BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049P14

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    338   3e-113   Nicotiana sylvestris
emb|CAA56601.1|  36kDa porin I                                          338   6e-113   Solanum tuberosum [potatoes]
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    337   6e-113   Solanum tuberosum [potatoes]
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    337   8e-113   Nicotiana tomentosiformis
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    337   1e-112   Solanum lycopersicum
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    330   7e-110   Nicotiana sylvestris
emb|CDP00288.1|  unnamed protein product                                329   1e-109   Coffea canephora [robusta coffee]
emb|CDP00287.1|  unnamed protein product                                328   2e-109   Coffea canephora [robusta coffee]
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    325   7e-108   Nicotiana tomentosiformis
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    323   2e-107   Eucalyptus grandis [rose gum]
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    322   8e-107   Morus notabilis
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             320   5e-106   Citrus clementina [clementine]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    319   1e-105   Citrus sinensis [apfelsine]
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    319   1e-105   Sesamum indicum [beniseed]
gb|KJB50697.1|  hypothetical protein B456_008G182700                    317   1e-105   Gossypium raimondii
ref|XP_002312708.1|  porin family protein                               319   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    318   2e-105   Vitis vinifera
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    318   2e-105   Populus euphratica
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            318   3e-105   Gossypium arboreum [tree cotton]
gb|KJB30018.1|  hypothetical protein B456_005G139100                    317   7e-105   Gossypium raimondii
gb|KJB30017.1|  hypothetical protein B456_005G139100                    316   8e-105   Gossypium raimondii
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            316   1e-104   Gossypium arboreum [tree cotton]
gb|KJB50696.1|  hypothetical protein B456_008G182700                    316   1e-104   Gossypium raimondii
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            315   4e-104   Gossypium arboreum [tree cotton]
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    313   2e-103   
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    313   2e-103   Sesamum indicum [beniseed]
ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    313   2e-103   Morus notabilis
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    313   3e-103   Prunus mume [ume]
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    313   3e-103   Ricinus communis
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    313   4e-103   Cucumis melo [Oriental melon]
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    313   4e-103   Malus domestica [apple tree]
gb|AAD38145.1|AF139498_1  porin                                         312   6e-103   Prunus armeniaca
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    312   7e-103   Nelumbo nucifera [Indian lotus]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    311   1e-102   Gossypium raimondii
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    311   2e-102   
ref|XP_006378154.1|  porin family protein                               311   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    310   3e-102   Pyrus x bretschneideri [bai li]
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    310   5e-102   Tarenaya hassleriana [spider flower]
gb|AID59897.1|  voltage-dependent anion channel protein                 309   8e-102   Prunus persica
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    309   8e-102   Tarenaya hassleriana [spider flower]
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    309   1e-101   Cucumis melo [Oriental melon]
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    308   2e-101   Populus euphratica
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             311   2e-101   
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    308   2e-101   Cucumis sativus [cucumbers]
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    307   7e-101   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         307   8e-101   Jatropha curcas
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                306   2e-100   Erythranthe guttata [common monkey flower]
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                305   4e-100   Erythranthe guttata [common monkey flower]
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       307   4e-100   
emb|CDP02196.1|  unnamed protein product                                305   4e-100   Coffea canephora [robusta coffee]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    305   4e-100   Glycine max [soybeans]
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            304   7e-100   Gossypium arboreum [tree cotton]
gb|AAA96275.1|  voltage-dependent anion channel protein                 304   9e-100   Spinacia oleracea
gb|KHN13242.1|  Outer plastidial membrane protein porin                 304   9e-100   Glycine soja [wild soybean]
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        304   1e-99    Theobroma cacao [chocolate]
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    303   2e-99    Glycine soja [wild soybean]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    303   3e-99    Malus domestica [apple tree]
gb|KJB33661.1|  hypothetical protein B456_006G024700                    303   3e-99    Gossypium raimondii
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    303   3e-99    Nicotiana sylvestris
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          303   3e-99    Amborella trichopoda
ref|XP_007032450.1|  Voltage dependent anion channel 1                  303   3e-99    
gb|AAQ87019.1|  VDAC1.1                                                 303   3e-99    Lotus japonicus
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    303   3e-99    Glycine max [soybeans]
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    302   4e-99    Prunus mume [ume]
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    302   5e-99    Nicotiana tomentosiformis
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    301   8e-99    Fragaria vesca subsp. vesca
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             303   1e-98    
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    301   2e-98    Malus domestica [apple tree]
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    299   7e-98    Vitis vinifera
gb|KHN11584.1|  Outer plastidial membrane protein porin                 299   8e-98    Glycine soja [wild soybean]
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    299   1e-97    Glycine max [soybeans]
gb|AFK39621.1|  unknown                                                 299   1e-97    Lotus japonicus
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    298   1e-97    Nelumbo nucifera [Indian lotus]
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    298   1e-97    Phaseolus coccineus [scarlet runner bean]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    298   2e-97    Glycine max [soybeans]
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    298   2e-97    Solanum tuberosum [potatoes]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    298   2e-97    Solanum lycopersicum
gb|AAQ87021.1|  VDAC1.3                                                 298   2e-97    Lotus japonicus
gb|ACU20122.1|  unknown                                                 297   5e-97    Glycine max [soybeans]
gb|AAQ87020.1|  VDAC1.2                                                 296   1e-96    Lotus japonicus
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    295   2e-96    Nicotiana tomentosiformis
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    294   3e-96    Gossypium arboreum [tree cotton]
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    295   4e-96    Nicotiana sylvestris
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             295   4e-96    Phaseolus vulgaris [French bean]
gb|AAB38498.1|  porin                                                   295   5e-96    Mesembryanthemum crystallinum
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             294   6e-96    Phaseolus vulgaris [French bean]
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            294   7e-96    Gossypium arboreum [tree cotton]
gb|AFK40985.1|  unknown                                                 294   8e-96    Lotus japonicus
gb|ACU24178.1|  unknown                                                 294   9e-96    Glycine max [soybeans]
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    294   9e-96    Sesamum indicum [beniseed]
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     293   1e-95    Eucalyptus grandis [rose gum]
dbj|BAF95070.1|  voltage-dependent anion channel                        293   1e-95    Nicotiana tabacum [American tobacco]
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    293   1e-95    Solanum tuberosum [potatoes]
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    292   3e-95    Sesamum indicum [beniseed]
gb|KJB11405.1|  hypothetical protein B456_001G256800                    290   3e-95    Gossypium raimondii
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    295   4e-95    Gossypium arboreum [tree cotton]
gb|AIL25718.1|  voltage-dependent anion channel                         292   5e-95    Nicotiana tabacum [American tobacco]
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                292   5e-95    Erythranthe guttata [common monkey flower]
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    292   5e-95    Elaeis guineensis
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            291   1e-94    Solanum tuberosum [potatoes]
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    291   2e-94    Eucalyptus grandis [rose gum]
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    291   2e-94    Elaeis guineensis
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    290   2e-94    Glycine max [soybeans]
gb|KJB11404.1|  hypothetical protein B456_001G256800                    290   2e-94    Gossypium raimondii
gb|KJB11402.1|  hypothetical protein B456_001G256800                    290   2e-94    Gossypium raimondii
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    290   3e-94    Sesamum indicum [beniseed]
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    290   3e-94    Solanum lycopersicum
ref|NP_001241054.1|  uncharacterized protein LOC100805016               290   3e-94    Glycine max [soybeans]
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    290   4e-94    Fragaria vesca subsp. vesca
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    290   4e-94    Eucalyptus grandis [rose gum]
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    289   6e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS57816.1|  hypothetical protein M569_17001                         287   4e-93    Genlisea aurea
gb|EPS68383.1|  hypothetical protein M569_06388                         287   4e-93    Genlisea aurea
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    286   6e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    286   8e-93    Citrus sinensis [apfelsine]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             286   8e-93    
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    286   1e-92    Phoenix dactylifera
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    286   1e-92    Elaeis guineensis
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             286   2e-92    
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    285   2e-92    Phoenix dactylifera
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             285   4e-92    
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             284   7e-92    Citrus clementina [clementine]
emb|CDY66736.1|  BnaCnng52100D                                          284   8e-92    Brassica napus [oilseed rape]
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    283   1e-91    Brassica rapa
ref|NP_186777.1|  voltage dependent anion channel 1                     283   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             285   2e-91    
emb|CDY28690.1|  BnaCnng05760D                                          283   2e-91    Brassica napus [oilseed rape]
emb|CDY63765.1|  BnaCnng42590D                                          283   2e-91    Brassica napus [oilseed rape]
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    283   2e-91    Brassica rapa
gb|AAM65525.1|  putative porin                                          283   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    283   2e-91    Arabis alpina [alpine rockcress]
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             282   3e-91    Populus trichocarpa [western balsam poplar]
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                282   3e-91    Erythranthe guttata [common monkey flower]
emb|CDX85566.1|  BnaA02g02470D                                          281   5e-91    
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    281   6e-91    Populus euphratica
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    281   7e-91    Brassica rapa
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    281   1e-90    Cicer arietinum [garbanzo]
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    281   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    280   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       280   3e-90    Brassica rapa
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    280   3e-90    Camelina sativa [gold-of-pleasure]
emb|CDY68122.1|  BnaA05g37480D                                          280   3e-90    Brassica napus [oilseed rape]
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    280   4e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         279   4e-90    Jatropha curcas
gb|KJB11403.1|  hypothetical protein B456_001G256800                    279   7e-90    Gossypium raimondii
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    279   7e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    278   9e-90    Phoenix dactylifera
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            278   2e-89    Brassica napus [oilseed rape]
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    278   2e-89    Setaria italica
gb|ABB02635.1|  unknown                                                 273   4e-89    Solanum tuberosum [potatoes]
emb|CDX91952.1|  BnaC03g32540D                                          276   5e-89    
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    276   7e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    276   7e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    276   8e-89    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX74294.1|  BnaA03g27530D                                          276   9e-89    
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    275   1e-88    Brassica rapa
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      275   1e-88    Brachypodium distachyon [annual false brome]
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    275   3e-88    Cicer arietinum [garbanzo]
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    274   4e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          274   4e-88    Sorghum bicolor [broomcorn]
gb|ABK24200.1|  unknown                                                 274   5e-88    Picea sitchensis
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          274   5e-88    Zea mays [maize]
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    273   8e-88    Oryza brachyantha
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             273   1e-87    Capsella rubella
emb|CDY59668.1|  BnaCnng35410D                                          273   1e-87    Brassica napus [oilseed rape]
gb|ACJ85279.1|  unknown                                                 273   1e-87    Medicago truncatula
gb|ACF85328.1|  unknown                                                 273   2e-87    Zea mays [maize]
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             272   3e-87    Eutrema salsugineum [saltwater cress]
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    272   3e-87    Camelina sativa [gold-of-pleasure]
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          271   7e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062983.1|  Os09g0361400                                       271   1e-86    
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    271   1e-86    Arabidopsis lyrata subsp. lyrata
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    270   1e-86    
gb|EAZ08792.1|  hypothetical protein OsI_31052                          270   3e-86    Oryza sativa Indica Group [Indian rice]
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          269   4e-86    
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    269   6e-86    Brassica rapa
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    268   9e-86    Pisum sativum [garden pea]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    268   1e-85    Triticum aestivum [Canadian hard winter wheat]
gb|AAS48868.1|  voltage-dependent anion-selective channel               268   1e-85    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    267   2e-85    Cicer arietinum [garbanzo]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    266   4e-85    Arabis alpina [alpine rockcress]
ref|NP_001043433.1|  Os01g0588200                                       265   2e-84    
gb|AFK34190.1|  unknown                                                 265   2e-84    Medicago truncatula
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    262   3e-83    Oryza brachyantha
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    262   3e-83    Ricinus communis
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    261   7e-83    Brachypodium distachyon [annual false brome]
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    260   1e-82    Setaria italica
emb|CDM83072.1|  unnamed protein product                                258   1e-81    Triticum aestivum [Canadian hard winter wheat]
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    258   1e-81    Medicago truncatula
dbj|BAJ99489.1|  predicted protein                                      257   2e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
pir||B55017  porin, plastid - garden pea                                255   1e-80    Pisum sativum [garden pea]
gb|EMS47295.1|  Outer plastidial membrane protein porin                 255   2e-80    Triticum urartu
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          255   2e-80    Sorghum bicolor [broomcorn]
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 254   2e-80    Triticum aestivum [Canadian hard winter wheat]
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    252   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141587.1|  outer plastidial membrane protein porin            252   2e-79    Zea mays [maize]
ref|NP_197013.1|  voltage dependent anion channel 3                     252   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    251   4e-79    Setaria italica
gb|ACG25664.1|  outer plastidial membrane protein porin                 251   4e-79    Zea mays [maize]
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    250   9e-79    Zea mays [maize]
gb|ACG45954.1|  outer plastidial membrane protein porin                 250   1e-78    Zea mays [maize]
gb|AFW83107.1|  outer plastidial membrane protein porin                 250   1e-78    
ref|NP_001278544.1|  outer plastidial membrane protein porin            249   4e-78    
gb|KJB30164.1|  hypothetical protein B456_005G132100                    250   7e-78    Gossypium raimondii
ref|NP_001056162.1|  Os05g0536200                                       246   6e-77    
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          246   6e-77    Sorghum bicolor [broomcorn]
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    245   9e-77    Setaria italica
ref|NP_001104949.1|  voltage-dependent anion channel protein2           245   1e-76    Zea mays [maize]
gb|KJB31318.1|  hypothetical protein B456_005G186100                    244   1e-76    Gossypium raimondii
gb|ADE76112.1|  unknown                                                 241   1e-76    Picea sitchensis
emb|CBI32017.3|  unnamed protein product                                243   2e-76    Vitis vinifera
gb|AFW82970.1|  outer membrane protein porin                            242   2e-76    
gb|EEC71387.1|  hypothetical protein OsI_03508                          245   2e-76    Oryza sativa Indica Group [Indian rice]
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    246   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044063.2|  Os01g0715500                                       245   4e-76    
ref|XP_003621109.1|  Outer plastidial membrane protein porin            243   5e-76    Medicago truncatula
gb|ACJ85253.1|  unknown                                                 243   5e-76    Medicago truncatula
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                    242   5e-76    
gb|EMS51310.1|  Mitochondrial outer membrane porin                      251   3e-75    Triticum urartu
gb|AFK38338.1|  unknown                                                 241   5e-75    Medicago truncatula
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    241   5e-75    Oryza brachyantha
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 239   1e-74    Triticum aestivum [Canadian hard winter wheat]
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa            236   4e-74    Gossypium arboreum [tree cotton]
gb|EMT02908.1|  Mitochondrial outer membrane porin                      249   6e-74    
dbj|BAJ99317.1|  predicted protein                                      236   3e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         235   2e-72    Zea mays [maize]
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    233   8e-72    Brachypodium distachyon [annual false brome]
dbj|BAD87377.1|  putative 36kDA porin II                                234   4e-71    Oryza sativa Japonica Group [Japonica rice]
gb|KJB29688.1|  hypothetical protein B456_005G114000                    228   5e-71    Gossypium raimondii
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    232   6e-71    Brachypodium distachyon [annual false brome]
gb|EMT20213.1|  Mitochondrial outer membrane porin                      243   2e-70    
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              243   2e-70    Triticum urartu
gb|ABK23226.1|  unknown                                                 227   1e-69    Picea sitchensis
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          224   2e-68    Sorghum bicolor [broomcorn]
ref|XP_001781995.1|  predicted protein                                  223   3e-68    
ref|XP_001779057.1|  predicted protein                                  221   4e-67    
emb|CDY70638.1|  BnaCnng69120D                                          218   2e-66    Brassica napus [oilseed rape]
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             218   3e-66    Selaginella moellendorffii
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             217   1e-65    Selaginella moellendorffii
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    212   7e-64    
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    212   7e-64    Elaeis guineensis
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    211   1e-63    Cucumis melo [Oriental melon]
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    213   1e-63    Oryza brachyantha
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...    210   2e-63    
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    210   4e-63    Cucumis sativus [cucumbers]
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             209   8e-63    Selaginella moellendorffii
emb|CAJ42303.1|  VDAC-like porin                                        209   8e-63    Plantago major [cart-track plant]
gb|ADE77918.1|  unknown                                                 209   1e-62    Picea sitchensis
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    207   4e-62    
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    207   5e-62    Phoenix dactylifera
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    204   1e-60    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006826372.1|  hypothetical protein AMTR_s00004p00132460          199   2e-60    
gb|EYU34672.1|  hypothetical protein MIMGU_mgv1a021682mg                197   7e-60    Erythranthe guttata [common monkey flower]
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    201   1e-59    Phoenix dactylifera
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    201   1e-59    Phoenix dactylifera
emb|CDP02971.1|  unnamed protein product                                201   4e-59    Coffea canephora [robusta coffee]
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         199   5e-59    Zea mays [maize]
emb|CDY11866.1|  BnaC03g12920D                                          199   6e-59    Brassica napus [oilseed rape]
emb|CDX88625.1|  BnaA03g10240D                                          199   1e-58    
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    199   1e-58    Brassica rapa
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    198   2e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             197   4e-58    Prunus persica
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    197   4e-58    Prunus mume [ume]
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          197   6e-58    Amborella trichopoda
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    196   1e-57    Phoenix dactylifera
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             194   5e-57    
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    194   5e-57    Pyrus x bretschneideri [bai li]
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    194   6e-57    
ref|NP_001241153.1|  uncharacterized protein LOC100818855               194   6e-57    Glycine max [soybeans]
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            194   8e-57    Glycine soja [wild soybean]
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          194   9e-57    Amborella trichopoda
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    193   1e-56    Nicotiana tomentosiformis
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      193   1e-56    Gossypium arboreum [tree cotton]
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    193   2e-56    Pyrus x bretschneideri [bai li]
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      193   2e-56    Gossypium arboreum [tree cotton]
gb|KDO82796.1|  hypothetical protein CISIN_1g0238542mg                  187   2e-56    Citrus sinensis [apfelsine]
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    193   2e-56    Malus domestica [apple tree]
ref|NP_001239899.1|  uncharacterized protein LOC100790578               192   4e-56    Glycine max [soybeans]
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    192   5e-56    Solanum tuberosum [potatoes]
gb|KJB23473.1|  hypothetical protein B456_004G100400                    192   5e-56    
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    192   5e-56    
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    192   5e-56    
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    192   7e-56    
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    191   9e-56    
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    192   9e-56    
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    191   1e-55    
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    191   1e-55    
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             191   1e-55    
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    191   2e-55    
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     191   2e-55    
ref|XP_007018499.1|  Voltage dependent anion channel 2                  191   2e-55    
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     192   2e-55    
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    190   2e-55    
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    190   3e-55    
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              189   4e-55    
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    189   4e-55    
gb|KJB58633.1|  hypothetical protein B456_009G219700                    189   4e-55    
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       191   5e-55    
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    189   5e-55    
ref|NP_001049301.1|  Os03g0202200                                       189   6e-55    
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    189   6e-55    
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             189   8e-55    
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    189   9e-55    
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             188   1e-54    
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    188   1e-54    
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    188   2e-54    
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    188   2e-54    
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    188   2e-54    
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    187   2e-54    
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             187   2e-54    
ref|XP_006381815.1|  VDAC3.1 family protein                             187   3e-54    
gb|ACU19720.1|  unknown                                                 186   3e-54    
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    187   3e-54    
ref|XP_007014286.1|  Voltage dependent anion channel 4                  189   3e-54    
ref|XP_002325061.1|  VDAC3.1 family protein                             187   5e-54    
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         186   1e-53    
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...    184   2e-53    
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    185   2e-53    
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    185   2e-53    
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    185   2e-53    
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    185   3e-53    
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...    184   3e-53    
dbj|BAL41368.1|  porin                                                  182   3e-53    
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          185   3e-53    
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    185   3e-53    
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    185   3e-53    
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             184   4e-53    
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    184   5e-53    
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              184   5e-53    
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         184   6e-53    
gb|ACG30926.1|  outer mitochondrial membrane protein porin              184   6e-53    
ref|NP_200557.1|  voltage dependent anion channel 4                     184   8e-53    
ref|XP_006380609.1|  VDAC2.1 family protein                             184   8e-53    
ref|XP_007047520.1|  Voltage dependent anion channel 2                  184   8e-53    
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    184   9e-53    
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    183   9e-53    
gb|ABE77194.1|  putative voltage-dependent ion channel                  184   1e-52    
emb|CAN64922.1|  hypothetical protein VITISV_017201                     183   1e-52    
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    183   2e-52    
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    183   2e-52    
gb|KJB48714.1|  hypothetical protein B456_008G082900                    182   2e-52    
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              182   3e-52    
tpg|DAA43264.1|  TPA: outer membrane protein porin                      182   4e-52    
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    182   4e-52    
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             182   4e-52    
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             181   5e-52    
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    181   5e-52    
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         181   6e-52    
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    181   8e-52    
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...    180   9e-52    
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                181   1e-51    
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         180   2e-51    
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    180   2e-51    
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    180   2e-51    
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    180   2e-51    
emb|CAA63968.1|  pom30                                                  180   2e-51    
gb|ABB16970.1|  POM30-like protein                                      180   2e-51    
ref|NP_001048902.1|  Os03g0137500                                       180   3e-51    
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    179   3e-51    
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    179   3e-51    
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         179   3e-51    
gb|EEC74475.1|  hypothetical protein OsI_09925                          179   4e-51    
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    179   5e-51    
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             179   6e-51    
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    179   6e-51    
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       179   7e-51    
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    178   1e-50    
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g             176   3e-50    
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      177   4e-50    
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    178   4e-50    
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    176   6e-50    
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    176   6e-50    
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    176   1e-49    
gb|KJB43907.1|  hypothetical protein B456_007G223000                    175   1e-49    
dbj|BAJ91367.1|  predicted protein                                      175   1e-49    
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             174   3e-49    
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       174   3e-49    
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    174   3e-49    
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    174   3e-49    
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             176   3e-49    
gb|KJB34748.1|  hypothetical protein B456_006G081500                    172   3e-49    
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    174   6e-49    
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    174   6e-49    
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    173   7e-49    
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    173   9e-49    
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    173   9e-49    
emb|CDY36497.1|  BnaC03g48560D                                          173   1e-48    
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    172   1e-48    
gb|AAW22622.1|  porin-like protein                                      172   1e-48    
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    172   2e-48    
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    172   2e-48    
gb|KJB60742.1|  hypothetical protein B456_009G323300                    170   2e-48    
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    172   2e-48    
emb|CDY08723.1|  BnaA06g25010D                                          172   2e-48    
gb|AAP46186.1|  PgPOR29                                                 172   2e-48    
gb|AAQ87022.1|  VDAC2.1                                                 172   2e-48    
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    174   2e-48    
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    171   4e-48    
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          171   4e-48    
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    170   4e-48    
emb|CDX81312.1|  BnaC09g07230D                                          171   4e-48    
emb|CDY18662.1|  BnaA09g07330D                                          171   5e-48    
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             171   5e-48    
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    171   7e-48    
gb|AAQ87023.1|  VDAC3.1                                                 171   8e-48    
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    171   8e-48    
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    171   8e-48    
gb|AFK33448.1|  unknown                                                 171   8e-48    
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             171   9e-48    
emb|CDP02599.1|  unnamed protein product                                170   1e-47    
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         170   1e-47    
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    170   1e-47    
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    170   2e-47    
gb|EEE58291.1|  hypothetical protein OsJ_09329                          179   2e-47    
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    169   2e-47    
gb|EMS67817.1|  Mitochondrial outer membrane protein porin              166   3e-47    
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            169   3e-47    
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    169   4e-47    
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    169   4e-47    
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    169   4e-47    
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             169   4e-47    
gb|ACU23163.1|  unknown                                                 169   5e-47    
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    168   6e-47    
ref|NP_201551.1|  voltage dependent anion channel 2                     168   6e-47    
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    168   8e-47    
ref|NP_001190641.1|  voltage dependent anion channel 2                  169   1e-46    
tpg|DAA43927.1|  TPA: outer membrane protein porin                      167   1e-46    
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             167   1e-46    
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    167   2e-46    
ref|XP_010551652.1|  PREDICTED: mitochondrial outer membrane prot...    164   2e-46    
ref|NP_001242630.1|  uncharacterized protein LOC100797369               166   4e-46    
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    166   5e-46    
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    166   5e-46    
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         166   7e-46    
ref|NP_001242891.1|  uncharacterized protein LOC100790270               166   8e-46    
ref|XP_010029026.1|  PREDICTED: mitochondrial outer membrane prot...    164   9e-46    
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    165   1e-45    
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    164   2e-45    
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    164   3e-45    
ref|XP_010029017.1|  PREDICTED: mitochondrial outer membrane prot...    163   4e-45    
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    163   9e-45    
ref|XP_011465744.1|  PREDICTED: mitochondrial outer membrane prot...    159   9e-45    
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         162   1e-44    
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             162   1e-44    
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             163   2e-44    
gb|ACJ85119.1|  unknown                                                 162   3e-44    
gb|EPS70241.1|  hypothetical protein M569_04517                         161   3e-44    
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    160   5e-44    
ref|XP_006367075.1|  PREDICTED: mitochondrial outer membrane prot...    159   6e-44    
emb|CDY02103.1|  BnaA03g40640D                                          160   6e-44    
ref|XP_004508774.1|  PREDICTED: mitochondrial outer membrane prot...    159   8e-44    
gb|KJB42460.1|  hypothetical protein B456_007G244300                    154   2e-43    
ref|XP_002318608.2|  hypothetical protein POPTR_0012s07210g             158   2e-43    
ref|XP_009614188.1|  PREDICTED: mitochondrial outer membrane prot...    158   2e-43    
ref|XP_011463658.1|  PREDICTED: mitochondrial outer membrane prot...    154   2e-43    
gb|KHN48663.1|  Mitochondrial outer membrane protein porin 1            157   2e-43    
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    159   3e-43    
ref|XP_007211055.1|  hypothetical protein PRUPE_ppa018776mg             157   4e-43    
gb|AFK40114.1|  unknown                                                 157   6e-43    
ref|XP_010086579.1|  Mitochondrial outer membrane protein porin o...    157   7e-43    
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    158   7e-43    
ref|XP_009801980.1|  PREDICTED: mitochondrial outer membrane prot...    157   8e-43    
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              156   2e-42    
ref|XP_011044010.1|  PREDICTED: mitochondrial outer membrane prot...    156   2e-42    
gb|AHH02397.1|  putative 34 kDa outer mitochondrial membrane prot...    150   5e-42    
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            156   6e-42    
ref|XP_003524958.1|  PREDICTED: mitochondrial outer membrane prot...    154   9e-42    
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    156   1e-41    
gb|EPS73591.1|  pom30 protein                                           154   1e-41    
ref|XP_007155337.1|  hypothetical protein PHAVU_003G192600g             153   2e-41    
ref|XP_007037222.1|  Porin/voltage-dependent anion-selective chan...    152   4e-41    
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    153   4e-41    
ref|XP_008239838.1|  PREDICTED: mitochondrial outer membrane prot...    151   9e-41    
gb|KDP31208.1|  hypothetical protein JCGZ_11584                         151   1e-40    
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...    150   2e-40    
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                151   3e-40    
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    151   3e-40    
emb|CDP01200.1|  unnamed protein product                                151   3e-40    
ref|XP_004236191.1|  PREDICTED: mitochondrial outer membrane prot...    149   4e-40    
emb|CDY25906.1|  BnaC09g32780D                                          151   7e-40    
ref|XP_006476654.1|  PREDICTED: mitochondrial outer membrane prot...    149   8e-40    
gb|ABI73982.1|  voltage-dependent anion-selective channel protein       143   1e-39    
ref|XP_010426523.1|  PREDICTED: mitochondrial outer membrane prot...    148   1e-39    
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-39    
gb|KHG03239.1|  Mitochondrial outer membrane porin of 36 kDa            147   2e-39    
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg             148   2e-39    
gb|ABR25498.1|  voltage dependent anion channel                         143   2e-39    
ref|XP_003549662.1|  PREDICTED: mitochondrial outer membrane prot...    147   2e-39    
gb|KJB50870.1|  hypothetical protein B456_008G190600                    147   4e-39    
gb|KHN18528.1|  Mitochondrial outer membrane protein porin 1            147   3e-38    
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             145   3e-38    
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...    143   2e-37    
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...    143   3e-37    
gb|KDO82799.1|  hypothetical protein CISIN_1g0238541mg                  135   1e-35    
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    135   2e-35    
gb|KJB30016.1|  hypothetical protein B456_005G139100                    135   2e-35    
ref|XP_003609006.1|  Mitochondrial outer membrane protein porin         137   3e-35    
gb|KDO82798.1|  hypothetical protein CISIN_1g0238541mg                  135   3e-35    
ref|XP_008236314.1|  PREDICTED: mitochondrial outer membrane prot...    136   1e-34    
gb|ACJ84955.1|  unknown                                                 135   1e-34    



