbjct  484  YCR  486


 Score = 34.3 bits (77),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  409  FTRGIDIQAVNVVINFDFPKNSE  431



>ref|XP_004229903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Solanum lycopersicum]
Length=498

 Score =   126 bits (317),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAV+LIT+EDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  436  FDFPKNSETYLHRVGRSGRFGHLGLAVSLITFEDRFNLYRIEQELGTEIKQIPPQIDQAI  495

Query  556  YCQ  548
            YCQ
Sbjct  496  YCQ  498


 Score = 34.7 bits (78),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  421  FTRGIDIQAVNVVINFDFPKNSE  443



>ref|XP_006583310.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=545

 Score =   126 bits (317),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  483  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAI  542

Query  556  YCQ  548
            YC+
Sbjct  543  YCR  545


 Score = 34.3 bits (77),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  468  FTRGIDIQAVNVVINFDFPK  487



>ref|XP_006848084.1| hypothetical protein AMTR_s00029p00205680 [Amborella trichopoda]
 gb|ERN09665.1| hypothetical protein AMTR_s00029p00205680 [Amborella trichopoda]
Length=468

 Score =   126 bits (317),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQ I
Sbjct  406  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQTI  465

Query  556  YCQ  548
            YC+
Sbjct  466  YCR  468


 Score = 34.3 bits (77),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  391  FTRGIDIQAVNVVINFDFPKNSE  413



>ref|XP_009408278.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   126 bits (316),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQ I
Sbjct  430  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQTI  489

Query  556  YCQ  548
            YC+
Sbjct  490  YCR  492


 Score = 34.7 bits (78),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  415  FTRGIDIQAVNVVINFDFPKNSE  437



>gb|ABR16163.1| unknown [Picea sitchensis]
Length=477

 Score =   126 bits (317),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEI+ IPP IDQ +
Sbjct  415  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIQQIPPQIDQTV  474

Query  556  YCQ  548
            YC+
Sbjct  475  YCR  477


 Score = 34.7 bits (78),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  400  FTRGIDIQAVNVVINFDFPK  419



>ref|XP_004982679.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
12-like [Setaria italica]
Length=505

 Score =   123 bits (309),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  443  FDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  502

Query  556  YCQ  548
            YCQ
Sbjct  503  YCQ  505


 Score = 37.0 bits (84),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  428  FTRGIDIQAVNVVINFDFPKTSE  450



>gb|EMS61023.1| DEAD-box ATP-dependent RNA helicase 8 [Triticum urartu]
Length=356

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIP
Sbjct  287  AVNVVINFDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIP  346

Query  577  PHIDQAIYCQ  548
            P ID+ IYCQ
Sbjct  347  PQIDRTIYCQ  356



>ref|NP_001150170.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 ref|XP_008677767.1| PREDICTED: ATP-dependent RNA helicase dhh1 isoform X1 [Zea mays]
 gb|ACG38116.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 tpg|DAA49386.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=503

 Score =   123 bits (309),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  441  FDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  500

Query  556  YCQ  548
            YCQ
Sbjct  501  YCQ  503


 Score = 37.0 bits (84),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  426  FTRGIDIQAVNVVINFDFPKTSE  448



>ref|XP_002464412.1| hypothetical protein SORBIDRAFT_01g017760 [Sorghum bicolor]
 gb|EER91410.1| hypothetical protein SORBIDRAFT_01g017760 [Sorghum bicolor]
Length=507

 Score =   123 bits (309),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  445  FDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  504

Query  556  YCQ  548
            YCQ
Sbjct  505  YCQ  507


 Score = 37.0 bits (84),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  430  FTRGIDIQAVNVVINFDFPKTSE  452



>ref|XP_002464413.1| hypothetical protein SORBIDRAFT_01g017770 [Sorghum bicolor]
 gb|EER91411.1| hypothetical protein SORBIDRAFT_01g017770 [Sorghum bicolor]
Length=507

 Score =   123 bits (308),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  445  FDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  504

Query  556  YCQ  548
            YCQ
Sbjct  505  YCQ  507


 Score = 37.0 bits (84),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  430  FTRGIDIQAVNVVINFDFPKTSE  452



>ref|NP_001140760.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACF84564.1| unknown [Zea mays]
 gb|ACG33781.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 gb|AFW68449.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=499

 Score =   122 bits (307),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID +I
Sbjct  437  FDFPKTSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLSI  496

Query  556  YCQ  548
            YCQ
Sbjct  497  YCQ  499


 Score = 37.0 bits (84),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +T +
Sbjct  422  FTRGIDIQAVNVVINFDFPKTSE  444



>ref|XP_008794179.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794180.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
Length=482

 Score =   125 bits (315),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA+
Sbjct  420  FDFPKNAETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAV  479

Query  556  YCQ  548
            YC+
Sbjct  480  YCR  482


 Score = 34.3 bits (77),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  405  FTRGIDIQAVNVVINFDFPK  424



>emb|CDY54061.1| BnaA02g36470D [Brassica napus]
Length=326

 Score =   125 bits (315),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDR NLY+IEQELGTEIK I PHIDQAI
Sbjct  264  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRLNLYRIEQELGTEIKQIQPHIDQAI  323

Query  556  YCQ  548
            YCQ
Sbjct  324  YCQ  326


 Score = 34.3 bits (77),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  249  FTRGIDIQAVNVVINFDFPK  268



>ref|XP_010905111.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Elaeis 
guineensis]
Length=492

 Score =   125 bits (313),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGR+GHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPP IDQAI
Sbjct  430  FDFPKNSETYLHRVGRSGRYGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPQIDQAI  489

Query  556  YCQ  548
            YC+
Sbjct  490  YCR  492


 Score = 34.7 bits (78),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  415  FTRGIDIQAVNVVINFDFPKNSE  437



>ref|XP_005831668.1| hypothetical protein GUITHDRAFT_71963 [Guillardia theta CCMP2712]
 gb|EKX44688.1| hypothetical protein GUITHDRAFT_71963 [Guillardia theta CCMP2712]
Length=407

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFPKNSETYLHRVGRSGRFGHLGLA+NLITY+DRFNLYK+EQELGTEIKPIP
Sbjct  338  SVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAINLITYDDRFNLYKVEQELGTEIKPIP  397

Query  577  PHIDQAIYC  551
            P ID+ +YC
Sbjct  398  PAIDKGLYC  406



>ref|XP_010908424.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Elaeis guineensis]
Length=482

 Score =   125 bits (313),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA+
Sbjct  420  FDFPKNAETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAV  479

Query  556  YCQ  548
            YC+
Sbjct  480  YCR  482


 Score = 34.3 bits (77),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  405  FTRGIDIQAVNVVINFDFPK  424



>ref|XP_008794547.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794548.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
Length=484

 Score =   124 bits (312),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQ I
Sbjct  422  FDFPKNSETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQTI  481

Query  556  YCQ  548
            YC+
Sbjct  482  YCR  484


 Score = 34.3 bits (77),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  407  FTRGIDIQAVNVVINFDFPKNSE  429



>ref|XP_005646927.1| cytoplasmic DExD/H-box RNA helicase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22383.1| cytoplasmic DExD/H-box RNA helicase [Coccomyxa subellipsoidea 
C-169]
Length=415

 Score =   124 bits (311),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNL++IEQELGTEIKPIPP I++ +
Sbjct  353  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLFRIEQELGTEIKPIPPVIEKTL  412

Query  556  YC  551
            YC
Sbjct  413  YC  414


 Score = 34.7 bits (78),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  338  FTRGIDIQAVNVVINFDFPKNSE  360



>gb|EMT21677.1| DEAD-box ATP-dependent RNA helicase 12 [Aegilops tauschii]
Length=515

 Score =   122 bits (306),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFN+Y+IEQELGTEIK IPP ID A 
Sbjct  453  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNMYRIEQELGTEIKTIPPQIDLAE  512

Query  556  YCQ  548
            YCQ
Sbjct  513  YCQ  515


 Score = 36.2 bits (82),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  438  FTRGIDIQAVNVVINFDFPKT  458



>gb|EYU29737.1| hypothetical protein MIMGU_mgv1a005117mg [Erythranthe guttata]
Length=496

 Score =   124 bits (311),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELG EIK IPP IDQAI
Sbjct  434  FDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGAEIKQIPPLIDQAI  493

Query  556  YC  551
            YC
Sbjct  494  YC  495


 Score = 34.3 bits (77),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  419  FTRGIDIQAVNVVINFDFPK  438



>emb|CDY48935.1| BnaA09g39020D [Brassica napus]
Length=475

 Score =   120 bits (301),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  413  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  472

Query  556  YCQ  548
            YCQ
Sbjct  473  YCQ  475


 Score = 38.1 bits (87),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  398  FTRGIDIQAVNVVINFDFPRTSE  420



>ref|NP_001065000.2| Os10g0503700 [Oryza sativa Japonica Group]
 dbj|BAF26914.2| Os10g0503700 [Oryza sativa Japonica Group]
Length=521

 Score =   124 bits (312),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+
Sbjct  459  FDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAV  518

Query  556  YCQ  548
            YCQ
Sbjct  519  YCQ  521


 Score = 33.9 bits (76),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGI IQAVNVVIN  F +T +
Sbjct  444  FTRGIGIQAVNVVINFDFPKTSE  466



>emb|CAA09203.1| RNA helicase [Arabidopsis thaliana]
Length=498

 Score =   120 bits (300),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  436  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  495

Query  556  YCQ  548
            YCQ
Sbjct  496  YCQ  498


 Score = 38.1 bits (87),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  421  FTRGIDIQAVNVVINFDFPRTSE  443



>ref|XP_002876600.1| hypothetical protein ARALYDRAFT_486601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52859.1| hypothetical protein ARALYDRAFT_486601 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   120 bits (300),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  432  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  491

Query  556  YCQ  548
            YCQ
Sbjct  492  YCQ  494


 Score = 38.5 bits (88),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  417  FTRGIDIQAVNVVINFDFPRTSE  439



>ref|XP_006290970.1| hypothetical protein CARUB_v10017085mg [Capsella rubella]
 gb|EOA23868.1| hypothetical protein CARUB_v10017085mg [Capsella rubella]
Length=494

 Score =   120 bits (300),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  432  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  491

Query  556  YCQ  548
            YCQ
Sbjct  492  YCQ  494


 Score = 38.5 bits (88),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  417  FTRGIDIQAVNVVINFDFPRTSE  439



>ref|XP_009116788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brassica rapa]
 ref|XP_009116789.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brassica rapa]
Length=473

 Score =   120 bits (300),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  411  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  470

Query  556  YCQ  548
            YCQ
Sbjct  471  YCQ  473


 Score = 38.5 bits (88),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  396  FTRGIDIQAVNVVINFDFPRTSE  418



>ref|NP_191683.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 ref|NP_974472.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 sp|Q9M2E0.1|RH12_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis 
thaliana]
 emb|CAB71054.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AAM53270.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AAN15357.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AEE80177.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 gb|AEE80178.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
Length=498

 Score =   120 bits (300),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  436  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  495

Query  556  YCQ  548
            YCQ
Sbjct  496  YCQ  498


 Score = 38.1 bits (87),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  421  FTRGIDIQAVNVVINFDFPRTSE  443



>emb|CDX71756.1| BnaC08g31180D [Brassica napus]
Length=479

 Score =   120 bits (300),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  417  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  476

Query  556  YCQ  548
            YCQ
Sbjct  477  YCQ  479


 Score = 38.1 bits (87),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  402  FTRGIDIQAVNVVINFDFPRTSE  424



>ref|XP_009104295.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Brassica 
rapa]
Length=477

 Score =   119 bits (299),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  IDQAI
Sbjct  415  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSQIDQAI  474

Query  556  YCQ  548
            YCQ
Sbjct  475  YCQ  477


 Score = 38.5 bits (88),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  400  FTRGIDIQAVNVVINFDFPRTSE  422



>ref|XP_010413440.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like isoform 
X2 [Camelina sativa]
Length=496

 Score =   120 bits (300),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  434  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  493

Query  556  YCQ  548
            YCQ
Sbjct  494  YCQ  496


 Score = 38.1 bits (87),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  419  FTRGIDIQAVNVVINFDFPRTSE  441



>ref|XP_010469048.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Camelina 
sativa]
Length=500

 Score =   119 bits (299),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  438  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  497

Query  556  YCQ  548
            YCQ
Sbjct  498  YCQ  500


 Score = 38.1 bits (87),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  423  FTRGIDIQAVNVVINFDFPRTSE  445



>ref|XP_010512458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Camelina sativa]
Length=502

 Score =   119 bits (299),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  440  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  499

Query  556  YCQ  548
            YCQ
Sbjct  500  YCQ  502


 Score = 38.1 bits (87),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  425  FTRGIDIQAVNVVINFDFPRTSE  447



>gb|KDD74992.1| DEAD/DEAH box helicase [Helicosporidium sp. ATCC 50920]
Length=370

 Score =   122 bits (306),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK+SETYLHRVGRSGRFGHLGLAVNLITY+DRFNLY+IEQELGTEIKPIPP I++++
Sbjct  308  FDFPKSSETYLHRVGRSGRFGHLGLAVNLITYDDRFNLYRIEQELGTEIKPIPPVIEKSL  367