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   338 bits (868),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SFV PDQ+SGKVELQYLHEYAGIST IGLTASPLV+FSGVAGNNT+ALGTD+SFD
Sbjct  90   LKTIVSFVLPDQRSGKVELQYLHEYAGISTGIGLTASPLVNFSGVAGNNTVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGLSFSTSDLIASL LNDKGD L ASYYHTV+P+TNTAVGAELTHSFSSN
Sbjct  150  TASGNFTKCNAGLSFSTSDLIASLALNDKGDTLSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   338 bits (866),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSGKVELQYLHEYAGI+TSIGLTASPLV+FSGVAGNNT+ALGTD+SFD
Sbjct  90   LKTIFSFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLSFS+SDLIASL LNDKGD + ASYYHTV+P+TNTAVGAELTHSFSSN
Sbjct  150  TATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   337 bits (865),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSGKVELQYLHEYAGI+TSIGLTASPLV+FSGVAGNNT+ALGTD+SFD
Sbjct  90   LKTIFSFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLSFS+SDLIASL LNDKGD + ASYYHTV+P+TNTAVGAELTHSFSSN
Sbjct  150  TATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   337 bits (865),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SFV PDQKSGKVELQYLHEYAGIST IGLTASPLV+FSGVAGNNT+ALGTD+SF+
Sbjct  90   LKTIVSFVLPDQKSGKVELQYLHEYAGISTGIGLTASPLVNFSGVAGNNTVALGTDLSFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGLSFSTSDLIASL LNDKGD L ASYYHTV+P+TNTAVGAELTHSFSSN
Sbjct  150  TASGNFTKCNAGLSFSTSDLIASLALNDKGDTLSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKACALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSGKVELQYLHEYAGI+TSIGLTASPLV+FSGVAGNN +ALGTDVSFD
Sbjct  90   LKTIFSFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNIVALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLSFS+SDLIASL LNDKGD + ASYYHTV+P+TNTAVGAELTHSFSSN
Sbjct  150  TATGNFTKCNAGLSFSSSDLIASLALNDKGDTVSASYYHTVKPVTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHLLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   330 bits (845),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSGKVELQYLHEYAGISTSIGL ASPLV+FSGVAGNN +ALGTD+SFD
Sbjct  90   LKTIFSFVVPDQKSGKVELQYLHEYAGISTSIGLAASPLVNFSGVAGNNKIALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G FTK NAGL+F+TSDLIASL LNDKGD L ASYYHTV PLTNTAVGAELTHSFSSN
Sbjct  150  TSSGNFTKCNAGLNFTTSDLIASLALNDKGDTLSASYYHTVNPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+TIGT H LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTMTIGTHHSLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTIISFV PDQ+SGKVELQYLHEYAGIST IGLTA+P+V+FSGVAGN+ LALG D+SFD
Sbjct  90   LKTIISFVVPDQRSGKVELQYLHEYAGISTGIGLTANPIVNFSGVAGNDKLALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAG SF+ SDLIA+LTLNDKGD L ASYYH+V PLTNTAVGAEL+H FSSN
Sbjct  150  TATGNFTKYNAGFSFTNSDLIAALTLNDKGDTLTASYYHSVSPLTNTAVGAELSHGFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TT+KA+VNN+GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHSLDPLTTLKARVNNYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   328 bits (842),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQYLHEYAGIS+SIGLTA+P+V+FSGVAGN+ LALGTDVSFD
Sbjct  90   LKTIFSFVVPDQRSGKVELQYLHEYAGISSSIGLTANPIVNFSGVAGNDKLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAGLSF+ SDLIA+LTLNDKGD L ASYYH+V PLTNTAVGAEL+HSFS+N
Sbjct  150  TATGNFTKYNAGLSFTNSDLIAALTLNDKGDTLTASYYHSVSPLTNTAVGAELSHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT+GTQH LDP TTVKA+VNN+GKA ALIQHEWRPKSL TISGEVDTRAIEKSAKIG
Sbjct  210  ENSLTLGTQHLLDPLTTVKARVNNYGKASALIQHEWRPKSLLTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSGKVELQYLHEYAGISTSIGL ASPLV+FSGVAGNN +ALGTD+SFD
Sbjct  90   LKTIFSFVVPDQKSGKVELQYLHEYAGISTSIGLAASPLVNFSGVAGNNKIALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G FTK NAGL+F+TSDLIASL LNDK D L ASYYHTV PLTNTAVGAELTHSFSSN
Sbjct  150  TSSGNFTKCNAGLNFTTSDLIASLALNDKADTLTASYYHTVNPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+TIGT H LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTMTIGTHHSLDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALK  194
            LAVALK
Sbjct  270  LAVALK  275



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ+SGKVELQY HEYAGISTSIGLTA+P+V+FSGV GNN LALGTD+SFD
Sbjct  90   LKTIFSFIVPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGLSF+ SDLIASLTLNDKGD L ASYYHTV PLT+TAVGAEL+HSFSSN
Sbjct  150  TASGNFTKCNAGLSFTNSDLIASLTLNDKGDTLSASYYHTVSPLTSTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LTIGTQH LDP T VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENMLTIGTQHALDPLTNVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   322 bits (825),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+ PDQ+SGKVELQY HEYAGISTSIGLTA+P V+FSG  GNNTLA+GTD+SFD
Sbjct  90   LKAIFSFIVPDQRSGKVELQYQHEYAGISTSIGLTANPSVNFSGAVGNNTLAIGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK+NAGL+F+ SDLIASLTLNDKGD L ASYYH+V PLTNTAVGAEL+HSFSSN
Sbjct  150  TATGNFTKFNAGLNFTRSDLIASLTLNDKGDALTASYYHSVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TT+KA+VNN GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHALDPLTTLKARVNNSGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   320 bits (820),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF+ PDQ+SGKVELQY HEYAGIST IG TA+P+V+FSGV GNN++ALGTD+SFD
Sbjct  90   LKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLS++ +DLIASLTLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TATGNFTKCNAGLSYTHTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF+ PDQ+SGKVELQY HEYAGIST IG TA+P+V+FSGV GNN++ALGTD+SFD
Sbjct  90   LKSIFSFIVPDQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLS++  DLIASLTLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TATGNFTKCNAGLSYTHIDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I SFVAPDQKSGKVELQYLHEYAGISTS+GLTA P+V+FSGVAGN+  A GTD+SFD
Sbjct  92   VKAIFSFVAPDQKSGKVELQYLHEYAGISTSLGLTAKPIVNFSGVAGNHKAAFGTDISFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAG+SF+T+DLIASL LNDKG  + ASY+HT+ PLTNTAVGAELTHSFSSN
Sbjct  152  TATGNFTKYNAGVSFTTTDLIASLILNDKGQTVTASYFHTISPLTNTAVGAELTHSFSSN  211