Query  556  YC  551
            YC
Sbjct  368  YC  369


 Score = 35.8 bits (81),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F ++ +
Sbjct  293  FTRGIDIQAVNVVINFDFPKSSE  315



>ref|XP_008778709.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Phoenix dactylifera]
 ref|XP_008778717.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Phoenix dactylifera]
Length=488

 Score =   123 bits (308),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNL +IEQELGTEIK IPP IDQ I
Sbjct  426  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLNRIEQELGTEIKQIPPQIDQTI  485

Query  556  YCQ  548
            YC+
Sbjct  486  YCR  488


 Score = 34.7 bits (78),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  411  FTRGIDIQAVNVVINFDFPKNSE  433



>ref|XP_005849570.1| hypothetical protein CHLNCDRAFT_56077 [Chlorella variabilis]
 gb|EFN57468.1| hypothetical protein CHLNCDRAFT_56077 [Chlorella variabilis]
Length=390

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  763  YSSCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKP  584
            + +      FDFPKNSETYLHRVGRSGRFGHLG+A+NLITYEDRFNLYKIEQELGTEIKP
Sbjct  319  HQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGIAINLITYEDRFNLYKIEQELGTEIKP  378

Query  583  IPPHIDQAIYC  551
            IPP I++ +YC
Sbjct  379  IPPVIEKGLYC  389



>ref|XP_010513761.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Camelina 
sativa]
Length=152

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAI
Sbjct  90   FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAI  149

Query  556  YCQ  548
            YCQ
Sbjct  150  YCQ  152



>dbj|BAJ95381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88430.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   120 bits (301),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFN+Y+IEQELGTEIK IPP ID A 
Sbjct  462  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNMYRIEQELGTEIKTIPPQIDLAE  521

Query  556  YCQ  548
            YCQ
Sbjct  522  YCQ  524


 Score = 36.6 bits (83),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  447  FTRGIDIQAVNVVINFDFPKT  467



>ref|XP_006402503.1| hypothetical protein EUTSA_v10005922mg [Eutrema salsugineum]
 gb|ESQ43956.1| hypothetical protein EUTSA_v10005922mg [Eutrema salsugineum]
Length=485

 Score =   119 bits (297),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  IDQAI
Sbjct  423  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDQAI  482

Query  556  YCQ  548
            YCQ
Sbjct  483  YCQ  485


 Score = 38.1 bits (87),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  408  FTRGIDIQAVNVVINFDFPRTSE  430



>ref|XP_010234885.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brachypodium 
distachyon]
Length=523

 Score =   120 bits (300),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFN+Y+IEQELGTEIK IPP ID A 
Sbjct  461  FDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNMYRIEQELGTEIKTIPPQIDLAE  520

Query  556  YCQ  548
            YCQ
Sbjct  521  YCQ  523


 Score = 36.6 bits (83),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRT  718
            FTRGIDIQAVNVVIN  F +T
Sbjct  446  FTRGIDIQAVNVVINFDFPKT  466



>ref|XP_009400273.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400274.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   122 bits (305),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHRVGRSGRFGHLGLA+NLITYEDRFNLY+IEQELG EIK IPP ID+ I
Sbjct  430  FDFPKNSETYLHRVGRSGRFGHLGLAINLITYEDRFNLYRIEQELGAEIKQIPPQIDRTI  489

Query  556  YC  551
            YC
Sbjct  490  YC  491


 Score = 34.7 bits (78),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F +  +
Sbjct  415  FTRGIDIQAVNVVINFDFPKNSE  437



>dbj|GAC99235.1| hypothetical protein PHSY_006835 [Pseudozyma hubeiensis SY62]
Length=1755

 Score =   122 bits (307),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIP +ID+ +
Sbjct  352  FDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPSNIDKRL  411

Query  556  Y  554
            Y
Sbjct  412  Y  412


 Score = 33.5 bits (75),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIF  727
             TRGIDIQAVNVVIN  F
Sbjct  337  LTRGIDIQAVNVVINFDF  354



>gb|KDO28289.1| DEAD-box ATP-dependent RNA helicase 8 [Saprolegnia parasitica 
CBS 223.65]
Length=421

 Score =   123 bits (308),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  359  FDFPKNSETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNL  418

Query  556  YCQ  548
            YC+
Sbjct  419  YCK  421


 Score = 32.7 bits (73),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  344  FTRGIDIQTVNVVINFDFPKNSE  366



>ref|XP_008605548.1| DEAD-box ATP-dependent RNA helicase 8 [Saprolegnia diclina VS20]
 gb|EQC40704.1| DEAD-box ATP-dependent RNA helicase 8 [Saprolegnia diclina VS20]
Length=421

 Score =   123 bits (308),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  359  FDFPKNSETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNL  418

Query  556  YCQ  548
            YC+
Sbjct  419  YCK  421


 Score = 33.1 bits (74),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  344  FTRGIDIQTVNVVINFDFPKNSE  366



>ref|XP_008873462.1| DEAD-box ATP-dependent RNA helicase 6 [Aphanomyces invadans]
 gb|ETV97901.1| DEAD-box ATP-dependent RNA helicase 6 [Aphanomyces invadans]
Length=423

 Score =   123 bits (308),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  361  FDFPKNSETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNL  420

Query  556  YCQ  548
            YC+
Sbjct  421  YCK  423


 Score = 33.1 bits (74),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  346  FTRGIDIQTVNVVINFDFPKNSE  368



>ref|XP_009829781.1| DEAD-box ATP-dependent RNA helicase 8 [Aphanomyces astaci]
 gb|ETV80834.1| DEAD-box ATP-dependent RNA helicase 8 [Aphanomyces astaci]
Length=421

 Score =   123 bits (308),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  359  FDFPKNSETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNL  418

Query  556  YCQ  548
            YC+
Sbjct  419  YCK  421


 Score = 32.7 bits (73),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  344  FTRGIDIQTVNVVINFDFPKNSE  366



>ref|XP_002769152.1| ATP-dependent RNA helicase, putative [Perkinsus marinus ATCC 
50983]
 gb|EER01870.1| ATP-dependent RNA helicase, putative [Perkinsus marinus ATCC 
50983]
Length=230

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+
Sbjct  169  FDFPKNSETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEAL  228

Query  556  YC  551
            YC
Sbjct  229  YC  230



>gb|AAK63966.1| At2g45810/F4I18.21 [Arabidopsis thaliana]
 gb|AAO11625.1| At2g45810/F4I18.21 [Arabidopsis thaliana]
Length=528

 Score =   117 bits (293),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  466  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  525

Query  556  YCQ  548
            YCQ
Sbjct  526  YCQ  528


 Score = 38.5 bits (88),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  451  FTRGIDIQAVNVVINFDFPRTSE  473



>ref|NP_182105.1| DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana]
 sp|Q94BV4.2|RH6_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis 
thaliana]
 gb|AAC28543.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AEC10604.1| DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana]
Length=528

 Score =   117 bits (293),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  466  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  525

Query  556  YCQ  548
            YCQ
Sbjct  526  YCQ  528


 Score = 38.5 bits (88),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  451  FTRGIDIQAVNVVINFDFPRTSE  473



>ref|XP_002880201.1| hypothetical protein ARALYDRAFT_483719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56460.1| hypothetical protein ARALYDRAFT_483719 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   117 bits (292),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  459  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  518

Query  556  YCQ  548
            YCQ
Sbjct  519  YCQ  521


 Score = 38.5 bits (88),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  444  FTRGIDIQAVNVVINFDFPRTSE  466



>ref|XP_002909411.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
 gb|EEY58225.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
Length=411

 Score =   122 bits (306),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGR+GHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  349  FDFPKNSETYLHRIGRSGRYGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNL  408

Query  556  YCQ  548
            YC+
Sbjct  409  YCK  411


 Score = 32.7 bits (73),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  334  FTRGIDIQTVNVVINFDFPKNSE  356



>gb|EJU02445.1| DEAD-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
Length=547

 Score =   119 bits (299),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK SETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIPP ID+++
Sbjct  354  FDFPKTSETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPPDIDKSL  413

Query  556  YC  551
            Y 
Sbjct  414  YV  415


 Score = 35.0 bits (79),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +T +
Sbjct  339  LTRGIDIQAVNVVINFDFPKTSE  361



>ref|XP_009514016.1| hypothetical protein PHYSODRAFT_283996 [Phytophthora sojae]
 gb|EGZ26741.1| hypothetical protein PHYSODRAFT_283996 [Phytophthora sojae]
Length=413

 Score =   122 bits (305),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGR+GHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  351  FDFPKNSETYLHRIGRSGRYGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNL  410

Query  556  YCQ  548
            YC+
Sbjct  411  YCK  413


 Score = 32.7 bits (73),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  336  FTRGIDIQTVNVVINFDFPKNSE  358



>ref|XP_010506559.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Camelina sativa]
 ref|XP_010506560.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Camelina sativa]
Length=520

 Score =   116 bits (290),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  458  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  517

Query  556  YCQ  548
            YCQ
Sbjct  518  YCQ  520


 Score = 38.1 bits (87),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  443  FTRGIDIQAVNVVINFDFPRTSE  465



>ref|XP_010518223.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
 ref|XP_010518224.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
Length=519

 Score =   116 bits (290),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  457  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  516

Query  556  YCQ  548
            YCQ
Sbjct  517  YCQ  519


 Score = 38.1 bits (87),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  442  FTRGIDIQAVNVVINFDFPRTSE  464



>ref|XP_006397768.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39221.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=406

 Score =   116 bits (290),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  344  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  403

Query  556  YCQ  548
            YCQ
Sbjct  404  YCQ  406


 Score = 38.1 bits (87),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  329  FTRGIDIQAVNVVINFDFPRTSE  351



>ref|XP_010508105.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
 ref|XP_010508106.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
Length=520

 Score =   115 bits (289),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  458  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  517

Query  556  YCQ  548
            YCQ
Sbjct  518  YCQ  520


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  443  FTRGIDIQAVNVVINFDFPRTSE  465



>emb|CDY27357.1| BnaC04g50480D [Brassica napus]
Length=509

 Score =   115 bits (289),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  447  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  506

Query  556  YCQ  548
            YCQ
Sbjct  507  YCQ  509


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  432  FTRGIDIQAVNVVINFDFPRTSE  454



>ref|XP_006294022.1| hypothetical protein CARUB_v10023015mg [Capsella rubella]
 gb|EOA26920.1| hypothetical protein CARUB_v10023015mg [Capsella rubella]
Length=518

 Score =   115 bits (289),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  456  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  515

Query  556  YCQ  548
            YCQ
Sbjct  516  YCQ  518


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  441  FTRGIDIQAVNVVINFDFPRTSE  463



>emb|CAA09198.1| RNA helicase [Arabidopsis thaliana]
Length=145

 Score =   116 bits (291),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  83   FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  142

Query  556  YCQ  548
            YCQ
Sbjct  143  YCQ  145


 Score = 37.7 bits (86),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  68   FTRGIDIQAVNVVINFDFPRTSE  90



>emb|CDY37067.1| BnaA04g26450D [Brassica napus]
Length=510

 Score =   116 bits (290),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  448  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  507

Query  556  YCQ  548
            YCQ
Sbjct  508  YCQ  510


 Score = 38.1 bits (87),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  433  FTRGIDIQAVNVVINFDFPRTSE  455



>ref|XP_006397771.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39224.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=518

 Score =   115 bits (289),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  456  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  515

Query  556  YCQ  548
            YCQ
Sbjct  516  YCQ  518


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  441  FTRGIDIQAVNVVINFDFPRTSE  463



>emb|CDY58787.1| BnaA07g38020D [Brassica napus]
Length=482

 Score =   115 bits (289),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF + + EQELGTEIKPIP  IDQAI
Sbjct  420  FDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMCQTEQELGTEIKPIPSQIDQAI  479

Query  556  YCQ  548
            YCQ
Sbjct  480  YCQ  482


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  405  FTRGIDIQAVNVVINFDFPRTSE  427



>ref|XP_009142369.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Brassica rapa]
Length=517

 Score =   115 bits (289),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AI
Sbjct  455  FDFPRTSESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAI  514

Query  556  YCQ  548
            YCQ
Sbjct  515  YCQ  517


 Score = 38.1 bits (87),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQAVNVVIN  F RT +
Sbjct  440  FTRGIDIQAVNVVINFDFPRTSE  462



>ref|XP_005855068.1| hypothetical protein NGA_0350100, partial [Nannochloropsis gaditana 
CCMP526]
 gb|EKU21291.1| hypothetical protein NGA_0350100, partial [Nannochloropsis gaditana 
CCMP526]
Length=140

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFPK +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNL++IEQELGTEIKPIP
Sbjct  71   SVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLITYDDRFNLFRIEQELGTEIKPIP  130

Query  577  PHIDQAIYC  551
              ID+++YC
Sbjct  131  RDIDRSLYC  139



>ref|XP_002769153.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER01871.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=449

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+
Sbjct  388  FDFPKNSETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEAL  447

Query  556  YC  551
            YC
Sbjct  448  YC  449



>ref|XP_002771414.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03230.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=453

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+
Sbjct  392  FDFPKNSETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEAL  451