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN G+A ALIQHEWRPKSL TISGEVDTRAIEKSAKIG
Sbjct  212  ENTLTIGTQHSLDPLTSVKARVNNHGRASALIQHEWRPKSLITISGEVDTRAIEKSAKIG  271

Query  211  LAVALKP  191
            LAVALKP
Sbjct  272  LAVALKP  278



>gb|KJB50697.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=210

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+APDQ+SGKVELQY HEYAGISTSIGLTA+PLV+FSGV GNN++ +GTD+SFD
Sbjct  24   LKTIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNSVTVGTDLSFD  83

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  84   TASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHSFSSN  143

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKSL TISGEVDT AIEKSAK+G
Sbjct  144  ENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGEVDTGAIEKSAKVG  203

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  204  LALALKP  210



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGISTS+GLTA+P+V+FSGV G+N ++LGTD+SFD
Sbjct  90   LKTIFSFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVIGSNVVSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAGLS++ +DLIASLT+NDKGD L ASYYHTVRPLT+TAVGAELT SFSSN
Sbjct  150  TATGNFTKYNAGLSYTNADLIASLTVNDKGDTLTASYYHTVRPLTSTAVGAELTRSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+GKA ALIQHEWRPKSLFTISGEVDT+AIEKSAKIG
Sbjct  210  ENTLTIGTQHALDPLTTVKARLNNYGKASALIQHEWRPKSLFTISGEVDTKAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ+SGKVELQYLHEYAGISTSIGLTA+P+V+FSGV GNNTL+LGTD+SFD
Sbjct  90   LKTIFSFIIPDQRSGKVELQYLHEYAGISTSIGLTANPIVNFSGVVGNNTLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGL FS +DLIA+LTLNDKGD L ASYYHTV PLTNTAVGAEL+H FS+N
Sbjct  150  TATGNFTKCNAGLGFSNADLIAALTLNDKGDTLNASYYHTVSPLTNTAVGAELSHCFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T VKA+ NN GK  ALIQHEWRPKSLFTISGEVD RA+EKSAKIG
Sbjct  210  ENTLTIGTQHALDPLTKVKARANNSGKVSALIQHEWRPKSLFTISGEVDARAVEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGISTS+GLTA+P+V+FSGV G+N ++LGTD+SFD
Sbjct  90   LKTIFSFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVIGSNVVSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAGLS++ +DLIASLT+NDKGD L ASYYHTVRPLT+TAVGAELT SFSSN
Sbjct  150  TATGNFTKYNAGLSYTNADLIASLTVNDKGDTLTASYYHTVRPLTSTAVGAELTRSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+GKA ALIQHEWRPKSLFTISGEVDT+AIEKSAKIG
Sbjct  210  ENTLTIGTQHALDPLTTVKARLNNYGKASALIQHEWRPKSLFTISGEVDTKAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ+SGKVELQY HEYAGISTSIGL A+PLV+FSGV GNN +++GTD+SFD
Sbjct  90   LKTIFSFIVPDQRSGKVELQYQHEYAGISTSIGLNANPLVNFSGVVGNNCVSVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTV+ ++NN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTTVRTRLNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   317 bits (813),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ+SGKVELQY HEYAGISTSIGL A+PLV+FSGV GNN +++GTD+SFD
Sbjct  90   LKTIFSFIVPDQRSGKVELQYQHEYAGISTSIGLNANPLVNFSGVVGNNCVSVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TGSGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A  LIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTTVKARLNNYGRASGLIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   316 bits (810),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ+SGKVELQY HEYAGISTSIGL A+PLV+FSGV GNN +++GTD+SFD
Sbjct  69   LKTIFSFIVPDQRSGKVELQYQHEYAGISTSIGLNANPLVNFSGVVGNNCVSVGTDLSFD  128

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  129  TGSGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSN  188

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A  LIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  189  ENTLTIGTQHALDPLTTVKARLNNYGRASGLIQHEWRPKSLFTISGEVDTRAIEKSAKVG  248

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  249  LALALKP  255



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+APDQ+SGKVELQY HEYAGISTSIGLTA+PLV+FSGV GNN++ +GTD+SFD
Sbjct  84   LKTIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNSVTVGTDLSFD  143

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  144  TASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHSFSSN  203

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKSL TISGEVDT AIEKSAK+G
Sbjct  204  ENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGEVDTGAIEKSAKVG  263

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  264  LALALKP  270



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+APDQ+SGKVELQY HEYAGISTSIGLTA+PLV+FSGV GNN++ +GTD+SFD
Sbjct  90   LKTIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNSVTVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIASLTLNDKGD L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKLNAGLNFTHSDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKSL TISGEVDT AIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTTVKARLNNYGRASALIQHEWRPKSLITISGEVDTGAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSGKVELQY HEYAGIST IGLTA PLVSFSGV GN+++++GTD+SFD
Sbjct  90   LKTIFSFVVPDQKSGKVELQYRHEYAGISTGIGLTAKPLVSFSGVIGNDSVSVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G F K NAGL+ + SDLIAS+TLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TASGNFIKLNAGLNITHSDLIASMTLNDKGDTLTASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTTVKARMNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+APDQ+SGKVELQY HEYAGISTSIGLTA+P+V+FSGV GNN L+LGTD+SFD
Sbjct  90   LKAIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIASL LNDK D + ASYYHTV PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKVNAGLNFTHSDLIASLLLNDKADTITASYYHTVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGT H LDP TTVKA+VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAKIG
Sbjct  210  ENSLTIGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+SFVAPDQKSGKVELQY HE+AGISTS+GLTA P+V+FSGVAGN   A GTD+SFD
Sbjct  92   VKAIVSFVAPDQKSGKVELQYFHEHAGISTSLGLTAKPIVNFSGVAGNQKAAFGTDISFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAG+SF+T+DLIASL LNDKG+ + ASY+HTV PLTNTAVGAELTHSFS+N
Sbjct  152  TATGNFTKCNAGVSFTTTDLIASLMLNDKGETVTASYFHTVSPLTNTAVGAELTHSFSTN  211

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+GK  ALIQHEWRPKSL TISGEVDTRAIEKSAK+G
Sbjct  212  ENTLTIGTQHLLDPLTSVKARVNNYGKVSALIQHEWRPKSLITISGEVDTRAIEKSAKVG  271

Query  211  LAVALKP  191
            LAVALKP
Sbjct  272  LAVALKP  278



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAGI+TS+GLTA+P+V+FSGV G N +ALGTDVSFD
Sbjct  90   LKTILSFRLPDQRSGKVELQYLHDYAGITTSVGLTANPVVNFSGVFGTNVVALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            + TG+FTK NAGLSFS +DLIASLTLNDKGD L ASYYHTV  LTNTAVGAE+THSFS+N
Sbjct  150  SKTGQFTKLNAGLSFSNADLIASLTLNDKGDTLSASYYHTVNLLTNTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TTVKA+VNNFGKA+ALIQHEWRPKS FT+SGEVDT+AIEKSAK+G
Sbjct  210  ENTITVGTQHALDPLTTVKARVNNFGKANALIQHEWRPKSFFTLSGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+ PDQ+SGKVELQY HEYAGISTSIGLTA+P+V+FSGV GNN L+LGTD+SFD
Sbjct  90   LKAIFSFIVPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK+NAGL+F+ +DLIASL LNDK D + ASYYHTV PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKWNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGTQH LDP TTVK +VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAKIG
Sbjct  210  ENSLTIGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HE+AGISTSIGLTA+P+V+FSGV G++ +ALGTD+SFD
Sbjct  90   LKTIFSFKIPDQRSGKVELQYQHEHAGISTSIGLTANPIVNFSGVIGSSAVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGLS+S +DLIASLTLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TASGNFTKLNAGLSYSNTDLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LDP TTVKA+VN++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTFGTQHALDPLTTVKARVNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGISTSIGLTA+P+V+FSGV G+N LALGTD+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVVGSNLLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSF+ +DLIASLTLNDKGD L ASYYHTV PLT+TAVGAE+ HSFSSN
Sbjct  150  TKTGNFTKVNAGLSFANADLIASLTLNDKGDTLSASYYHTVNPLTSTAVGAEVAHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T+VKA+VNNFGKA ALIQHEWRPKS FT+SGEVDT+AIEKSAK+G
Sbjct  210  ENTITVGTQHALDPLTSVKARVNNFGKASALIQHEWRPKSFFTVSGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+APDQ+SGKVELQY HEYAGISTSIGLTA+P+V FSGV GNN L+LGTD+SFD
Sbjct  90   LKAIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPIVHFSGVVGNNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIASL LNDK D + ASYYHTV PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKVNAGLNFTHSDLIASLLLNDKADTITASYYHTVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGT H LDP TTVKA+VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAK+G
Sbjct  210  ENSLTIGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+ PDQ+SGKVELQY HEYAGISTSIGLTA+P+V+FSGV GNN L+LGTD+SFD
Sbjct  90   LKAIFSFIVPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ +DLIASL LNDK D + ASYYHTV PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKCNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGTQH LDP TTVK +VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAKIG
Sbjct  210  ENSLTIGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   312 bits (799),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SFV PDQKSGK ELQYLH++AGISTSIGLTASP+V+FSGV G +  ++GTD+SFD
Sbjct  90   LKTIVSFVVPDQKSGKAELQYLHDHAGISTSIGLTASPIVNFSGVVGTSAASIGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T+TGKF KYNAGLSFS +DLIASLTLNDKGD L ASYYHTV PLTNTAVGAE+T  FSS 
Sbjct  150  TSTGKFVKYNAGLSFSNADLIASLTLNDKGDKLTASYYHTVSPLTNTAVGAEMTRIFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T VKA++N++GKA ALIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTMVKARLNSYGKASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQKSG VELQY HEYAGIS  IGLTA PLVSFSGV GN+ +++GTD+SFD
Sbjct  90   LKTIFSFVVPDQKSGMVELQYRHEYAGISNGIGLTAKPLVSFSGVIGNDCVSVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G F K NAGL+ + SDLIAS+TLNDKGD L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TASGNFIKLNAGLNITHSDLIASMTLNDKGDTLTASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVKA++NN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTTVKARMNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGISTSIGLTA+P+V+FSGV G+N LALGTD+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVVGSNLLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK N GLSF+ +DLIASLTLNDKGD L ASYYHTV PLT+TAVGAE+ HSFSSN
Sbjct  150  TKTGNFTKVNTGLSFANADLIASLTLNDKGDTLSASYYHTVNPLTSTAVGAEVAHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T+VKA+VNNFGKA ALIQHEWRPKS FT+SGEVDT+AIEKSAK+G
Sbjct  210  ENTITVGTQHALDPLTSVKARVNNFGKASALIQHEWRPKSFFTVSGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGISTS+GLTA+P+V+FSGV G+N +ALGTD+SFD
Sbjct  90   LKTIFSFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVVGSNVVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLS++ SDLIASLT+NDKGD L ASYYHTV PLT+TAVGAELTHSFSSN
Sbjct  150  TATGNFTKCNAGLSYTNSDLIASLTVNDKGDTLSASYYHTVSPLTSTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LTIGTQH LDP TTVKA++NN+GK  ALIQ+EWRPKSLFTISGEVDT+AIEKSAK+G
Sbjct  210  ENILTIGTQHALDPLTTVKARLNNYGKVSALIQNEWRPKSLFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+APDQ+SGKVELQY HEYAGISTSIGLTA+P+V+FSGV GNN L+LGTD+SFD
Sbjct  90   LKAIFSFIAPDQRSGKVELQYQHEYAGISTSIGLTANPIVNFSGVVGNNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F   DLIASL LNDK D + ASYYHTV PLTNTAVGAEL HSFSSN
Sbjct  150  TASGNFTKVNAGLNFIHCDLIASLLLNDKADTITASYYHTVSPLTNTAVGAELAHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGT H LDP TTVKA+VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAK+G
Sbjct  210  ENSLTIGTAHALDPLTTVKARVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ+SGKVELQYLH+YAGISTSIGLTA+P+V+FSGV G+N LALGTDVSFD
Sbjct  90   LKSIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPVVNFSGVVGSNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSF+  DLIASLTLNDKGD L  SYYH V PL+NTAVGAE++HSFS+N
Sbjct  150  TKTGNFTKCNAGLSFTKDDLIASLTLNDKGDTLNGSYYHIVNPLSNTAVGAEVSHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TTVKA+VNN GKA ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTITVGTQHALDPLTTVKARVNNTGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   309 bits (792),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+ PDQ+SGKVELQY HEYAGIST IGLTA+P+V+FSGV GNN L+LGTD+SFD
Sbjct  90   LKAIFSFIVPDQRSGKVELQYQHEYAGISTGIGLTANPIVNFSGVVGNNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK+NAGL+F+ +DLIASL LNDK D + ASYYHTV PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKWNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGT+H LDP TTVK +VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAKIG
Sbjct  210  ENSLTIGTRHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   309 bits (792),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ+SGKVELQYLH+YAGISTSIGLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKSIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVVGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSF+  DLIASLTLNDKGD + ASYYH V PL+NTAVGAE++HSFS+N
Sbjct  150  TKTGNFTKCNAGLSFTKDDLIASLTLNDKGDTVNASYYHIVNPLSNTAVGAEVSHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T VKA+VNN GKA ALIQHEWRPKS FTISGEVDT+AIEKSAKIG
Sbjct  210  ENTITVGTQHALDPLTAVKARVNNAGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGIST IGLTASP+V+F+GV GN  L+LGTD+SFD
Sbjct  90   LKTIFSFRVPDQRSGKVELQYQHEYAGISTGIGLTASPIVNFAGVIGNEKLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G  TK NAGLS++ SDLIA+LTLNDKGD L ASYYH V PL+NTAVGAEL+HSFSSN
Sbjct  150  TASGNITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHLVSPLSNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAI+KSAKIG
Sbjct  210  ENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIDKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGISTS+GLTA+P+V+FSGV G+N +ALGTD+SFD
Sbjct  90   LKTIFSFKVPDQRSGKVELQYQHEYAGISTSLGLTANPIVNFSGVVGSNVVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGLS++ SDLIASLT+NDKGD L ASYYHTV PLT+TAVGAELTHSFS+N
Sbjct  150  TATGNFTKCNAGLSYTNSDLIASLTVNDKGDTLSASYYHTVSPLTSTAVGAELTHSFSNN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LTIGTQH LDP TTVKA++NN+GK  ALIQ+EWRPK+LFTISGEVDT+AIEKSAK+G
Sbjct  210  ENILTIGTQHALDPLTTVKARLNNYGKGSALIQNEWRPKALFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   311 bits (796),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+ PDQ+SGKVELQY HEYAGIST IGLTA+P+V+FSGV GNN L+LGTD+SFD
Sbjct  158  LKAIFSFIVPDQRSGKVELQYQHEYAGISTGIGLTANPIVNFSGVVGNNLLSLGTDLSFD  217

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK+NAGL+F+ +DLIASL LNDK D + ASYYHTV PLTNTAVGAEL+HSFSSN
Sbjct  218  TASGNFTKWNAGLNFTHTDLIASLILNDKADTVTASYYHTVSPLTNTAVGAELSHSFSSN  277

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGTQH LDP TTVK +VNN+G+A ALIQHEWRPKS FTISGEVDTRAIEKSAKIG
Sbjct  278  ENSLTIGTQHALDPLTTVKGRVNNYGRASALIQHEWRPKSFFTISGEVDTRAIEKSAKIG  337

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  338  LALALKP  344



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGIST IGLTASP+V+F+GV GN+ L+LGTD+SFD
Sbjct  90   LKTIFSFRVPDQRSGKVELQYQHEYAGISTGIGLTASPIVNFAGVIGNDKLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G  TK NAGLS++ SDLIA+LTLNDKGD L ASYYH V PL+NTAVGAEL+HSFSSN
Sbjct  150  TASGNITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHLVSPLSNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAI+KSAKIG
Sbjct  210  ENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIDKSAKIG  269

Query  211  LAVALKP  191
            LA+ LKP
Sbjct  270  LALVLKP  276



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   307 bits (786),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLHEYAGISTS+GLTA+P+V+FSGV GN+TLALGTD+SFD
Sbjct  90   LKAIFSFRVPDQRSGKVELQYLHEYAGISTSLGLTANPIVNFSGVIGNSTLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ +DLIASL +NDK D L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKCNAGLNFTNTDLIASLNVNDKADILNASYYHIVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+GKA ALIQHEWRPKS  TISGEVDT AIEKSAK+G
Sbjct  210  ENTLTIGTQHALDPLTSVKARVNNYGKASALIQHEWRPKSTVTISGEVDTSAIEKSAKLG  269

Query  211  LAVALKP  191
            LA+ LKP
Sbjct  270  LALVLKP  276



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKV+LQY HEY+GIST IGLTA+P+V+FSGV GN+T+ALGTD+SFD
Sbjct  90   LKTIFSFKIPDQRSGKVDLQYQHEYSGISTGIGLTANPIVNFSGVVGNSTIALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGLS++ +DLIAS+TLNDKGD L ASYYHTV PLT+TAVGAELTHSFSSN
Sbjct  150  TASGNFTKLNAGLSYTNADLIASVTLNDKGDTLNASYYHTVSPLTDTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGT+H LDP TTVKA+ NN+G A ALIQHEWR KSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTLTIGTKHALDPLTTVKARANNYGIASALIQHEWRLKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I SFVAPDQKSGKVELQY HEY+GISTS+GLTA P+V+FSGVAGN+T A GTDVSFD
Sbjct  92   VKAIFSFVAPDQKSGKVELQYFHEYSGISTSLGLTAKPIVNFSGVAGNHTFAFGTDVSFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG F K NA LSF+T+DL+ASL L+DKG+ + ASY+HTV PLTNTAVGAE+ HSFS+N
Sbjct  152  TETGNFIKSNAALSFTTADLVASLGLSDKGETVTASYFHTVSPLTNTAVGAEMVHSFSTN  211