Query  556  YC  551
            YC
Sbjct  452  YC  453



>emb|CDY45702.1| BnaCnng13670D [Brassica napus]
Length=206

 Score =   117 bits (294),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFP+ SE+YLHRVGRSGRF HLGLA+NL+TYEDRF +Y+ EQELGTEIKPIP HIDQAI
Sbjct  144  FDFPRTSESYLHRVGRSGRFRHLGLALNLVTYEDRFKMYQTEQELGTEIKPIPSHIDQAI  203

Query  556  YCQ  548
            YCQ
Sbjct  204  YCQ  206


 Score = 36.2 bits (82),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGID QAVNVVIN  F RT +
Sbjct  129  FTRGIDTQAVNVVINFDFPRTSE  151



>ref|XP_002767329.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER00047.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=447

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+
Sbjct  386  FDFPKNSETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEAL  445

Query  556  YC  551
            YC
Sbjct  446  YC  447



>ref|XP_002771413.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03229.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=431

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+
Sbjct  370  FDFPKNSETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEAL  429

Query  556  YC  551
            YC
Sbjct  430  YC  431



>ref|XP_002767330.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER00048.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
Length=364

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+
Sbjct  303  FDFPKNSETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEAL  362

Query  556  YC  551
            YC
Sbjct  363  YC  364



>ref|XP_008913632.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
INRA-310]
 gb|ETI33717.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
P1569]
 gb|ETK74059.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETL27485.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETL80734.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETM33927.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETN01077.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
INRA-310]
 gb|ETO62499.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
P1976]
 gb|ETP03583.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
CJ01A1]
 gb|ETP31731.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
P10297]
Length=411

 Score =   120 bits (302),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGR+GHLGLA+N+ITY+DRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  349  FDFPKNSETYLHRIGRSGRYGHLGLAINMITYDDRFNLYRIEQELGTEIRPIPPVIDRNL  408

Query  556  YCQ  548
            YC+
Sbjct  409  YCK  411


 Score = 32.7 bits (73),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  334  FTRGIDIQTVNVVINFDFPKNSE  356



>ref|XP_004336605.1| atpdependent rna helicase ddx6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14592.1| atpdependent rna helicase ddx6, putative [Acanthamoeba castellanii 
str. Neff]
Length=407

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNL+KIEQELGTEIKPIP
Sbjct  337  AVNVVINFDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLFKIEQELGTEIKPIP  396

Query  577  PHIDQAIYC  551
            P ID+ +Y 
Sbjct  397  PVIDKRLYV  405



>ref|XP_002164714.2| PREDICTED: probable ATP-dependent RNA helicase DDX6-like [Hydra 
vulgaris]
Length=436

 Score =   118 bits (296),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLG+A+NLITY+DRF LY++EQELGTEIKPIPP ID+++
Sbjct  359  FDFPKNSETYLHRIGRSGRFGHLGIALNLITYDDRFTLYQVEQELGTEIKPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 34.7 bits (78),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQAVNVVIN  F +
Sbjct  344  FTRGIDIQAVNVVINFDFPK  363



>emb|CCI48817.1| unnamed protein product [Albugo candida]
Length=417

 Score =   120 bits (300),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+++ITY+DRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  355  FDFPKNSETYLHRIGRSGRFGHLGLAISMITYDDRFNLYRIEQELGTEIRPIPPVIDRNL  414

Query  556  YCQ  548
            YC+
Sbjct  415  YCK  417


 Score = 32.7 bits (73),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  340  FTRGIDIQTVNVVINFDFPKNSE  362



>ref|XP_002473400.1| eukaryotic translation initiation factor 4A-like protein [Postia 
placenta Mad-698-R]
 gb|EED81414.1| eukaryotic translation initiation factor 4A-like protein [Postia 
placenta Mad-698-R]
Length=501

 Score =   120 bits (300),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP +ID+ +
Sbjct  355  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQYIDKGL  414

Query  556  YC  551
            Y 
Sbjct  415  YV  416


 Score = 32.7 bits (73),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  340  LTRGIDIQAVNVVINFDFPK  359



>emb|CCL98213.1| predicted protein [Fibroporia radiculosa]
Length=488

 Score =   120 bits (300),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  351  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQQIDKGL  410

Query  556  YC  551
            Y 
Sbjct  411  YV  412


 Score = 32.7 bits (73),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  336  LTRGIDIQAVNVVINFDFPK  355



>emb|CCA22119.1| predicted protein putative [Albugo laibachii Nc14]
 emb|CCA23389.1| unknown putative [Albugo laibachii Nc14]
Length=417

 Score =   120 bits (300),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+++ITY+DRFNLY+IEQELGTEI+PIPP ID+ +
Sbjct  355  FDFPKNSETYLHRIGRSGRFGHLGLAISMITYDDRFNLYRIEQELGTEIRPIPPIIDRNL  414

Query  556  YCQ  548
            YC+
Sbjct  415  YCK  417


 Score = 32.7 bits (73),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
            FTRGIDIQ VNVVIN  F +  +
Sbjct  340  FTRGIDIQTVNVVINFDFPKNSE  362



>emb|CEP17217.1| hypothetical protein [Parasitella parasitica]
Length=492

 Score =   120 bits (300),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++
Sbjct  350  FDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSL  409

Query  556  YCQ*N  542
            Y   N
Sbjct  410  YVAPN  414


 Score = 32.3 bits (72),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  335  LTRGIDIQAVNVVINFDFPK  354



>ref|XP_003294872.1| hypothetical protein DICPUDRAFT_93301 [Dictyostelium purpureum]
 gb|EGC28605.1| hypothetical protein DICPUDRAFT_93301 [Dictyostelium purpureum]
Length=413

 Score =   120 bits (301),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK+SETYLHR+GRSGRFGHLGLA+NLITYEDRF+LYKIEQELGTEIKPIPP ID+++
Sbjct  351  FDFPKHSETYLHRIGRSGRFGHLGLAINLITYEDRFSLYKIEQELGTEIKPIPPVIDKSL  410

Query  556  YC  551
            Y 
Sbjct  411  YA  412


 Score = 32.0 bits (71),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQ VNVVIN  F +
Sbjct  336  FTRGIDIQDVNVVINFDFPK  355



>ref|XP_008042303.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW55033.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=503

 Score =   119 bits (299),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  353  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQQIDKGL  412

Query  556  YC  551
            Y 
Sbjct  413  YV  414


 Score = 32.7 bits (73),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  338  LTRGIDIQAVNVVINFDFPK  357



>ref|XP_629938.1| hypothetical protein DDB_G0291804 [Dictyostelium discoideum AX4]
 sp|Q54E49.1|DDX6_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx6; AltName: 
Full=DEAD box protein 6 [Dictyostelium discoideum]
 gb|EAL61523.1| hypothetical protein DDB_G0291804 [Dictyostelium discoideum AX4]
Length=423