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T VKA+VNN+GKA ALIQHEWRPKSL TISGEVDTRAIEKSAK+G
Sbjct  212  ENTLTIGTQHLLDPLTAVKARVNNYGKASALIQHEWRPKSLITISGEVDTRAIEKSAKVG  271

Query  211  LAVALKP  191
            LAVALKP
Sbjct  272  LAVALKP  278



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K IISF APDQKSGKVELQY HEYA ISTS+GLTA P+V+FSGVAG++  A GTDVSFD
Sbjct  92   VKAIISFAAPDQKSGKVELQYFHEYAAISTSLGLTAKPIVNFSGVAGSHKAAFGTDVSFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAG+SF+T+DLIAS  LNDKG  L ASY+HTV PLTNTAVGAELTHSF+SN
Sbjct  152  TATGNFTKYNAGVSFTTTDLIASFILNDKGQSLTASYFHTVSPLTNTAVGAELTHSFTSN  211

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LD  T+VKA++NN+GKA ALIQH+WRPKSL TISGEVDTRAI+K+AKIG
Sbjct  212  ENTLTIGTQHSLDHLTSVKARLNNYGKASALIQHQWRPKSLVTISGEVDTRAIDKTAKIG  271

Query  211  LAVALKP  191
            LAVALKP
Sbjct  272  LAVALKP  278



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   307 bits (787),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQY HEYAGIST IGLTASP+V+F+GV GN+ L+LGTD+SFD
Sbjct  156  LKTIFSFRVPDQRSGKVELQYQHEYAGISTGIGLTASPIVNFAGVIGNDKLSLGTDLSFD  215

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G  TK NAGLS++ SDLIA+LTLNDKGD L ASYYH V PL+NTAVGAEL+HSFSSN
Sbjct  216  TASGNITKLNAGLSYTHSDLIAALTLNDKGDALTASYYHLVSPLSNTAVGAELSHSFSSN  275

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAI+KSAKIG
Sbjct  276  ENTLTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIDKSAKIG  335

Query  211  LAVALKP  191
            LA+ LKP
Sbjct  336  LALVLKP  342



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGK+ELQYLH+YAGISTS+GLTA+P+++FSGV G N LALGTDVSFD
Sbjct  90   LKTIFSFRVPDQRSGKLELQYLHDYAGISTSVGLTANPIINFSGVVGTNALALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG  TK NAGLSF+ SDLIASLTLNDKGD L ASYYHTV PLT+TAVGAE+THSFS+N
Sbjct  150  TKTGTLTKCNAGLSFTNSDLIASLTLNDKGDALSASYYHTVSPLTSTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TT+KA+VNN+GKA ALIQHEWRPKSLFTI+GEVDT++I++SAK G
Sbjct  210  ENTITLGTQHALDPLTTLKARVNNYGKASALIQHEWRPKSLFTITGEVDTKSIDQSAKFG  269

Query  211  LAVALKP  191
            LA+ LKP
Sbjct  270  LALVLKP  276



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK+NAGL+F+  DL+ASLT+NDKGD L ASYYH V  LTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKFNAGLNFTKDDLVASLTVNDKGDALNASYYHAVNRLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TT+KA+VNNFGKA+ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHALDPLTTMKARVNNFGKANALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L +ALKP
Sbjct  270  LGLALKP  276



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   304 bits (779),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF APDQ+SGKVELQYLHEYAGIS+SIGLTA+P+V+ SGV G N LALGTD+SFD
Sbjct  90   LKAIFSFRAPDQRSGKVELQYLHEYAGISSSIGLTANPIVNLSGVIGTNVLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSFS  DLIASLTLN+KGD L ASYYH V P+TNTAVGAE+THSFS+N
Sbjct  150  TKTGNFTKCNAGLSFSNVDLIASLTLNEKGDSLNASYYHIVNPMTNTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+TIGTQH LDP T VKA+VNN GKA ALIQHEWRP+SL TISGEVDT++I+KSAK+G
Sbjct  210  ENTITIGTQHALDPLTMVKARVNNAGKASALIQHEWRPRSLITISGEVDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   304 bits (778),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLHEYAGISTS+GLTA+P+V+FSGV GN+TLALGTD+SFD
Sbjct  90   LKAIFSFRVPDQRSGKVELQYLHEYAGISTSLGLTANPIVNFSGVFGNSTLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGLSF+  DLIAS+ +NDK D L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKCNAGLSFTNDDLIASVNVNDKLDILNASYYHIVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL IGTQH LDP T+VKA+VNN+GKA ALIQHEWRPKS+ TISGEVDT AIEKSAK+G
Sbjct  210  ENTLNIGTQHALDPLTSVKARVNNYGKASALIQHEWRPKSIVTISGEVDTSAIEKSAKLG  269

Query  211  LAVALKP  191
            LA+ LKP
Sbjct  270  LALVLKP  276



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   304 bits (778),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSG+ G N LALGTDVSFD
Sbjct  90   LKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGIVGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK+NAGL+F+  DL+ASLT+NDKGD L ASYYH V  LTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKFNAGLNFTKDDLVASLTVNDKGDALNASYYHAVNRLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TT+KA+VNNFGKA+ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHALDPLTTMKARVNNFGKANALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L +ALKP
Sbjct  270  LGLALKP  276



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQY HEYAGISTSIGLTA+PLV+FSGV GNN +++GTD+SFD
Sbjct  90   LKTIFSFVVPDQRSGKVELQYQHEYAGISTSIGLTANPLVNFSGVVGNNCVSVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK NAGL+F+ SDLIAS+T+NDK D L ASYYH V PLTNTAVGAELTHSFSSN
Sbjct  150  TASGNFTKLNAGLNFTHSDLIASVTVNDKCDNLTASYYHIVSPLTNTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQ++LDP TTVKA+ NNFG+A ALIQHE+RPKSL TISGEVDTRAIEKSAK+G
Sbjct  210  ENTLTFGTQYELDPLTTVKARWNNFGRASALIQHEFRPKSLLTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            +A+ LKP
Sbjct  270  MALLLKP  276



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  81   LKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGTDVSFD  140

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK+NAGL+F+  DL+ASLT+N+KGD L ASYYHTV  LTNTAVGAE+TH FS+N
Sbjct  141  TKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTVNRLTNTAVGAEVTHQFSTN  200

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TTVKA+VNN GKA+ALIQHEWRP+S FTISGEVDT+AIEKSAK+G
Sbjct  201  ENTLTLGTQHALDPLTTVKARVNNLGKANALIQHEWRPRSFFTISGEVDTKAIEKSAKVG  260

Query  211  LAVALKP  191
            L +ALKP
Sbjct  261  LGLALKP  267



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGIS+S+GLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  89   LKAIFSFKVPDQRSGKVELQYLHDYAGISSSVGLTANPIVNFSGVIGTNQLALGTDLSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG  TK NAGLSFS +DL+A+LTLNDKGD L ASYYH+V PL+NTAVGAE+TH F +N
Sbjct  149  TKTGNLTKCNAGLSFSNADLVAALTLNDKGDILSASYYHSVNPLSNTAVGAEVTHRFPTN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T++KA+VNNFGKA ALIQHEWRPKS  T+SGEVDT+AIEKSAKIG
Sbjct  209  ENTITLGTQHALDPLTSIKARVNNFGKASALIQHEWRPKSFLTVSGEVDTKAIEKSAKIG  268

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  269  LALALKP  275



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLHEYAGIS+SIGLTA+P+V+ SGV G N LALGTD+SFD
Sbjct  90   LKAIFSFRVPDQRSGKVELQYLHEYAGISSSIGLTANPIVNLSGVIGTNVLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSFS  DLIASLTLN+KGD L ASYYH V P+TNTAVGAE+THSFS+N
Sbjct  150  TKTGNFTKCNAGLSFSNVDLIASLTLNEKGDSLNASYYHIVNPMTNTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+TIGTQH LDP T VKA+VNN G A ALIQHEWRP+SLFTISGEVDT++I+KSAK+G
Sbjct  210  ENTITIGTQHALDPLTMVKARVNNAGNASALIQHEWRPRSLFTISGEVDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   303 bits (776),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+E+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTILSFRVPDQRSGKLEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNILALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSF+ +DL+ASL LNDKGD L ASYYHTV P T+T VGAE+TH FS+N
Sbjct  150  TKTGDFTKCNAGLSFTNADLVASLNLNDKGDNLSASYYHTVSPFTSTVVGAEVTHCFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH+LDP T+VKA+VNNFGKA AL+QHEWRPKSLFTISGEVDT++++K AK G
Sbjct  210  ENTITVGTQHRLDPLTSVKARVNNFGKASALLQHEWRPKSLFTISGEVDTKSVDKGAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI S + PDQ+SGKVELQYLH+YAGIS+SIGLTA+P+V+FSGV GN T ALGTDV+FD
Sbjct  90   LKTIFSCIFPDQRSGKVELQYLHDYAGISSSIGLTATPIVNFSGVLGNETFALGTDVAFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT K TK NAG SF+TSDLIA+ T+NDKG+ L ASYYHTV PLT T+VGAEL+HS S+N
Sbjct  150  TATSKLTKCNAGFSFTTSDLIAAATVNDKGNTLTASYYHTVSPLTRTSVGAELSHSLSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLTIGTQH LDP TTVK ++NNFGKA ALIQHEWRPKSLFT+ GEVD RAIEKSAK+G
Sbjct  210  ENTLTIGTQHSLDPLTTVKGRLNNFGKASALIQHEWRPKSLFTLCGEVDARAIEKSAKVG  269

Query  211  LAVALKP  191
            L+VALKP
Sbjct  270  LSVALKP  276



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVELQYLH+YAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  90   LKTIFSFRVPDQRSGKVELQYLHDYAGISSSIGLTANPIVNFSGVFGTNVLALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSFS  DLIAS+ LN+KGD L ASYYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKTGNFTKCNAGLSFSNVDLIASVALNEKGDSLNASYYHIVNPLTNTAVGAEVTHCFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T VKA+VNN GKA ALIQHEWRP+SLFTISGEVDT++I+KSAK+G
Sbjct  210  ENTITVGTQHALDPLTMVKARVNNAGKASALIQHEWRPRSLFTISGEVDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGIS+SIGLTA+P+V+FSGV G N LALG D++FD
Sbjct  90   LKAIFSFKVPDQRSGKVELQYLHDYAGISSSIGLTANPIVNFSGVIGTNVLALGADLTFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLSF+  DLIA+LTLNDKGD L ASYYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKSNAGLSFTKDDLIAALTLNDKGDALNASYYHVVSPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK+NAGL+F+  DL+ASLT+N+KGD L ASYYHTV  LTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKFNAGLNFTKDDLVASLTVNNKGDSLNASYYHTVNRLTNTAVGAEVTHQFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TTVKA+VNN GKA+ALIQHEWRP+S FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHALDPLTTVKARVNNLGKANALIQHEWRPRSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L +ALKP
Sbjct  270  LGLALKP  276



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGISTS+GLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  89   LKAIFSFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSGVIGTNQLALGTDLSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG  TK NAG+SFS +DLIA+LTLNDKGD L ASYYH V PL NTAVGAE+TH F +N
Sbjct  149  TKTGNLTKCNAGVSFSNADLIAALTLNDKGDILSASYYHNVNPLANTAVGAEVTHRFPTN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS  TISGEVDT+AIEK+AKIG
Sbjct  209  ENTITLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFVTISGEVDTKAIEKTAKIG  268

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  269  LALALKP  275



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+E+QYLHEYAGISTS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTILSFRVPDQRSGKLEVQYLHEYAGISTSVGLTANPIVNFSGVVGTNILALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            + TG FTK NAGLSF+ +DL+ASL LNDKGD L ASYYH+V P T+TAVGAE+ H FS+N
Sbjct  150  SKTGDFTKCNAGLSFTNADLVASLNLNDKGDNLSASYYHSVSPFTSTAVGAEVNHCFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH+LDP T+VKA+VNNFGKA AL+QHEWRPKSLFTISGEVDT++++K AK G
Sbjct  210  ENTITVGTQHRLDPLTSVKARVNNFGKASALLQHEWRPKSLFTISGEVDTKSVDKGAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+SF+ PDQKS +VELQY HEYAGISTS+GLTA+P+++FSGV GN  L+LGTDVSFD
Sbjct  90   LKAILSFIVPDQKSARVELQYQHEYAGISTSLGLTANPVINFSGVVGNAALSLGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G  TK NAGL+F  +DLIASL +NDKGD L ASYY TV P+T TAVGAEL+HSFSSN
Sbjct  150  TASGNLTKLNAGLNFIHTDLIASLLVNDKGDTLTASYYQTVSPITCTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT TIGTQH LDP T+VKA+VNN+G+A ALIQHEWRPKSLFTISGEVDTRAIEKSAKIG
Sbjct  210  ENTFTIGTQHALDPLTSVKARVNNYGRASALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGISTSIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  140  LKAIFSFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGVIGTNQLALGTDLSFD  199

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG  TK NAG+SFS +DLIA+LTLNDKGD L ASYYH V PL NTAVGAE+TH F +N
Sbjct  200  TKTGNLTKCNAGVSFSNADLIAALTLNDKGDILSASYYHNVNPLANTAVGAEVTHRFPTN  259

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS  TISGEVDT+AIEK+AKIG
Sbjct  260  ENTITLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFVTISGEVDTKAIEKTAKIG  319

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  320  LALALKP  326



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGKVELQYLH+YAGIS+S+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  89   LKAIFCFKVPDQRSGKVELQYLHDYAGISSSVGLTANPIVNFSGVIGTNQLALGADLSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG  TK NAGLSFS +DLIA+LTLNDKGD L ASYYH+V PL+NTAVGAE+TH F +N
Sbjct  149  TKTGILTKCNAGLSFSNADLIAALTLNDKGDILSASYYHSVNPLSNTAVGAEVTHRFPTN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TT+KA+VNNFGKA AL+QHEWRPKS  T+SGEVDT+AIEKSAKIG
Sbjct  209  ENTITLGTQHALDPMTTIKARVNNFGKASALVQHEWRPKSFLTVSGEVDTKAIEKSAKIG  268

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  269  LALALKP  275



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   299 bits (766),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I +F  PDQ+SGKVELQYLH+YAGISTSIGLTA+P+V+FSG  G N +ALGTD+SFD
Sbjct  90   LKSIFNFKVPDQRSGKVELQYLHDYAGISTSIGLTANPIVNFSGTIGTNVVALGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG+SF  +DLIASLT+NDKGD + ASY+H+V  LTNTAVGAE+THSFS+N
Sbjct  150  TKSGNFTKCNAGVSFCNADLIASLTVNDKGDAVNASYFHSVNLLTNTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NTLT+G QHKLDP TTVKA+VNNFGKA ALIQHEWRP+SLFTISGEVDT+A++K+AK+G
Sbjct  210  QNTLTLGAQHKLDPLTTVKARVNNFGKASALIQHEWRPRSLFTISGEVDTKAVDKTAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   299 bits (766),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L + LKP
Sbjct  270  LGLVLKP  276



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L + LKP
Sbjct  270  LGLVLKP  276



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGIS+SIGLTA+P+V+FSGV G N LALG D++FD
Sbjct  90   LKAIFSFKVPDQRSGKVELQYLHDYAGISSSIGLTANPIVNFSGVIGTNVLALGADLTFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGL F+  DLIA+LTLND+GD L ASYYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGGLTKSNAGLGFTKDDLIAALTLNDRGDALNASYYHVVSPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TT+KA+VNNFGKA ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHALDPLTTLKARVNNFGKASALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK ELQYLH+YAGIS SIGLTA+P+V+FSGV G +  ++GTD+SFD
Sbjct  90   LKTILSFKVPDQRSGKAELQYLHDYAGISASIGLTANPIVNFSGVVGTSAASVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTK+NAG S S +DLIASLTLNDKGD L ASYYH V PLT+TAVGAELT +FSSN
Sbjct  150  TASGNFTKFNAGASLSNADLIASLTLNDKGDTLTASYYHIVSPLTHTAVGAELTRTFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NTLT GTQH LDP TTVKA++NN+GKA ALIQHEWRPKSL TISGEVDTRAIEKSAK+G
Sbjct  210  DNTLTFGTQHALDPLTTVKARLNNYGKASALIQHEWRPKSLLTISGEVDTRAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I +F  PDQ+SGKVELQYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFNFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSGVVGTNILALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP TT+KA+VNNFGK+ ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTITLGTQHALDPLTTLKARVNNFGKSSALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  SKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+E+QYLH+YAGI TS+GLTA+P+V+FSGV G N +ALGTDVSFD
Sbjct  90   LKTILSFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIIALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSF+ +DL+ASL LN+KGD L ASYYHTV PLT+TAVGAE+ HSFS+N
Sbjct  150  TKTGDFTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHTVSPLTSTAVGAEVNHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH+LDP T+VKA++NNFGKA AL+QHEWRPKSLFT+SGEVDT++++K AK G
Sbjct  210  ENIITVGTQHRLDPLTSVKARINNFGKASALLQHEWRPKSLFTVSGEVDTKSVDKGAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+E+QYLH+YAGI TS+GLTA+P+V+FSGV G N +ALGTDVSFD
Sbjct  90   LKTILSFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIVALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAGLSF+ +DL+ASL LN+KGD L ASYYHTV PLT+TAVGAE+ HSFS+N
Sbjct  150  TKTGDFTKCNAGLSFTNADLVASLNLNNKGDNLTASYYHTVSPLTSTAVGAEVNHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH+LDP T+VKA++NNFGKA AL+QHEWRPKSLFT+SGEVDT++++K AK G
Sbjct  210  ENIITVGTQHRLDPLTSVKARINNFGKASALLQHEWRPKSLFTVSGEVDTKSVDKGAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQKSGKVELQY HEYAGISTSIGLTASP+V+FSG+ GNN +A+GTD+SFD
Sbjct  90   LKTIFSFIFPDQKSGKVELQYQHEYAGISTSIGLTASPIVNFSGIIGNNLVAVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  150  TASGNFTKYNAGLNVTHADLIASLTLNDKGDSLNASYYHVVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LTIGTQH LDP T +KA+VNN+G+A ALIQHEW P++  ++ GEVDT AIEKSAK+G
Sbjct  210  ENILTIGTQHALDPITLLKARVNNYGRASALIQHEWNPRTRVSLVGEVDTGAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQH+WRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHKWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L + LKP
Sbjct  270  LGLVLKP  276