 Score =   120 bits (300),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPK+SETYLHR+GRSGRFGHLGLA+NLITYEDRF+LYKIEQELGTEIKPIPP ID+++
Sbjct  361  FDFPKHSETYLHRIGRSGRFGHLGLAINLITYEDRFSLYKIEQELGTEIKPIPPVIDKSL  420

Query  556  YC  551
            Y 
Sbjct  421  YA  422


 Score = 32.0 bits (71),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
            FTRGIDIQ VNVVIN  F +
Sbjct  346  FTRGIDIQDVNVVINFDFPK  365



>gb|KIJ36696.1| hypothetical protein M422DRAFT_232268 [Sphaerobolus stellatus 
SS14]
Length=543

 Score =   119 bits (299),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIP  ID+++
Sbjct  351  FDFPKNSETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPTQIDKSL  410

Query  556  YC  551
            Y 
Sbjct  411  YV  412


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  336  LTRGIDIQAVNVVINFDFPKNSE  358



>ref|XP_007719915.1| ATP-dependent RNA helicase DHH1 [Capronia coronata CBS 617.96]
 gb|EXJ95686.1| ATP-dependent RNA helicase DHH1 [Capronia coronata CBS 617.96]
Length=506

 Score =   119 bits (299),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWEDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>ref|XP_011129036.1| putative DEAD box ATP-dependent RNA helicase [Gregarina niphandrodes]
 gb|EZG82130.1| putative DEAD box ATP-dependent RNA helicase [Gregarina niphandrodes]
Length=434

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFP+NSETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY++EQELGTEI+PIP
Sbjct  366  SVNVVINFDFPRNSETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRVEQELGTEIQPIP  425

Query  577  PHIDQAIY  554
             H+D A+Y
Sbjct  426  SHVDTALY  433



>gb|KIO14251.1| hypothetical protein M404DRAFT_12103 [Pisolithus tinctorius Marx 
270]
Length=490

 Score =   119 bits (299),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGH GLA+NL+TYEDRFNLY+IEQELGTEI+PIP HID+++
Sbjct  359  FDFPKNSETYLHRIGRSGRFGHFGLAINLVTYEDRFNLYRIEQELGTEIQPIPQHIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  344  LTRGIDIQAVNVVINFDFPKNSE  366



>ref|XP_001881258.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR08188.1| predicted protein [Laccaria bicolor S238N-H82]
Length=442

 Score =   119 bits (299),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP +ID+ +
Sbjct  340  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQNIDRGL  399

Query  556  YC  551
            Y 
Sbjct  400  YV  401


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  325  LTRGIDIQAVNVVINFDFPKNSE  347



>gb|EMD35619.1| hypothetical protein CERSUDRAFT_96734 [Ceriporiopsis subvermispora 
B]
Length=502

 Score =   119 bits (298),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  357  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDKGL  416

Query  556  YC  551
            Y 
Sbjct  417  YV  418


 Score = 32.7 bits (73),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  342  LTRGIDIQAVNVVINFDFPK  361



>ref|XP_007731184.1| ATP-dependent RNA helicase DHH1 [Capronia epimyces CBS 606.96]
 gb|EXJ89787.1| ATP-dependent RNA helicase DHH1 [Capronia epimyces CBS 606.96]
Length=510

 Score =   119 bits (298),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWEDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>dbj|GAN04011.1| eukaryotic translation initiation factor 4A-like protein [Mucor 
ambiguus]
Length=520

 Score =   119 bits (299),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +
Sbjct  350  FDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKNL  409

Query  556  YCQ*N  542
            Y   N
Sbjct  410  YVAPN  414


 Score = 32.3 bits (72),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  335  LTRGIDIQAVNVVINFDFPK  354



>ref|XP_007272025.1| DEAD-domain-containing protein [Fomitiporia mediterranea MF3/22]
 gb|EJC97706.1| DEAD-domain-containing protein [Fomitiporia mediterranea MF3/22]
Length=533

 Score =   119 bits (298),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGR+GHLGLA+NLITYEDRFNLYKIEQELGTEI+PIP  ID+++
Sbjct  357  FDFPKNSETYLHRIGRSGRYGHLGLAINLITYEDRFNLYKIEQELGTEIQPIPAQIDRSL  416

Query  556  YC  551
            Y 
Sbjct  417  YV  418


 Score = 32.7 bits (73),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  342  LTRGIDIQAVNVVINFDFPKNSE  364



>gb|EPB84122.1| ATP-dependent RNA helicase DHH1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=513

 Score =   119 bits (299),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +
Sbjct  350  FDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKNL  409

Query  556  YCQ*N  542
            Y   N
Sbjct  410  YVAPN  414


 Score = 32.3 bits (72),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  335  LTRGIDIQAVNVVINFDFPK  354



>ref|XP_007384334.1| DEAD-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN08382.1| DEAD-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=505

 Score =   119 bits (298),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+++
Sbjct  351  FDFPKNAETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPAQIDRSL  410

Query  556  YC  551
            Y 
Sbjct  411  YV  412


 Score = 32.3 bits (72),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  336  LTRGIDIQAVNVVINFDFPK  355



>ref|XP_001832628.1| ATP-dependent RNA helicase dhh1 [Coprinopsis cinerea okayama7#130]
 gb|EAU89171.1| ATP-dependent RNA helicase dhh1 [Coprinopsis cinerea okayama7#130]
Length=509

 Score =   119 bits (298),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+++
Sbjct  354  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQSIDRSL  413

Query  556  YCQ*N  542
            Y   N
Sbjct  414  YVAPN  418


 Score = 32.3 bits (72),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  339  LTRGIDIQAVNVVINFDFPKNSE  361



>ref|XP_009268120.1| ATP-dependent RNA helicase dhh1 [Wallemia ichthyophaga EXF-994]
 gb|EOR00843.1| ATP-dependent RNA helicase dhh1 [Wallemia ichthyophaga EXF-994]
Length=495

 Score =   119 bits (298),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGR+GHLGLA+NLITYEDRFNLYKIEQELGTEI+PIP  ID+++
Sbjct  348  FDFPKNSETYLHRIGRSGRYGHLGLAINLITYEDRFNLYKIEQELGTEIQPIPSQIDRSL  407

Query  556  YCQ*N  542
            Y   N
Sbjct  408  YVAPN  412


 Score = 32.3 bits (72),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  333  LTRGIDIQAVNVVINFDFPKNSE  355



>ref|XP_007301961.1| DEAD-domain-containing protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM89042.1| DEAD-domain-containing protein [Stereum hirsutum FP-91666 SS1]
Length=538

 Score =   119 bits (298),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  358  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDKGL  417

Query  556  YC  551
            Y 
Sbjct  418  YV  419


 Score = 32.3 bits (72),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  343  LTRGIDIQAVNVVINFDFPKNSE  365