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGISTS+GLT +P+V+FSGV G N LA+GTD+SFD
Sbjct  90   LKAIFSFRVPDQRSGKVELQYLHDYAGISTSVGLTPNPIVNFSGVVGTNALAVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK+NAGL+F+ +DLIASLT+NDKGD L ASYYH V PLTNTA GAE+TH FS+N
Sbjct  150  TKIGELTKFNAGLNFTKADLIASLTVNDKGDALNASYYHIVNPLTNTAFGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP T+VKA+VNN GKA+ALIQHEWR KS FTISGEVDT+AIEKSAKIG
Sbjct  210  ENTLTLGTQHALDPLTSVKARVNNLGKANALIQHEWRAKSFFTISGEVDTKAIEKSAKIG  269

Query  211  LAVALKP  191
            L +ALKP
Sbjct  270  LGLALKP  276



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PD  S K+E+QYLH+YAGISTS+GLTA+P+V+FSGV G N L+LGTDVSFD
Sbjct  90   LKTILSFRIPDHSSAKLEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH V PLT TAVGAE+THSFS+N
Sbjct  150  TKVGAITKCNAGLSFTNTDLIASLNLNDKGDSLSASYYHIVSPLTMTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+++GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTISVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  72   LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  131

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH V P TNTAVGAE+THSFS+N
Sbjct  132  TKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTNTAVGAEVTHSFSTN  191

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TT+KA+VNN GKA ALIQHEWRPKSLF+ISGEVDT++I+KS K+G
Sbjct  192  VNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISGEVDTKSIDKSPKVG  251

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  252  LALALKP  258



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ S K+E+QYLH+YAGISTS+GLTA+P+V+FSGV G N L+LGTD+SFD
Sbjct  90   LKTILSFRIPDQSSAKLEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH V PLT TAV AE+THSF +N
Sbjct  150  TKVGAITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHIVSPLTMTAVSAEVTHSFCTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTITVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF+ PDQKSGKVELQYLHEYAGISTSIGLTA+P+V+FSGV GNN +A+GTD+SFD
Sbjct  90   LKAIFSFIFPDQKSGKVELQYLHEYAGISTSIGLTANPIVNFSGVVGNNLVAVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH V PLTNTAVGAEL+H+FSSN
Sbjct  150  TASGNFTKYNAGLNITHADLIASLTLNDKGDTLNASYYHIVSPLTNTAVGAELSHNFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LTIGTQH LDP T +KA+VNN+G A ALIQH+W P++ F++ GEVDT AI KSAK+G
Sbjct  210  ENSLTIGTQHALDPLTHLKARVNNYGLASALIQHDWNPRTRFSLVGEVDTGAIGKSAKVG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+ELQYLH+YAGI TS+GLTA+P+V+FSGV G N LA GTDVSFD
Sbjct  90   LKTILSFRVPDQRSGKLELQYLHDYAGICTSVGLTANPIVNFSGVLGTNLLAFGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            + TG FTK NAGLSF+ +DLIASLTLNDKGD L ASYYHT+ PLT++AVGAE+ HSFS+N
Sbjct  150  SKTGNFTKCNAGLSFANADLIASLTLNDKGDTLNASYYHTISPLTSSAVGAEVAHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+G QH +DP T +K +VNNFGKA ALIQHEWRPKSL T S EVDT+AIEKSAK+G
Sbjct  210  QNTITLGAQHAIDPLTNLKGRVNNFGKATALIQHEWRPKSLVTFSAEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   294 bits (753),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I +F  PDQ+SGKVELQYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFNFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSGVVGTNILALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLSF+  DLIASLTLNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  TKIGELTKSNAGLSFTKDDLIASLTLNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL +GTQH LDP TT+KA+V NFGK  ALIQHEWRPKS FTISGEVDT+AIEKSAK+G
Sbjct  210  ENTLILGTQHALDPLTTLKARVTNFGKTSALIQHEWRPKSFFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   294 bits (752),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  85   LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  144

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH V P TNTAVGAE+THSFS+N
Sbjct  145  TKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTNTAVGAEVTHSFSTN  204

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TT+KA+VNN GKA ALIQHEWRPKSLF+ISGEVDT++I+KS K+G
Sbjct  205  VNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISGEVDTKSIDKSPKVG  264

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  265  LALALKP  271



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   294 bits (752),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVELQYLH+YAGISTS+GLT +P+V+FSGV G N  A+GTD+SFD
Sbjct  90   LKAIFSFRVPDQRSGKVELQYLHDYAGISTSVGLTPNPIVNFSGVVGTNARAVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK+NAGL+F+ +DLIASLT+NDKGD L ASYYH V PLTNTA GAE+TH FS+N
Sbjct  150  TKIGELTKFNAGLNFTKADLIASLTVNDKGDALNASYYHIVNPLTNTAFGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP T+VKA+VNN GKA+ALIQHEWR KS FTISGEVDT+AIEKSAKIG
Sbjct  210  ENTLTLGTQHALDPLTSVKARVNNLGKANALIQHEWRAKSFFTISGEVDTKAIEKSAKIG  269

Query  211  LAVALKP  191
            L +ALKP
Sbjct  270  LGLALKP  276



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   294 bits (752),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G N LALG D+SFD
Sbjct  90   LKAIFSFKVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVIGTNVLALGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +  G+ TK NAGLSF+  DLIASL LNDKGD L A+YYH V PLTNTAVGAE+TH FS+N
Sbjct  150  SKIGELTKSNAGLSFTKDDLIASLALNDKGDALNAAYYHVVNPLTNTAVGAEVTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH+LDP TT+KA+VNNFG+  ALIQHEWRPKS FTI GEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHQLDPLTTLKARVNNFGRTSALIQHEWRPKSFFTIFGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   294 bits (752),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+ELQYLH+YAGIS+++GLTA+P+V+FSGV GNN +ALG+DVSFD
Sbjct  90   LKTILSFRVPDQRSGKLELQYLHDYAGISSNVGLTANPIVNFSGVVGNNKVALGSDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G F K N G SF+ +DLIA+LTLNDKGD L ASYYH V PLTNTAVGAE+THSFS+N
Sbjct  150  TKEGAFVKCNFGASFTNADLIAALTLNDKGDTLSASYYHIVSPLTNTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T+VKA+VNNFGKA+ALIQHEWRPKSL T+S EVDT++I+KSAK G
Sbjct  210  ENTITVGTQHALDPLTSVKARVNNFGKANALIQHEWRPKSLITVSTEVDTKSIDKSAKFG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ+SGK+ELQYLHE+AGIS+SIGLTA+P+V+FSGV G + LALGTDVSFD
Sbjct  74   LKSIFSFKVPDQRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFD  133

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F K NAGLSFS +DLIASLT+NDKGD L ASYYH V  LTNTAVGAE TH FS+N
Sbjct  134  TKSGDFAKCNAGLSFSNADLIASLTVNDKGDTLAASYYHLVNGLTNTAVGAEFTHRFSTN  193

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T+VKA+V N GK  ALIQHEWRP+SLFTISGEVD+++I+KSAK+G
Sbjct  194  ENTITVGTQHALDPLTSVKARVTNAGKVSALIQHEWRPRSLFTISGEVDSKSIDKSAKVG  253

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  254  LALALKP  260



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ S K+E+QYLH+YAGISTS+GLTA+P+V+FSGV G N L+LGTD+SFD
Sbjct  90   LKTILSFRIPDQSSAKLEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH V PLT TAV AE+THSF +N
Sbjct  150  TKVGAITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHIVSPLTMTAVSAEVTHSFCTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+++GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTISVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI S   PDQ S K+ELQYLH+YAGI TS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTIFSCRIPDQSSAKMELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGLSF+ +DLI SL LN+KGD L ASYYH V PLT+TAVGAE+THSFS+N
Sbjct  150  TKAGAITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHIVTPLTSTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTITVGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+ELQYLH+YAGIS+S+GLTA+P+V+FS V G+N LA+G+DVSFD
Sbjct  90   LKTILSFRVPDQRSGKLELQYLHDYAGISSSVGLTANPIVNFSAVLGSNKLAVGSDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +  G  TK N G SF+ SDLIA+LTLNDKGD L ASYYHTV PLTNTAVGAE+THSFSSN
Sbjct  150  SKEGAITKCNFGASFTNSDLIAALTLNDKGDTLSASYYHTVNPLTNTAVGAEVTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T VKA+VNNFGKA ALIQHEWRPKSL T+S EVDT++I+KSAK G
Sbjct  210  ENTITVGTQHSLDPLTMVKARVNNFGKASALIQHEWRPKSLITVSTEVDTKSIDKSAKFG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  VALALKP  276



>gb|KJB11405.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=214

 Score =   290 bits (742),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  28   LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  87

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH V   TNT VGAE+THSFS+N
Sbjct  88   TKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNTVVGAEVTHSFSTN  147

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKSLFTISGEVDT++I+KS K+G
Sbjct  148  VNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVG  207

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  208  LALALKP  214



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  158  LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  217

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH V P TNTAVGAE+THSFS+N
Sbjct  218  TKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNPSTNTAVGAEVTHSFSTN  277

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TT+KA+VNN GKA ALIQHEWRPKSLF+ISGEVDT++I+KS K+G
Sbjct  278  VNTITVGTQHALDPLTTIKARVNNAGKASALIQHEWRPKSLFSISGEVDTKSIDKSPKVG  337

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  338  LALALKP  344



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ S ++E+QYLH+YAGISTS+GLTA+P+V+FSGV G N L+LGTD+SFD
Sbjct  90   LKTILSFRIPDQSSAELEVQYLHDYAGISTSLGLTANPIVNFSGVVGTNLLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGLSF+ +DLIASL LNDKGD L ASYYH V PLT TAV AE+THSF +N
Sbjct  150  TKVGAITKCNAGLSFTNTDLIASLNLNDKGDALSASYYHIVSPLTMTAVSAEVTHSFCTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+++GTQH+LDP TTVKA+VNN GKA+ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTISVGTQHQLDPLTTVKARVNNLGKANALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTIISF  PDQ+SGK+ELQYLH+YAGIS+S+GLTA+P+V+FSGV GNN  ++G+DVS+D
Sbjct  90   LKTIISFKVPDQRSGKLELQYLHDYAGISSSVGLTANPIVNFSGVVGNNLFSVGSDVSYD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK N G SF+ +DLIASLTLNDKGD L ASYYHTV P+TNTAVGAE+THSFSSN
Sbjct  150  TKEGALTKCNFGASFTNADLIASLTLNDKGDSLSASYYHTVTPVTNTAVGAEVTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LD  TTVKA++NNFGKA ALIQHEWRPKSL T+S EVDT++++KSAK G
Sbjct  210  ENTITVGTQHSLDSLTTVKARLNNFGKASALIQHEWRPKSLVTVSSEVDTKSVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQYLH+YAG++TSIGLTA+P+V+ S V G    A+G DVSFD
Sbjct  89   LKTIFSFVVPDQRSGKVELQYLHDYAGVNTSIGLTANPIVNISSVFGTKAFAVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGLS + +DLIA+LTLN+KGD L  SYYH V PL++TAVGAE+THSFSSN
Sbjct  149  TASGNFTKYNAGLSVTNADLIAALTLNNKGDSLSGSYYHLVSPLSSTAVGAEITHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT G QH LDP TTVKA+ NN+GKA ALIQHEWRPKS FTISGEVDT+AIEKS+K+G
Sbjct  209  ENTLTFGMQHALDPLTTVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI S   PDQ S K+ELQYLH+YAGI TS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTIFSCRIPDQSSAKMELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGLSF+ +DLI SL LN+KGD L ASYYH V PLT+TAVGAE+THSFS++
Sbjct  150  TKAGAITKCNAGLSFTNADLITSLNLNNKGDSLSASYYHIVTPLTSTAVGAEVTHSFSTS  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTITVGTQHQLDPLTTVKARVNNFGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ+SGK+ELQYLHE+AGIS+SIGLTA+P+V+FSGV G + LALGTDVSFD
Sbjct  90   LKSIFSFKVPDQRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F K NAGLSFS +DLIASLT+NDKGD L ASYYH V  LTNTAVGAE TH FS+N
Sbjct  150  TKSGDFAKCNAGLSFSNADLIASLTVNDKGDTLAASYYHLVNGLTNTAVGAEFTHRFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T+VKA+V N GK  ALIQHEWRP+SLFTISGEVD+++I+KSAK+G
Sbjct  210  ENTITVGTQHALDPLTSVKARVTNAGKVSALIQHEWRPRSLFTISGEVDSKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQYLH+YAG++  IGLTA+P+V+ SGV G   L++G DVSFD
Sbjct  89   LKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIGLTANPIVNLSGVVGTKALSVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGLS + +DLIA+LTLN+KGD L ASYYH V PL++TAVGAE+THSFS N
Sbjct  149  TASGNFTKYNAGLSVTNADLIAALTLNNKGDSLSASYYHLVNPLSSTAVGAEITHSFSGN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LDP T VKA+ NN+GKA ALIQHEWRPKS FTISGEVDT+AIEKS+K+G
Sbjct  209  ENTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            L++ L+P
Sbjct  269  LSLVLRP  275



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQKSGKVELQY HEYAGI+TSIGLTA+P+V+FSGV GNN +A+GTD+SFD
Sbjct  90   LKTIFSFNFPDQKSGKVELQYQHEYAGINTSIGLTANPVVNFSGVVGNNLVAVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH V PLTNTAVGAEL+HSFS N
Sbjct  150  TASGNFTKYNAGLNITHADLIASLTLNDKGDNLTASYYHIVNPLTNTAVGAELSHSFSGN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LT GTQH LDP T +K++VNN+G+A ALIQH+W P++ F++ GEVDT AIEKSAK+G
Sbjct  210  ENILTFGTQHALDPLTLLKSRVNNYGRASALIQHDWTPRTRFSLVGEVDTGAIEKSAKVG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  89   LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH V   TNT VGAE+THSFS+N
Sbjct  149  TKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNTVVGAEVTHSFSTN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKSLFTISGEVDT++I+KS K+G
Sbjct  209  VNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVG  268

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  269  LALALKP  275



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  90   LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL LN+KGD + ASYYH V   TNT VGAE+THSFS+N
Sbjct  150  TKTGNFTKCNAGFSFTNADLIASLALNEKGDSVNASYYHIVNLSTNTVVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKSLFTISGEVDT++I+KS K+G
Sbjct  210  VNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+ELQYLHEYAGIS+S+GLTA+P+V+FSGV GNN LALG+DVSFD
Sbjct  90   LKTILSFRVPDQRSGKLELQYLHEYAGISSSVGLTANPIVNFSGVVGNNKLALGSDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G F K N G SF+ +DLIA+LTLNDKGD L ASYYH V PL+NTAVGAE+THSFS+N
Sbjct  150  TKEGAFIKCNFGASFTNADLIAALTLNDKGDTLSASYYHIVSPLSNTAVGAEVTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+ +GTQH LDP T+VKA++NNFGKA ALIQHEWRPKSL T+S EVDT++I+KS K G
Sbjct  210  ENTVIVGTQHSLDPLTSVKARLNNFGKASALIQHEWRPKSLITVSTEVDTKSIDKSPKFG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI S   PDQ S K+ELQYLH+YAGI TS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   LKTIFSCRIPDQSSAKMELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK NAGL F+ +DLI SL LN+KGD L ASYYH V PLT+TAVGAE+THSFS++
Sbjct  150  TKAGAITKCNAGLRFTNADLITSLNLNNKGDSLSASYYHIVSPLTSTAVGAEVTHSFSTS  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH+LDP TTVKA+VNNFG A ALIQHEWRPKSLFTISGEVDT+A++KSAK G
Sbjct  210  ENTITVGTQHQLDPLTTVKARVNNFGMATALIQHEWRPKSLFTISGEVDTKAVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQKSGKVELQY HEYAGISTSIGLTA+P+V+FSGV GNN +A+GTD+SFD
Sbjct  90   LKTIFSFNFPDQKSGKVELQYQHEYAGISTSIGLTANPVVNFSGVVGNNLVAVGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTKYNAGL+ + +DLIASLTLNDKGD L ASYYH V PLTN+AVGAEL+HSFS N
Sbjct  150  TTSGNFTKYNAGLNITHADLIASLTLNDKGDNLTASYYHIVNPLTNSAVGAELSHSFSGN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LT GTQH LDP T +KA+VNN+G+A ALIQH+W P++ F++ GEVDT AIEKSAK+G
Sbjct  210  ENILTFGTQHALDPLTLLKARVNNYGRASALIQHDWTPRTRFSLVGEVDTGAIEKSAKVG  269

Query  211  LAVALKP  191
            LAVALKP
Sbjct  270  LAVALKP  276



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+SF  PDQ SGK ELQYLH+YAGISTS+GLTA+P+V+FSGV G N LALGTDVSFD
Sbjct  90   VKAILSFKVPDQNSGKAELQYLHDYAGISTSVGLTANPVVNFSGVLGTNLLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGL+FS +DL+ASL LN+KGD +  S+YH++ P  NTAVGAE+TH FS++
Sbjct  150  TKSGNFTKCNAGLNFSNADLMASLNLNEKGDVVSGSFYHSLYPEQNTAVGAEVTHRFSNS  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+G QH LDP T+VKA+VNN GKA+ALIQHEWRPKS FTISGEVDTRAIEKSAKIG
Sbjct  210  ENTITLGAQHALDPLTSVKARVNNIGKANALIQHEWRPKSFFTISGEVDTRAIEKSAKIG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SG++ELQYLH+YAGISTS+GLTA+P+V+F+ V G+N L+LGTDVSFD
Sbjct  90   LKTIFSFTVPDQRSGQIELQYLHDYAGISTSVGLTANPVVNFAAVLGSNVLSLGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +    FTK NAG+SFS +DLIASL LN+KGD L ASYYH V P+T+TA+GAE+THSFSSN
Sbjct  150  SKASNFTKCNAGISFSNADLIASLALNNKGDSLTASYYHIVNPVTSTAIGAEVTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TT+KA++NN GKA ALIQHEWRP+SLFT+SGEVDT++I+KSAK+G
Sbjct  210  VNTITVGTQHALDPLTTLKARINNSGKASALIQHEWRPRSLFTVSGEVDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   289 bits (740),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVEL YLH+YAG++ SIGLTA+P+V+FSGV G+ T+++G DV+FD
Sbjct  89   LKTIFSFVIPDQRSGKVELHYLHDYAGVNASIGLTANPVVNFSGVVGSKTVSVGADVAFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG F KYNA LS + +DLIA+L LN+KGD L ASYYH V PL++TAVGAELTHSFSSN
Sbjct  149  TATGNFIKYNASLSITNADLIAALALNNKGDSLSASYYHLVNPLSSTAVGAELTHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL  GTQH LDP TT+KA+ NN+GKA ALIQHEW+PKS FTISGEVDT+AIEKS+KIG
Sbjct  209  ENTLAFGTQHALDPLTTIKARFNNYGKASALIQHEWKPKSFFTISGEVDTKAIEKSSKIG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   287 bits (735),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+ELQYLH+YAGIS+S+GLTA+P+V+FSGV GNN  ALG+D+SFD
Sbjct  90   LKTILSFKVPDQRSGKLELQYLHDYAGISSSVGLTANPIVNFSGVLGNNAFALGSDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G  TK+N G S+S +DLIA+L LNDKGD L ASYYH V P+TNTAVG E+THSFSSN
Sbjct  150  TKEGNVTKWNFGASYSNADLIAALALNDKGDTLSASYYHLVSPVTNTAVGGEVTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T+VKA++NN GKA ALIQHEWRPKSL T+S EVDTR+++KSAK G
Sbjct  210  ENTITVGTQHLLDPLTSVKARINNSGKASALIQHEWRPKSLLTLSTEVDTRSVDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   287 bits (735),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I S  APDQKSGKVELQY HEYAGISTS+ LTA P+V+FSGVAGN  +  GTDVSFD
Sbjct  92   VKAIFSITAPDQKSGKVELQYFHEYAGISTSLFLTAKPIVNFSGVAGNKNVFFGTDVSFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAG+SF+T+DLIASL LNDKG+ + ASY+HTV PLTNTAVGAE TH+ ++ 
Sbjct  152  TATGNFTKYNAGISFTTADLIASLNLNDKGEKITASYFHTVSPLTNTAVGAEFTHNLTTK  211

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN + +GTQH LDP T VK ++N++G+A A+IQHEWRPKSL TISGEVDTRAIEK+AKIG
Sbjct  212  ENVVFVGTQHLLDPLTAVKGRLNSYGQASAVIQHEWRPKSLITISGEVDTRAIEKTAKIG  271

Query  211  LAVALKP  191
            LAVALKP
Sbjct  272  LAVALKP  278



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQYLH+YAG++ SIGLTA+P+V+ SGV G+  +++G DV+FD
Sbjct  89   LKTIFSFVIPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSGVVGSKNVSVGADVAFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG F KYNAGLS + +DLIASLTLN+KGD L ASYYH V PL++TAVGAEL HSFSSN
Sbjct  149  TATGNFIKYNAGLSITNTDLIASLTLNNKGDSLSASYYHLVNPLSSTAVGAELNHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LDP TT KA+ NN+GKA ALIQHEW+PKS  TISGEVDT+AIE S+KIG
Sbjct  209  ENTLTFGTQHALDPLTTAKARFNNYGKASALIQHEWKPKSFLTISGEVDTKAIENSSKIG  268

Query  211  LAVALKP  191
            L++ L+P
Sbjct  269  LSLVLRP  275



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   286 bits (733),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 163/187 (87%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAGISTS+GLTA+P+V+FS V G N L+LGTD+SFD
Sbjct  90   LKTILSFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSAVIGTNVLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            + +G FTK NAGLSF+ +DLIASL LN+KGD L ASYYH V PL  TAVGAE+ HSFS+N
Sbjct  150  SKSGNFTKCNAGLSFNNADLIASLNLNNKGDSLAASYYHFVNPL--TAVGAEVIHSFSTN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP TT+KA+VNN G A ALIQHEWRPKSLFTISGEVDT+AIEKSAK G
Sbjct  208  DNTITVGTQHILDPLTTLKARVNNAGIASALIQHEWRPKSLFTISGEVDTKAIEKSAKFG  267

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  268  LALALKP  274



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   286 bits (732),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA+GTDVSFD
Sbjct  81   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  140

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+N+KGD L ASYYH V PL NTAVGAE++H FSS 
Sbjct  141  TKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAEVSHKFSSK  200

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEWRPKS FTISGEVDT+AI+K+A++G
Sbjct  201  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKNARVG  260

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  261  LALALKP  267



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQYLH+YAG++  IGLTA+P+V+ SGV G   L++G DVSFD
Sbjct  89   LKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIGLTANPIVNLSGVVGTRGLSVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGLS   +DLIA+LTLN+KGD L ASYYH V PL NTAVGAE+THSFSSN
Sbjct  149  TASGNFTKYNAGLSVINADLIAALTLNNKGDSLSASYYHLVNPLWNTAVGAEITHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LDP T VKA+ NN+GKA ALIQHEWR KS  TISGEVDT+AIEKS+K+G
Sbjct  209  ENTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRLKSFLTISGEVDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SG+VELQY H++AG++ SIGLTA+P+VS SGV G N +A+G DVSFD
Sbjct  89   LKTIFSFVLPDQRSGQVELQYQHDHAGVNASIGLTANPIVSLSGVVGTNAVAVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA G F KYNAGLS + +DLIASLT+NDKGD + ASYYH V PL++TAVGAELTHSFSSN
Sbjct  149  TAVGDFIKYNAGLSITNADLIASLTVNDKGDSVNASYYHLVSPLSSTAVGAELTHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NTLT GTQH LDP T VKA+ NN+GKA ALIQHEWRPKS  T++GEVDT+AIEKS+K+G
Sbjct  209  QNTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRPKSFLTVTGEVDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            L++ L+P
Sbjct  269  LSLVLRP  275



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA+GTDVSFD
Sbjct  123  LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  182

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+N+KGD L ASYYH V PL NTAVGAE++H FSS 
Sbjct  183  TKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAEVSHKFSSK  242

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEWRPKS FTISGEVDT+AI+K+A++G
Sbjct  243  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKNARVG  302

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  303  LALALKP  309



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            L+TI SFV P+Q+SGKVELQYLH+YAG++TSIGLTA+P+V+ SGV G    A+G DVSFD
Sbjct  89   LRTIFSFVVPEQRSGKVELQYLHDYAGVNTSIGLTANPIVNLSGVFGTKGFAVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G FTKYNAGLS + +DLIA+LTLN+KGD L ASYYH   PL++ AVGAE+THSFSSN
Sbjct  149  TASGNFTKYNAGLSVTNADLIAALTLNNKGDSLSASYYHLASPLSSAAVGAEITHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT G Q  LDP T VKA+ NN+GKA ALIQHEWRPKS FTISGEVDT+AIEKS+K+G
Sbjct  209  ENTLTFGMQQALDPLTMVKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA+GTDVSFD
Sbjct  90   LKSIFSFKVPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+N+KGD L ASYYH V PL NTAVGAE++H FSS 
Sbjct  150  TKSGNFTKINAGLSFTKDDLIASLTVNEKGDLLNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTISGEVDT++I+KSAK+G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   284 bits (726),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAGISTS+GLTA+P+V+FS V G N L+LGTD+SFD
Sbjct  90   LKTILSFKVPDQRSGKVELQYLHDYAGISTSVGLTANPIVNFSAVIGTNVLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            + +G FTK NAGLSF+ +DLIASL LN+KGD L ASYYH V PL  TAVGAE+ HSFS+ 
Sbjct  150  SKSGNFTKCNAGLSFNNADLIASLNLNNKGDSLAASYYHFVNPL--TAVGAEVIHSFSTT  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP TT+KA+VNN G A ALIQHEWRPKSLFTISGEVDT+AIEKSAK G
Sbjct  208  DNTITVGTQHILDPLTTLKARVNNAGIASALIQHEWRPKSLFTISGEVDTKAIEKSAKFG  267

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  268  LALALKP  274



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   284 bits (726),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLHEYAGISTS+GLT +P V+FSGV G N LALGTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSGVVGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE+ H FS+N
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P+S FTISGEVDT+AI+K+AK+G
Sbjct  210  VNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPRSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV GNN LALGTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVVGNNLLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGL+F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE+ H FSS 
Sbjct  150  TKSGSFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH +DP T VKA+VN+ G A+ALIQHEW PKS FT+SGEVDT+AI+KSAK+G
Sbjct  210  VNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKSFFTVSGEVDTKAIDKSAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            L++I SF  PDQ SGKVELQYLHEYAGISTS+GLT +P V+FSGV G+N LA+GTDVSFD
Sbjct  90   LRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+NDKGD L ASYYH V PL NTAVGAE++H  SS 
Sbjct  150  TKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ++T+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTISGEVDT++I+KSAK+G
Sbjct  210  DSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G+N +ALGTDVSFD
Sbjct  155  LKSIFSFKVPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGSNVVALGTDVSFD  214

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLTLN+KGD +  SYYH V PL NTAVGAE++H FSS 
Sbjct  215  TKSGNFTKINAGLSFTKDDLIASLTLNEKGDAMNLSYYHIVNPLFNTAVGAEVSHKFSSK  274

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEWRPKS FTISGEVDT+AI+KSAK+G
Sbjct  275  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWRPKSFFTISGEVDTKAIDKSAKVG  334

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  335  LALALKP  341



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV GNN LALGTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVVGNNLLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGL+F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE+ H F+S 
Sbjct  150  TKSGSFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFASK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH +DP T VKA+VN+ G A+ALIQHEW PKS FT+SGEVDT+AI+KSAK+G
Sbjct  210  VNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKSFFTVSGEVDTKAIDKSAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   PDQKSGKVELQYLH+YAGI TS+GLTASP+V+FSGV GNN LALGTDVSF+
Sbjct  90   LKAIVSAKVPDQKSGKVELQYLHDYAGICTSVGLTASPIVNFSGVVGNNVLALGTDVSFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAG SF+  DLIA+LTLNDKGD L ASYYH V PL+NT VGAE+THSF++ 
Sbjct  150  TQSGGFKHFNAGFSFTKDDLIAALTLNDKGDKLNASYYHIVNPLSNTVVGAEVTHSFTTQ  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +N +T+G QH +DP TTVKA++NN G A+ALIQH+WRPKS  T+SGEVD+RAIEKSAK+G
Sbjct  210  KNAITVGAQHAIDPLTTVKARLNNDGVANALIQHQWRPKSFITVSGEVDSRAIEKSAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV GNN LA+GTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGNNALAVGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGL+F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE+ H FSS 
Sbjct  150  TKSGNFTKINAGLNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH +DP T VKA+VN+ G A+ALIQHEW PKS FT+SGEVDT+AI+KSAK+G
Sbjct  210  VNTITVGTQHSIDPLTMVKARVNSAGIANALIQHEWSPKSFFTVSGEVDTKAIDKSAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            L++I SF  PDQ SGKVELQYLHEYAGISTS+GLT +P V+FSGV G+N LA+GTDVSFD
Sbjct  90   LRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+NDKGD L ASYYH V PL NTAVGAE++H  SS 
Sbjct  150  TKSGNFTKINAGLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ++T+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTISGE+DT++I+KSAK+G
Sbjct  210  DSTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEIDTKSIDKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF  PDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA+GTDVSFD
Sbjct  90   LKSIFSFKVPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNALAIGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK N GLSF   DLIASLTLN+KGD L ASYYH V PL NTAVGAE++H FSS 
Sbjct  150  TKSGNFTKINGGLSFIKEDLIASLTLNEKGDLLNASYYHHVNPLFNTAVGAEVSHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTI GEVDT+AI+KSAK+G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSVGIASALIQHEWKPKSFFTICGEVDTKAIDKSAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FAIALKP  276



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVE+QYLH+YA +S+S+GLT +P+V+FSGV G N  +LGTD+SFD
Sbjct  90   LKTIFSFKVPDQRSGKVEIQYLHDYAAVSSSVGLTVNPIVNFSGVIGTNVASLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG F K NAG+S S  DLIASLTLNDKGD L ASYYH V PL  TAVGAE++HSFSSN
Sbjct  150  TKTGDFIKCNAGVSLSKVDLIASLTLNDKGDSLNASYYHIVNPL--TAVGAEVSHSFSSN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+G QH LDP TT+KA+VNN GKA AL+QH+WRPKS FT+SGEVDT+AIEK+AK+G
Sbjct  208  ENTITVGAQHALDPLTTLKARVNNAGKASALVQHQWRPKSFFTVSGEVDTKAIEKTAKVG  267

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  268  LALALKP  274



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF APDQ+SGK+ELQYLH+YAG+S+SIGLTA+P+V+F+GV GNN LALG+DVSFD
Sbjct  90   LKTILSFKAPDQRSGKLELQYLHDYAGLSSSIGLTANPVVNFAGVLGNNKLALGSDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G F KYN G SF+ +DLIA++TLN+K D + ASYYHTV PLTNTAVG E THSFSS+
Sbjct  150  TKEGAFLKYNFGASFTNADLIAAVTLNNKFDSVSASYYHTVSPLTNTAVGGEFTHSFSSS  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+GTQH LDP T VKA+VNN GK  ALIQHEWRPKSL T+S EVD +A +KSAK G
Sbjct  210  ENTITVGTQHSLDPLTNVKARVNNAGKVSALIQHEWRPKSLITVSTEVDAKAFDKSAKFG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   281 bits (720),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   PDQKSGKVELQYLH+YAGI TS+GLTASP+V+FSGV GNN LALGTDVSF+
Sbjct  90   LKAIVSAKVPDQKSGKVELQYLHDYAGICTSVGLTASPIVNFSGVVGNNVLALGTDVSFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F ++NAG SF+  DLIA+LTLNDKGD L ASYYH V PL+NT VGAE+THSF++ 
Sbjct  150  TQSGDFKQFNAGFSFTKDDLIAALTLNDKGDKLNASYYHIVNPLSNTVVGAEVTHSFTTQ  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +N +T+G QH LDP TT+KA+VNN G A+ALIQH+WRPKS  T+SGEV++RAIEK AK+G
Sbjct  210  KNAITVGAQHALDPLTTLKARVNNDGVANALIQHQWRPKSFITVSGEVNSRAIEKGAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGKVE+QYLH+YA +S+SIGLT +P+V+FSGV G N  +LGTD+SFD
Sbjct  90   LKTIFSFKVPDQRSGKVEIQYLHDYAAVSSSIGLTVNPIVNFSGVIGTNVASLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG F K NAG+S S  DLIASLTLN+KGD L ASYYH V PL  TAVGAE++HSFSSN
Sbjct  150  TKTGDFIKCNAGVSLSKVDLIASLTLNNKGDSLNASYYHIVNPL--TAVGAEVSHSFSSN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+TIG QH LDP TT+KA+VNN GKA AL+QHEWRPKS FT+SGEVDT+AIEK+AK+G
Sbjct  208  DNTITIGAQHALDPLTTLKARVNNAGKASALVQHEWRPKSFFTVSGEVDTKAIEKTAKVG  267

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  268  LALALKP  274



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   281 bits (720),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLHEYAGISTS+GLT +P V+FS V G N LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSAVMGTNVLAAGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE+ H FS+N
Sbjct  150  TKSGNFTKINAGLSFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P+S FTISGEVDT+AI+K+AK+G
Sbjct  210  VNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPRSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ S KVELQY HEY GI+TSIGLTASP+V+FS V GNN +++G+DVSFD
Sbjct  90   LKTIFSFIFPDQNSAKVELQYQHEYVGINTSIGLTASPIVNFSSVIGNNLVSVGSDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G F KYNAGL+ + +DLIASLT+NDKGD L ASYYH V PLTNTAVGAEL+ SFSSN
Sbjct  150  TASGNFIKYNAGLNVTHADLIASLTINDKGDTLNASYYHVVSPLTNTAVGAELSRSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LTIGTQH LDP T +KA+VNN+G+A ALIQH+W P++  ++ GEVDT AI+KSAK+G
Sbjct  210  ENLLTIGTQHALDPITLLKARVNNYGRASALIQHDWNPRTRISLVGEVDTVAIQKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+E+QYLHEYAGISTS+GLT +P V+FSGV G N LA+GTD+SFD
Sbjct  90   LKSIFSFKAPDQNSGKIEVQYLHEYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDISFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+N+K D L ASYYH V PL NTAVGAE++H FS+ 
Sbjct  150  TKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHIVNPLFNTAVGAEVSHRFSNK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTISGEVDT+AI+K+AK+G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVE+QYLH+Y GI+ SIGLTA+P+V+ SG  G+ TL++G DV+FD
Sbjct  89   LKTIFSFVVPDQRSGKVEIQYLHDYTGINASIGLTANPVVNLSGAVGSKTLSVGADVAFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TGKF KYNAGLS + +DLIA+LTLN++GD L ASYYH V+ L+ TAVGAELTHSFSSN
Sbjct  149  TTTGKFIKYNAGLSITNADLIAALTLNNRGDSLTASYYHLVKSLSRTAVGAELTHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LD  TTVK ++N++GKA ALIQHEW+PKS  TISGE+DT+AIEKS+K+G
Sbjct  209  ENTLTFGTQHALDRLTTVKGRINSYGKASALIQHEWKPKSFLTISGEIDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            L++ L+P
Sbjct  269  LSLVLRP  275