>gb|KIM70603.1| hypothetical protein SCLCIDRAFT_156787 [Scleroderma citrinum 
Foug A]
Length=490

 Score =   119 bits (297),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP +ID+++
Sbjct  359  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIPQYIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.7 bits (73),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>gb|KJA23157.1| hypothetical protein HYPSUDRAFT_138278 [Hypholoma sublateritium 
FD-334 SS-4]
Length=491

 Score =   119 bits (297),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  354  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQSIDRGL  413

Query  556  YC  551
            Y 
Sbjct  414  YV  415


 Score = 32.3 bits (72),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  339  LTRGIDIQAVNVVINFDFPKNSE  361



>emb|CDO74578.1| hypothetical protein BN946_scf184583.g5 [Trametes cinnabarina]
Length=494

 Score =   119 bits (297),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  353  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDKGL  412

Query  556  YC  551
            Y 
Sbjct  413  YV  414


 Score = 32.7 bits (73),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  338  LTRGIDIQAVNVVINFDFPK  357



>gb|KIJ98785.1| hypothetical protein K443DRAFT_194552 [Laccaria amethystina LaAM-08-1]
Length=480

 Score =   119 bits (297),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP +ID+ +
Sbjct  354  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQNIDRGL  413

Query  556  YC  551
            Y 
Sbjct  414  YV  415


 Score = 32.3 bits (72),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  339  LTRGIDIQAVNVVINFDFPKNSE  361



>emb|CCO29368.1| ATP-dependent RNA helicase DDX6/DHH1 [Rhizoctonia solani AG-1 
IB]
Length=159

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPK+SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP
Sbjct  21   AVNVVINFDFPKHSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIP  80

Query  577  PHIDQAIYC  551
              I++++Y 
Sbjct  81   TEINKSLYV  89



>gb|EHA20131.1| hypothetical protein ASPNIDRAFT_209198 [Aspergillus niger ATCC 
1015]
Length=1445

 Score =   117 bits (294),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -3

Query  736   FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
             FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLYKIEQELGTEI+PIP +ID+ +
Sbjct  1299  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWEDRFNLYKIEQELGTEIQPIPQNIDKKL  1358

Query  556   Y  554
             Y
Sbjct  1359  Y  1359


 Score = 33.5 bits (75),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -1

Query  780   FTRGIDIQAVNVVINLIF  727
              TRGIDIQAVNVVIN  F
Sbjct  1284  LTRGIDIQAVNVVINFDF  1301



>emb|CEI85652.1| Putative DEAD/DEAH box helicase [Rhizopus microsporus]
Length=498

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIP
Sbjct  332  AVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIP  391

Query  577  PHIDQAIYCQ*N  542
            P ID+++Y   N
Sbjct  392  PVIDKSLYVAPN  403



>ref|XP_007331967.1| hypothetical protein AGABI1DRAFT_115242 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM77310.1| hypothetical protein AGABI1DRAFT_115242 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=500

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  351  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDRTL  410

Query  556  YC  551
            Y 
Sbjct  411  YV  412


 Score = 32.7 bits (73),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  336  LTRGIDIQAVNVVINFDFPK  355



>emb|CEG81286.1| Putative Atp-dependent rna helicase dhh1 [Rhizopus microsporus]
Length=501

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIP
Sbjct  342  AVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIP  401

Query  577  PHIDQAIYCQ*N  542
            P ID+++Y   N
Sbjct  402  PVIDKSLYVAPN  413



>ref|XP_007367461.1| eukaryotic translation initiation factor 4A-like protein [Dichomitus 
squalens LYAD-421 SS1]
 gb|EJF59749.1| eukaryotic translation initiation factor 4A-like protein [Dichomitus 
squalens LYAD-421 SS1]
Length=498

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  353  FDFPKNAETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQQIDKGL  412

Query  556  YC  551
            Y 
Sbjct  413  YV  414


 Score = 32.7 bits (73),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  338  LTRGIDIQAVNVVINFDFPK  357



>ref|XP_009549682.1| hypothetical protein HETIRDRAFT_67389 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78030.1| hypothetical protein HETIRDRAFT_67389 [Heterobasidion irregulare 
TC 32-1]
Length=487

 Score =   119 bits (297),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  353  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPHQIDKGL  412

Query  556  YC  551
            Y 
Sbjct  413  YV  414


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  338  LTRGIDIQAVNVVINFDFPKNSE  360



>gb|KIW14976.1| ATP-dependent RNA helicase DHH1 [Exophiala spinifera]
Length=512

 Score =   119 bits (297),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>gb|KDQ58786.1| hypothetical protein JAAARDRAFT_34642 [Jaapia argillacea MUCL 
33604]
Length=541

 Score =   119 bits (297),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRF+LYKIEQELGTEI+PIP  ID+A+
Sbjct  356  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFSLYKIEQELGTEIQPIPQFIDKAL  415

Query  556  YC  551
            Y 
Sbjct  416  YV  417


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  341  LTRGIDIQAVNVVINFDFPKNSE  363



>emb|CEG63343.1| Putative Atp-dependent rna helicase dhh1 [Rhizopus microsporus]
Length=508

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIP
Sbjct  342  AVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIP  401

Query  577  PHIDQAIYCQ*N  542
            P ID+++Y   N
Sbjct  402  PVIDKSLYVAPN  413



>gb|EPS95261.1| hypothetical protein FOMPIDRAFT_101552 [Fomitopsis pinicola FP-58527 
SS1]
Length=490

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  351  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQVIDKGL  410

Query  556  YC  551
            Y 
Sbjct  411  YV  412


 Score = 32.7 bits (73),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  336  LTRGIDIQAVNVVINFDFPKNSE  358



>gb|KEQ91251.1| hypothetical protein AUEXF2481DRAFT_70100 [Aureobasidium subglaciale 
EXF-2481]
Length=537

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLY+IEQELGTEIKPIP HID+ +
Sbjct  360  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWEDRFNLYRIEQELGTEIKPIPQHIDKGL  419

Query  556  YC  551
            Y 
Sbjct  420  YV  421


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  345  LTRGIDIQAVNVVINFDFPK  364



>gb|EIE82813.1| ATP-dependent RNA helicase dhh1 [Rhizopus delemar RA 99-880]
Length=453

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIP
Sbjct  327  AVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIP  386

Query  577  PHIDQAIYCQ*N  542
            P ID+ +Y   N
Sbjct  387  PVIDKQLYVAPN  398



>ref|XP_006463363.1| hypothetical protein AGABI2DRAFT_194203 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45218.1| hypothetical protein AGABI2DRAFT_194203 [Agaricus bisporus var. 
bisporus H97]
Length=506

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  357  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDRTL  416