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   PDQKSGKVELQYLH+YAGI TS+GLTASP+V+FSGV GNN LALGTDVSF+
Sbjct  90   LKAIVSAKVPDQKSGKVELQYLHDYAGICTSVGLTASPIVNFSGVVGNNVLALGTDVSFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F ++NAG SF+  DLIA+LTLNDKGD L ASYYH V PL+NT VGAE+THSF++ 
Sbjct  150  TQSGDFKQFNAGFSFTKDDLIAALTLNDKGDKLNASYYHIVNPLSNTVVGAEVTHSFTTQ  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +N +T+G QH LDP  T+KA+VNN G A+ALIQH+WRPKS  T+SGEV++RAIEK AK+G
Sbjct  210  KNAITVGAQHALDPLATLKARVNNDGVANALIQHQWRPKSFITVSGEVNSRAIEKGAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+E+QYLH+YAGISTS+GLT +P V+FSGV G N LA+GTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIEVQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+N+K D L ASYYH V PL NTAVGAE++H FS+ 
Sbjct  150  TKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHIVNPLFNTAVGAEVSHRFSNK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTISGEVDT+AI+K+AK+G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLHEYAGISTS+GLT +P V+FS V G N LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSAVMGTNVLAAGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DL+ASLTLNDKGD + ASYYH V PL NTAVGAE+ H FS+N
Sbjct  150  TKSGNFTKINAGLSFTKDDLVASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S FTISGEVDT+AI+K+AK+G
Sbjct  210  VNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPSSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGK+ELQYLH+Y G+ TS+G TA+P+V+FSGV G N +ALGTDVSFD
Sbjct  90   LKTILSFKVPDQRSGKLELQYLHDYVGVCTSVGATANPIVNFSGVIGTNMVALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTKYNAGLSF++ DLIA+LT NDKG+ L AS+YH V P+T  ++GAE+THS S+ 
Sbjct  150  TKTGNFTKYNAGLSFASEDLIAALTFNDKGNNLNASFYHYVNPMTKLSIGAEVTHSLSTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+G QH LDP T VKA++NN GKA AL+QHEWRP S  T+S EVDTRAIEK+AK+G
Sbjct  210  ENTVTLGAQHALDPLTNVKARINNLGKASALLQHEWRPMSTVTVSAEVDTRAIEKTAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 162/187 (87%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+SF  PDQ+SGK+E+QYLH+YA +S+SIGLT +P+V+FSGV G+N ++LGTD+SFD
Sbjct  90   LKAILSFKVPDQRSGKLEVQYLHDYAAVSSSIGLTPNPIVNFSGVIGSNAVSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLS+S +DL+A+LTLNDKGD L ASYYH V P    AVGAE++HSFS+N
Sbjct  150  TKSGNFTKCNAGLSYSNADLVAALTLNDKGDSLKASYYHIVNP--THAVGAEVSHSFSTN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+G+QH LDP TT+KA+VNNFGK  ALIQHEWRPKS FT++GEVDT+AIEKS KIG
Sbjct  208  ENTVTVGSQHALDPLTTLKARVNNFGKVSALIQHEWRPKSFFTVTGEVDTKAIEKSTKIG  267

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  268  LALALKP  274



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV G N LALGTD+SFD
Sbjct  90   LKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVLGTNVLALGTDISFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG FTK NAG SF+ +DLIASL L   GD + ASYYH V   TNT VGAE+THSFS+N
Sbjct  150  TKTGNFTKCNAGFSFTNADLIASLALY-VGDSVNASYYHIVNLSTNTVVGAEVTHSFSTN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP+TT+KA+VNN GKA ALIQHEWRPKSLFTISGEVDT++I+KS K+G
Sbjct  209  VNTITVGTQHALDPSTTIKARVNNAGKASALIQHEWRPKSLFTISGEVDTKSIDKSPKVG  268

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  269  LALALKP  275



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+E+QYLH+YAGISTS+GLT +P V+FSGV G N LA+GTDVSFD
Sbjct  90   LKSIFSFKAPDQNSGKIEVQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAVGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAGLSF+  DLIASLT+N+K D L ASYYH V P+ NTAVGAE++H FS+ 
Sbjct  150  TKSGNFTKINAGLSFAKEDLIASLTVNEKFDLLNASYYHIVNPVFNTAVGAEVSHRFSNK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LDP T+VKA+VN+ G A ALIQHEW+PKS FTISGEVDT+AI+K+AK+G
Sbjct  210  DNTITVGTQHSLDPLTSVKARVNSAGIASALIQHEWKPKSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   278 bits (712),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SFV PDQ+SGKVELQYLH++ G++ SIGLTA+P+V+ SGV G + +A+G DVSFD
Sbjct  89   LKTIFSFVVPDQRSGKVELQYLHDHGGVNASIGLTANPIVNLSGVVGTDAVAVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA G F K NAGLS + +DLIASLT+NDKGD + ASYYH V PL++TAVGAELTHSFSSN
Sbjct  149  TANGDFIKCNAGLSITNADLIASLTVNDKGDCVNASYYHLVSPLSSTAVGAELTHSFSSN  208

Query  391  E-NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKI  215
            + NTLT GTQH LDP T VKA+ NN+GKA ALIQHEWRPKS  TI+GEVDT+AIEKS+K+
Sbjct  209  QKNTLTFGTQHALDPLTLVKARFNNYGKASALIQHEWRPKSFLTITGEVDTKAIEKSSKV  268

Query  214  GLAVALKP  191
            GL++ L+P
Sbjct  269  GLSLVLRP  276



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLHEYAGISTS+GLT +P V+FSGV G N LALGTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHEYAGISTSMGLTQNPTVNFSGVVGTNVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE+ H FS+N
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVNHKFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQ+ LDP TTVKA VN+ G A +LIQH+W P+S FTISGEVDT+AI+K+AK+G
Sbjct  210  VNTITVGTQNSLDPLTTVKAPVNSAGIAKSLIQHQWTPRSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+SF  PDQ+SGK ELQYLH+YAG++ SIG+TA+P+V+ SG  G   LA+G D+S D
Sbjct  90   LKAILSFAVPDQRSGKFELQYLHDYAGVNASIGMTANPIVNLSGSFGTKALAVGADISLD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAGLS +  DLIASL LN+KGD L A+YYH+V  LT+TAVGAELTHSFSSN
Sbjct  150  TATGNFTKYNAGLSVTHEDLIASLNLNNKGDSLTAAYYHSVSQLTSTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LDP T +KA+ NN GKA ALIQHEWRPKSL TIS EVDT+ IEKS+K+G
Sbjct  210  ENTLTFGTQHALDPLTVLKARFNNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>gb|ABB02635.1| unknown [Solanum tuberosum]
Length=171

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -1

Query  703  VELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFS  524
            +ELQYLH+YAGI TS+GLTA+P+V+FSGV G N LALGTDVSFDT  G  TK NAGLSF+
Sbjct  1    MELQYLHDYAGICTSVGLTANPIVNFSGVLGTNVLALGTDVSFDTKAGAITKCNAGLSFT  60

Query  523  TSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPAT  344
             +DLI SL LN+KGD L ASYYH V PLT+TAVGAE+THSFS++ENT+T+GTQH+LDP T
Sbjct  61   NADLITSLNLNNKGDSLSASYYHIVTPLTSTAVGAEVTHSFSTSENTITVGTQHQLDPLT  120

Query  343  TVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  191
            TVKA+VNNFG A ALIQHEWRPKSLFTISGEVDT+A++KSAK GLA+ALKP
Sbjct  121  TVKARVNNFGTATALIQHEWRPKSLFTISGEVDTKAVDKSAKFGLALALKP  171



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   276 bits (707),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAAGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE++H FSS 
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S FTISGEVDT+AI+K+AK+G
Sbjct  210  TNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++LKP
Sbjct  270  LALSLKP  276



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   276 bits (706),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I++   PDQKSGK+ELQYLH+YAGI+TSIGLT SP V+FSGV G N LALGTDVSF+
Sbjct  90   VKAILTAKLPDQKSGKLELQYLHDYAGIATSIGLTGSPTVNFSGVVGTNVLALGTDVSFE  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAGLSF+  DLIASLTLNDKG+ L ASYYH V P+TNT VGAE++H+F++ 
Sbjct  150  TDSGNFKHFNAGLSFTKDDLIASLTLNDKGEKLNASYYHIVNPVTNTVVGAEVSHNFTTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+G+Q+ +DP TTVKA+VNN G A+ALIQHEWRPKS FT+SGEVD++AIEKSAK+G
Sbjct  210  ENAITVGSQYAMDPLTTVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSKAIEKSAKVG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  IALALKP  276



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   276 bits (706),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+S   PDQKSGK+ELQY H+YAGI+TSIGLT SP V+FSGV G N LALGTDVSF+
Sbjct  90   VKAILSAKLPDQKSGKLELQYFHDYAGIATSIGLTGSPTVNFSGVVGTNVLALGTDVSFE  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAGLSF+  DLIASLTLNDKG+ L ASYYH V PLTNT VGAE++H+F++ 
Sbjct  150  TDSGNFKHFNAGLSFTKDDLIASLTLNDKGEKLNASYYHIVSPLTNTVVGAEVSHNFTTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+G+QH +DP T VKA+VNN G A+ALIQHEWRPKS FT+SGEVD++AIEKSAK+G
Sbjct  210  ENAITVGSQHAIDPLTIVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSKAIEKSAKVG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  IALALKP  276



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            L++I +F+ PDQ+ GKVELQYLH+Y G++ ++GLTA+P+V+ SGV G N  ++G DVSFD
Sbjct  89   LRSIFNFIIPDQQLGKVELQYLHDYVGVTAAVGLTANPIVNLSGVVGTNVYSVGADVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG F K N GLS   +DLIASLT+NDKGD + ASYYH V PL++TAVGAELTH+FS+N
Sbjct  149  TATGNFIKCNGGLSVINADLIASLTVNDKGDSINASYYHLVSPLSSTAVGAELTHNFSTN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT GTQH LDP T VKA++NN+GKA ALIQHEWRPKS FTISGE+D++AIEK AK+G
Sbjct  209  ENSLTFGTQHALDPLTIVKARLNNYGKASALIQHEWRPKSFFTISGEIDSKAIEKGAKVG  268

Query  211  LAVALKP  191
            LA+ L+P
Sbjct  269  LALVLRP  275



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAAGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE++H FSS 
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S FTISGEVDT+AI+K+AK+G
Sbjct  210  TNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++L+P
Sbjct  270  LALSLRP  276



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA GTDVSFD
Sbjct  90   LKSIFSFRAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLAAGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG++F+  DLIASLTLNDKGD + ASYYH V PL NTAVGAE++H FSS 
Sbjct  150  TKSGNFTKINAGVNFTKDDLIASLTLNDKGDSVNASYYHIVNPLFNTAVGAEVSHKFSSK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TTVKA+VN+ G A+ALIQH+W P S FTISGEVDT+AI+K+AK+G
Sbjct  210  TNTITVGTQHSLDPLTTVKARVNSAGIANALIQHQWTPGSFFTISGEVDTKAIDKNAKVG  269

Query  211  LAVALKP  191
            LA++L+P
Sbjct  270  LALSLRP  276



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF  PDQ+SGK+ELQYLH+YAGI+ SIGLTA+P+V+ SG  G N LA+G DVS D
Sbjct  90   LKTIFSFAIPDQRSGKLELQYLHDYAGINASIGLTANPVVNLSGSFGTNALAVGADVSLD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNAGLSF+  DL ASL LN+KGD L ASYYH V   T TAVGAELTHSFSSN
Sbjct  150  TATKNFTKYNAGLSFTNDDLTASLNLNNKGDSLTASYYHFVEKSTKTAVGAELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL  GTQH LDP T VKA++NN GKA ALIQHE+RP+SL TIS EVDT+AIEKS+K+G
Sbjct  210  ENTLIFGTQHTLDPLTLVKARINNSGKASALIQHEFRPRSLCTISAEVDTKAIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +KT++SF  PDQ+SGKVE+QYLH+Y GI  S+GLTA+P+++ SG  G N +ALG D+++D
Sbjct  90   VKTVLSFRIPDQRSGKVEVQYLHDYFGIGASVGLTANPIINVSGTLGTNVIALGHDLTYD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+FTK N GL+F+  DL+ASLTL DKGD L ASYYH V  LT TAVGAE+TH FS+ 
Sbjct  150  TKIGEFTKLNTGLNFTKDDLVASLTLTDKGDVLNASYYHVVNHLTKTAVGAEVTHRFSNT  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT+GTQH LDP TTVKA+ NNFGKA+ALIQHEWRP+S  TISGEVDT+AIEKSAK+G
Sbjct  210  ENTLTLGTQHALDPLTTVKARFNNFGKANALIQHEWRPRSFLTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            L++I S + PDQ+SGKVELQYLH YAG++  IGLTA+P+V+ SGV G NT A+G DVSFD
Sbjct  88   LRSIFSVIIPDQRSGKVELQYLHNYAGVTAGIGLTANPVVNLSGVVGTNTYAVGADVSFD  147

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG F K N GL+   +DLIASLT+NDKGD + ASYYH V PL+ TAVGAELTH FSSN
Sbjct  148  TATGNFIKCNGGLNVINADLIASLTVNDKGDSVTASYYHLVSPLS-TAVGAELTHCFSSN  206

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T GTQH LDP T VKA+ NN GKA ALIQHEWRPKS  TISGEVDT+AIEKSAK+G
Sbjct  207  ENTMTFGTQHTLDPLTNVKARFNNCGKASALIQHEWRPKSFVTISGEVDTKAIEKSAKVG  266

Query  211  LAVALKP  191
            LA+ L+P
Sbjct  267  LALVLRP  273



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAG++ SIGLTA+P+V+ S   G   LA+G DVS D
Sbjct  90   LKTILSFAVPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSAAFGTKALAVGADVSLD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYN+GL F+  DLIASL+LN++GD L  +YYH V  LTNTAVGAELTHSFS+N
Sbjct  150  TATGNLTKYNSGLRFTHEDLIASLSLNNRGDSLTGAYYHKVSELTNTAVGAELTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T G QH LDP T +KA++NN GKA ALIQHEWRPKSL TIS EVDT+ IEKS+K+G
Sbjct  210  ENTVTFGGQHALDPLTVLKARINNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   274 bits (701),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAG+STSIGLT SP+  FSGV GN+T ++G +VSFD
Sbjct  90   LKTILSFTVPDQRSGKVELQYLHDYAGVSTSIGLTPSPITHFSGVIGNDTFSVGGEVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+G F KY+AGLSFS  D ++SLTL  KGD L ASY HTV PLT TAVGAE++HSFS +
Sbjct  150  TASGNFLKYDAGLSFSKPDFVSSLTLTGKGDTLKASYLHTVSPLTKTAVGAEISHSFSRS  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT TIGTQH LDP TTVK ++NN+GKA AL+QHEWRPKS  T+SGEVDT+A+  SAK+G
Sbjct  210  ENTFTIGTQHALDPLTTVKGRLNNYGKAAALLQHEWRPKSFVTLSGEVDTKALHNSAKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLILKP  276



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   274 bits (701),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAG++ SIGLTA+P+V+ S   G   +ALG D+S D
Sbjct  90   LKTILSFAVPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSAAFGTKAVALGADISLD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYNA L F+  DL+ASL LN+KGD L  +YYH V  LTNTAVGAELTHSFS+N
Sbjct  150  TATGNLTKYNAALRFTHEDLVASLNLNNKGDSLTGAYYHKVSELTNTAVGAELTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT G QH LDP T +KA++NN GKA ALIQHEWRPKSL TIS EVDT+ IEKS+K+G
Sbjct  210  ENTLTFGGQHALDPLTVLKARINNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   273 bits (699),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+SF  PDQ+SGK ELQYLH+YAG+S SIGLTA+P+V+ S V G   LA+G DVS D
Sbjct  89   LKSILSFAVPDQRSGKFELQYLHDYAGVSASIGLTANPVVNLSSVFGTKALAVGADVSLD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYNAGLSF+  DLIASL LN+KGD L ASYYH V   + TAVGAELTHSFSSN
Sbjct  149  TATGNLTKYNAGLSFTNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT GTQH LDP T VKA+ NN GKA AL+QHEWRPKSL+TIS EVDT+AIEKS+K+G
Sbjct  208  ENSLTFGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKSLWTISAEVDTKAIEKSSKVG  267