Query  556  YC  551
            Y 
Sbjct  417  YV  418


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  342  LTRGIDIQAVNVVINFDFPKNSE  364



>gb|ESA01456.1| hypothetical protein GLOINDRAFT_333744 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX61432.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX61433.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX61434.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
Length=490

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITY+DRFNLYKIEQELGTEI+PIPP ID+ +
Sbjct  357  FDFPKNAETYLHRIGRSGRFGHLGLAINLITYDDRFNLYKIEQELGTEIQPIPPVIDKRL  416

Query  556  YC  551
            Y 
Sbjct  417  YV  418


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  342  LTRGIDIQAVNVVINFDFPK  361



>gb|KIV96660.1| ATP-dependent RNA helicase DHH1 [Exophiala mesophila]
Length=512

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>ref|XP_007869359.1| eukaryotic translation initiation factor 4A-like protein [Gloeophyllum 
trabeum ATCC 11539]
 gb|EPQ52176.1| eukaryotic translation initiation factor 4A-like protein [Gloeophyllum 
trabeum ATCC 11539]
Length=509

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  356  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPSTIDKRL  415

Query  556  YC  551
            Y 
Sbjct  416  YV  417


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  341  LTRGIDIQAVNVVINFDFPK  360



>gb|EPB90373.1| ATP-dependent RNA helicase dhh1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=499

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIP
Sbjct  343  AVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIP  402

Query  577  PHIDQAIYCQ*N  542
            P ID+++Y   N
Sbjct  403  PVIDKSLYVAPN  414



>gb|KEQ69618.1| DEAD-domain-containing protein [Aureobasidium pullulans var. 
namibiae CBS 147.97]
Length=536

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLY+IEQELGTEIKPIP HID+ +
Sbjct  360  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWEDRFNLYRIEQELGTEIKPIPQHIDKGL  419

Query  556  YC  551
            Y 
Sbjct  420  YV  421


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  345  LTRGIDIQAVNVVINFDFPK  364



>ref|XP_009158872.1| ATP-dependent RNA helicase dhh1 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY58411.1| ATP-dependent RNA helicase dhh1 [Exophiala dermatitidis NIH/UT8656]
Length=506

 Score =   118 bits (296),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>gb|KIV81870.1| ATP-dependent RNA helicase dhh1 [Exophiala sideris]
Length=506

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>ref|XP_003062040.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53752.1| predicted protein [Micromonas pusilla CCMP1545]
Length=362

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFPKNSETYLHRVGRSGRFGHLG++VNLITY+DRFNL++IEQELGTEI+ IP
Sbjct  293  SVNVVINFDFPKNSETYLHRVGRSGRFGHLGISVNLITYDDRFNLFRIEQELGTEIQQIP  352

Query  577  PHIDQAIYCQ  548
            P ID ++YC+
Sbjct  353  PVIDPSVYCR  362



>ref|XP_002951166.1| DEAD-box RNA helicase, ATP-dependent, cytoplasmic [Volvox carteri 
f. nagariensis]
 gb|EFJ47695.1| DEAD-box RNA helicase, ATP-dependent, cytoplasmic [Volvox carteri 
f. nagariensis]
Length=406

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITY+DR NL+KIEQELGTEIKPIP
Sbjct  337  SVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYDDRINLFKIEQELGTEIKPIP  396

Query  577  PHIDQAIYC  551
              I++ +YC
Sbjct  397  AQIEEKLYC  405



>gb|KIW61171.1| ATP-dependent RNA helicase dhh1 [Exophiala xenobiotica]
Length=517

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.3 bits (72),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>gb|KEF62095.1| ATP-dependent RNA helicase DHH1 [Exophiala aquamarina CBS 119918]
Length=517

 Score =   118 bits (295),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++
Sbjct  359  FDFPKNAETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSL  418

Query  556  YC  551
            Y 
Sbjct  419  YV  420


 Score = 32.7 bits (73),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  344  LTRGIDIQAVNVVINFDFPK  363



>ref|XP_001692202.1| cytoplasmic DExD/H-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP04152.1| cytoplasmic DExD/H-box RNA helicase [Chlamydomonas reinhardtii]
Length=405

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            S      FDFPKN+ETYLHRVGRSGRFGHLGLAVNLITY+DR NL+KIEQELGTEIKPIP
Sbjct  336  SVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYDDRINLFKIEQELGTEIKPIP  395

Query  577  PHIDQAIYC  551
              I++ +YC
Sbjct  396  AQIEEKLYC  404



>dbj|GAN00930.1| conserved hypothetical protein [Mucor ambiguus]
Length=491

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  757  SCQCCDKFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIP  578
            +      FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIP
Sbjct  343  AVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIP  402

Query  577  PHIDQAIYCQ*N  542
            P ID+++Y   N
Sbjct  403  PVIDKSLYVAPN  414



>gb|KDR80281.1| hypothetical protein GALMADRAFT_136789 [Galerina marginata CBS 
339.88]
Length=496

 Score =   118 bits (295),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +
Sbjct  355  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDRGL  414

Query  556  YC  551
            Y 
Sbjct  415  YV  416


 Score = 32.3 bits (72),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  340  LTRGIDIQAVNVVINFDFPKNSE  362



>gb|KIK36386.1| hypothetical protein CY34DRAFT_811305 [Suillus luteus UH-Slu-Lm8-n1]
Length=494

 Score =   118 bits (295),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP  ID+ +
Sbjct  360  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIPQAIDKGL  419

Query  556  YC  551
            Y 
Sbjct  420  YV  421


 Score = 32.3 bits (72),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  345  LTRGIDIQAVNVVINFDFPKNSE  367



>gb|KIM91499.1| hypothetical protein PILCRDRAFT_669 [Piloderma croceum F 1598]
Length=493

 Score =   118 bits (295),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKNSETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP  ID+ +
Sbjct  354  FDFPKNSETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIPQTIDKGL  413

Query  556  YC  551
            Y 
Sbjct  414  YV  415


 Score = 32.3 bits (72),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLRTQK  712
             TRGIDIQAVNVVIN  F +  +
Sbjct  339  LTRGIDIQAVNVVINFDFPKNSE  361



>gb|EST04933.1| ATP-dependent RNA helicase [Pseudozyma brasiliensis GHG001]
Length=488

 Score =   118 bits (295),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  FDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAI  557
            FDFPKN+ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIP +ID+ +
Sbjct  352  FDFPKNAETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPSNIDKRL  411

Query  556  YC  551
            Y 
Sbjct  412  YV  413


 Score = 32.3 bits (72),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -1

Query  780  FTRGIDIQAVNVVINLIFLR  721
             TRGIDIQAVNVVIN  F +
Sbjct  337  LTRGIDIQAVNVVINFDFPK  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940