Query  211  LAVALKP  191
            +AVALKP
Sbjct  268  IAVALKP  274



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I S   PDQKSGK ELQYL++YAGI+TS+ LT SP+V+FSGV G N +ALGTDVSF+
Sbjct  90   VKAIFSAKLPDQKSGKFELQYLNDYAGIATSLSLTGSPIVNFSGVVGTNVVALGTDVSFE  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAG+SF+  DLIASLTLNDKG+ L ASYYH V PL+NT VGAE++H+F++ 
Sbjct  150  TESGNFKHFNAGVSFTKDDLIASLTLNDKGEKLNASYYHIVNPLSNTVVGAEVSHNFTTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH +DP TTVKA+VNN G A+ALIQHEWRPKS FT+SGEVD+RAIEKSAK+G
Sbjct  210  ENAITVGTQHAIDPLTTVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSRAIEKSAKVG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  IALALKP  276



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+S   PDQKS KVELQYLH +AGI TS+GLTA+P+V+FSGV G + LALGTDVSFD
Sbjct  90   LKTIVSAKVPDQKSAKVELQYLHPHAGICTSVGLTANPVVNFSGVIGTSVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAG+SF+  DLIASLTLNDKG+ L ASYYH V PL NT VGAE++H+  S 
Sbjct  150  TESGNFKHFNAGVSFTKDDLIASLTLNDKGEKLNASYYHIVNPLKNTVVGAEVSHNLKSQ  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             N++T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS  TISGEVD++AIEKSAK+G
Sbjct  210  VNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKSFITISGEVDSKAIEKSAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ P+QKSGKVELQYLH+YAGISTSIGLTA+P V+ S V GNN +++G+DVSF+
Sbjct  90   LKTIFSFIYPEQKSGKVELQYLHDYAGISTSIGLTATPTVNISAVLGNNLVSVGSDVSFE  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G   K N GL+ + +DLIASLT+ND+GD L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  150  TSSGSLNKCNFGLNVTHADLIASLTVNDRGDSLNASYYHVVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN LTIGTQH LDP T +KAKVNN+GKA ALIQH+W  ++ F++ GEVDT AI+K+AK+G
Sbjct  210  ENVLTIGTQHALDPVTLLKAKVNNYGKASALIQHDWSRQARFSLVGEVDTAAIQKTAKVG  269

Query  211  LAVALKP  191
            LA ALKP
Sbjct  270  LACALKP  276



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAG++ SIGLTA+P+V+ S   G   +A+G D+S D
Sbjct  90   LKTILSFAVPDQRSGKVELQYLHDYAGVNASIGLTANPVVNLSAAFGTKAVAVGADISLD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYNA L F+  DL+ASL LN+KGD L  +YYH V  LTNTAVGAELTHSFS+N
Sbjct  150  TATGNLTKYNAALRFTHEDLVASLNLNNKGDSLTGAYYHKVSELTNTAVGAELTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT G QH LDP T +KA++NN GKA ALIQHEWRPKSL TIS EVDT+ IEKS+K+G
Sbjct  210  ENTLTFGGQHALDPLTVLKARINNSGKASALIQHEWRPKSLVTISAEVDTKTIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   PDQKSGKVELQYLH+YAGISTS+GLTA+P+V+FSGV G N LALG DVSF+
Sbjct  90   LKAILSAKLPDQKSGKVELQYLHDYAGISTSVGLTANPIVNFSGVVGTNVLALGADVSFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAG SF+  DLIASLTLNDKG+ L ASYYH V PL+NT VGAE++H+F++ 
Sbjct  150  TESGNFKHFNAGFSFTKDDLIASLTLNDKGEKLNASYYHIVNPLSNTVVGAEVSHNFTTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH LDP TTVKA+VN+ G A+ALIQHEWRPKS  TISGEVD+++IEK+ K G
Sbjct  210  ENAITVGTQHALDPLTTVKARVNHAGVANALIQHEWRPKSFVTISGEVDSKSIEKNPKFG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+S   PDQKSGK+ELQYLH+YAGISTS+GLT SP V+FSGV G N LALGTDVSF+
Sbjct  90   VKAILSARLPDQKSGKLELQYLHDYAGISTSVGLTGSPTVNFSGVVGTNVLALGTDVSFE  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAGLSF+  DLIASL L+DKG+ L ASYY  V PLTNT VGAE++H+F++ 
Sbjct  150  TDSGNFKHFNAGLSFTKEDLIASLILSDKGEKLNASYYQIVNPLTNTVVGAEVSHNFTTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+G+Q+ +DP TTVKA+VNN G A+ALIQHEWRPKS FT+SGEVD++AIEKSAK+G
Sbjct  210  ENAITVGSQYAIDPLTTVKARVNNAGIANALIQHEWRPKSFFTVSGEVDSKAIEKSAKVG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  IALALKP  276



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   271 bits (693),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+SF  PDQ+SGK ELQY H+YAG+S SIGLTASP+V+ S V G   LA+G DVS D
Sbjct  89   LKSILSFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYNAGLSFS  DLIASL LN+KGD L ASYYH V   + TAVGAELTHSFSSN
Sbjct  149  TATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT GTQH LDP T VKA+ NN GKA AL+QHEWRPKS++TIS EVDT+AI+KS+K+G
Sbjct  208  ENSLTFGTQHTLDPLTVVKARFNNSGKARALLQHEWRPKSVWTISAEVDTKAIDKSSKVG  267

Query  211  LAVALKP  191
            +AVALKP
Sbjct  268  IAVALKP  274



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+SF  PDQ+SGK ELQY H+YAG+S SIGLTASP+V+ S V G   LA+G DVS D
Sbjct  89   LKSILSFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYNAGLSFS  DLIASL LN+KGD L ASYYH V   + TAVGAELTHSFSSN
Sbjct  149  TATGNLTKYNAGLSFSNDDLIASLNLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT GTQH LDP T VKA+ NN GKA AL+QHEWRPKS++TIS EVDT+AI+KS+K+G
Sbjct  208  ENSLTFGTQHTLDPLTVVKARFNNSGKASALLQHEWRPKSVWTISAEVDTKAIDKSSKVG  267

Query  211  LAVALKP  191
            +AVALKP
Sbjct  268  IAVALKP  274



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+    PD KSGK E+QY H+YA ISTS+G TASP+V+FSGV G N LALGTDV+F+
Sbjct  90   LKVIVQAKLPDHKSGKAEVQYFHDYAAISTSVGFTASPIVNFSGVVGTNVLALGTDVAFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAGL+F+  DLIASL LN+KG+ L ASYY  V PLTNT VGAE++H+F++ 
Sbjct  150  TESGNFKHFNAGLNFTKDDLIASLILNEKGEKLNASYYQIVNPLTNTVVGAEISHNFTTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH +DP TTVKA+VNN G A+ALIQHEWRPKS FT+SGEVD+RAIEKSAK+G
Sbjct  210  ENAITVGTQHAIDPLTTVKARVNNVGVANALIQHEWRPKSFFTVSGEVDSRAIEKSAKVG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  IALALKP  276



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAG++ S+ LTA+P+ + S   G   LA+G ++SFD
Sbjct  90   LKTILSFAVPDQRSGKVELQYLHDYAGVNASVSLTANPVANLSAAFGTKALAVGAEISFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +ATG FTKYNAGL F+  DLIASL +N+KGD L  +YYH V  LTNTAVGAELTHSFS+N
Sbjct  150  SATGNFTKYNAGLMFTHEDLIASLNMNNKGDNLTGAYYHKVSELTNTAVGAELTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT G QH LDP T +KA++NN GKA  LIQHEWRPKSL TIS EVDT+ IEKS+K+G
Sbjct  210  ENTLTFGGQHTLDPLTVLKARINNSGKASVLIQHEWRPKSLVTISAEVDTKTIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+SF  PDQ+SGK ELQY H+YAG+S SIGLTASP+V+ S V G   LA+G DVS D
Sbjct  89   LKSILSFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG  TKYNAGLSFS  DLIASL+LN+KGD L ASYYH V   + TAVGAELTHSFSSN
Sbjct  149  TATGNLTKYNAGLSFSNDDLIASLSLNNKGDSLTASYYHIVNH-SATAVGAELTHSFSSN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT GTQH LDP T VKA  NN GKA AL+QHEWRPKS++TIS EVDT+AI+KS+K+G
Sbjct  208  ENSLTFGTQHTLDPLTVVKAHFNNSGKASALLQHEWRPKSVWTISAEVDTKAIDKSSKVG  267

Query  211  LAVALKP  191
            +AVALKP
Sbjct  268  IAVALKP  274



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQ+SGKVELQYLH+YAG++ S+ LTA+P+ + S   G   LA+G ++SFD
Sbjct  90   LKTILSFAVPDQRSGKVELQYLHDYAGVNASVSLTANPVANLSAGFGTKALAVGAEISFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +ATG FTKYNAGL F+  DLIASL +N+KGD L  +YYH V  LTNTAVGAELTHSFS+N
Sbjct  150  SATGNFTKYNAGLMFTHEDLIASLNMNNKGDNLTGAYYHKVSELTNTAVGAELTHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT G QH LDP T +KA++NN GKA  LIQHEWRPKSL TIS EVDT+ IEKS+K+G
Sbjct  210  ENTLTFGGQHTLDPLTVLKARINNSGKASVLIQHEWRPKSLVTISAEVDTKTIEKSSKVG  269

Query  211  LAVALKP  191
            +AVALKP
Sbjct  270  IAVALKP  276



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   PDQKS KVELQY+H +AGI TS+GLTA+P+V+FSGV G + LALGTDVSFD
Sbjct  90   LKAIVSAKVPDQKSAKVELQYMHPHAGICTSVGLTANPVVNFSGVIGTSVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +N G+SF+  DLIASLTLNDKG+ L ASYYH V PL NT VGAE++H+  S 
Sbjct  150  TESGNFKHFNTGVSFTKDDLIASLTLNDKGEKLNASYYHIVNPLKNTVVGAEVSHNLKSQ  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             N++T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS  TISGEVD++AIEKSAK+G
Sbjct  210  VNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKSFITISGEVDSKAIEKSAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+SF  P+Q SGKVELQYLHEYAGIS+S+GL A+P+V+FS V G N LA G D+SFD
Sbjct  90   VKAILSFKVPEQTSGKVELQYLHEYAGISSSVGLKANPIVNFSSVIGTNALAFGADISFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NA ++F   DLI SLTLN+KGD L ASYYH + PL+NTAVG +++H FS+ 
Sbjct  150  TKLGELTKSNAAVNFVKDDLIGSLTLNEKGDLLSASYYHAINPLSNTAVGVDISHRFSTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT T+GTQH LDP TTVK +V N GKA ALIQHEWRPKSL TIS EVDT+AIEKSAKIG
Sbjct  210  ENTFTLGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKSLITISSEVDTKAIEKSAKIG  269

Query  211  LAVALKP  191
            L++ALKP
Sbjct  270  LSLALKP  276



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+SF  PDQKSGKVELQYLH+YAGI+ SIGLTA+P+V+ SG  G + LA+G DVS D
Sbjct  90   LKTILSFAVPDQKSGKVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSLD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  F KYNA LS++  DLIASL LN+KGD L ASYYH V   + TAVGAELTHSFSSN
Sbjct  150  TATKNFAKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFSSN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+LT GTQH LDP T VKA++NN GKA ALIQHE+ PKSL TIS EVDT+AIEKS+K+G
Sbjct  209  ENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFMPKSLCTISAEVDTKAIEKSSKVG  268

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  269  IAIALKP  275



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   PDQKS KVELQY+H +AGI TS+GLTA+P+V+FSGV G + LALGTDVSFD
Sbjct  90   LKAIVSAKVPDQKSAKVELQYMHPHAGICTSVGLTANPVVNFSGVIGTSVLALGTDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +N G+SF+  DLIASLTLNDKG+ L ASYYH V PL NT VGAE++H+  S 
Sbjct  150  TESGNFKHFNTGVSFTKDDLIASLTLNDKGEKLTASYYHIVNPLKNTVVGAEVSHNLKSQ  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             N++T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS  TISGEVD++AIEKSAK+G
Sbjct  210  VNSITVGTQHALDPLTTVKARVNNAGIANALIQHEWRPKSFITISGEVDSKAIEKSAKVG  269

Query  211  LAVALKP  191
             A+ALKP
Sbjct  270  FALALKP  276



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+SF  PDQ SGKVELQYLH+YAG+S S GL A+P+V+ S V G N LA+G D+SFD
Sbjct  90   VKAILSFKVPDQTSGKVELQYLHDYAGLSGSFGLKANPIVNLSSVVGTNVLAIGADLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T  G+ TK NAGLS++  DLIASLTLN+KGD L AS+YH V PLTNTA G ++ H FS+ 
Sbjct  150  TKLGELTKSNAGLSYAKDDLIASLTLNNKGDALNASFYHLVNPLTNTAFGVDVNHRFSTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT T+GTQH LD  TTVKA+V N GKA ALIQHEWRPKSLFTISGEVDT+AIEKSAK+G
Sbjct  210  ENTFTLGTQHALDSLTTVKARVTNAGKASALIQHEWRPKSLFTISGEVDTKAIEKSAKVG  269

Query  211  LAVALKP  191
            L++ALKP
Sbjct  270  LSLALKP  276



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+S   PDQKSGK+ELQYLH+YAGI TS+GLTA+P V+F+GV G N LALGTD SF+
Sbjct  90   LKTILSAKLPDQKSGKLELQYLHDYAGICTSVGLTANPTVNFAGVVGTNILALGTDASFN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T TG     N GLSF+  DLIASL LNDKG+ L ASYYH V PLTNT VGAE+ H+FS+N
Sbjct  150  TETGNLKHLNFGLSFTKDDLIASLNLNDKGEKLNASYYHIVNPLTNTVVGAEVNHNFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +NT+T+GTQH LD  TTVKA+VNN G A+ALIQH+WRPKS  TIS E+D++AIEK+ K+G
Sbjct  210  QNTITVGTQHALDSLTTVKARVNNAGVANALIQHQWRPKSFVTISSEIDSKAIEKTPKVG  269

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  270  IALALKP  276



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHEYAGI+ S+GL ++P+V+ SGV G+  L++G DV+FD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEYAGINASVGLNSNPMVNLSGVFGSKELSVGVDVAFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS + SDLIASL LN+ GD L ASYYH V+  +NTAVGAEL+HSFS N
Sbjct  149  TATSNFTKYNAALSLTNSDLIASLHLNNHGDTLIASYYHLVKHHSNTAVGAELSHSFSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSLITISGEVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQ--KSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVS  578
            LKTI+SF  P+   KSGK E+QYLH+YAGIS SIGLTA+P+ +FSGV GNN +ALG D+S
Sbjct  90   LKTILSFRIPEPELKSGKAEVQYLHDYAGISASIGLTANPVANFSGVIGNNVVALGGDLS  149

Query  577  FDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFS  398
            +DT TG FT+ NAGL+F+  DLIASLTLN+K + L ASYYH V P+T TAVGAE++H FS
Sbjct  150  YDTKTGVFTRLNAGLNFTKDDLIASLTLNEKANALNASYYHVVNPVTKTAVGAEVSHRFS  209

Query  397  SNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            + ENTLT+GTQH +D  TT K + NNFG A  LIQHEWRPKS FTISGEVDT+AIEKSA+
Sbjct  210  TKENTLTLGTQHAIDSLTTAKLRFNNFGLASGLIQHEWRPKSFFTISGEVDTKAIEKSAR  269

Query  217  IGLAVALKP  191
            IG+A+ALKP
Sbjct  270  IGIALALKP  278



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHEYAGI+ S+GL ++P+V+ SGV G+  L++G DV+FD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEYAGINASVGLNSNPMVNLSGVFGSKELSVGVDVAFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS + S+LIAS+ LN+ GD L  SYYH V+  +NTAVGAEL+HSFS N
Sbjct  149  TATSNFTKYNAALSLTNSELIASMHLNNHGDTLTTSYYHLVKHHSNTAVGAELSHSFSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSLITISGEVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI+S   PDQ+SGK+E+QYLH+YA +S+S+GL  +P V+FSGV G N ++LGT++SFD
Sbjct  90   LKTILSCKLPDQRSGKLEIQYLHDYAAVSSSVGLAPNPTVNFSGVIGTNVVSLGTELSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G FTK NAG S+S +DLIASLTLNDKGD L ASYY  V P+   AVGAE++HSFS+N
Sbjct  150  TKSGNFTKCNAGFSYSNADLIASLTLNDKGDSLKASYYQIVNPV--HAVGAEVSHSFSTN  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT+T+G+QH LDP TT+K +VNNFGKA AL QHEWRPKS  T+S EVDT+AIE + KIG
Sbjct  208  ENTITLGSQHALDPLTTMKTRVNNFGKASALFQHEWRPKSFITVSAEVDTKAIESNPKIG  267

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  268  LALALKP  274



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   261 bits (667),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+E QYLHE+AGI+ ++GL  +P+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKLEFQYLHEFAGINANVGLNPNPMVNLSGVFGSKELSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+P ++TAVGAEL+HSFS N
Sbjct  149  TATSNFTKYNAALSLTNPDLIASLHLNNHGDTLTASYYHLVKPHSSTAVGAELSHSFSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHEYAG++ S+GL ++P+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEYAGVNASVGLNSNPMVNLSGVFGSKELSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS +  DLIASL LN+ GD + ASYYH V+  + TAVGAEL+HSFS N
Sbjct  149  TATSNFTKYNAALSLTNPDLIASLHLNNHGDTMVASYYHLVKHHSGTAVGAELSHSFSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS  TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L+V LK
Sbjct  269  LSVVLK  274



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHE+AG++ S+GL  +P+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEFAGVNASVGLNPNPMVNLSGVFGSKELSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+  ++TAVGAEL+H+F  N
Sbjct  149  TATSNFTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHLVKSHSSTAVGAELSHNFPRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWRPKSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ P+QKSGKVELQYLH+YAGISTSIGLTA+P V+ S V GNN +++G+DVSF+
Sbjct  90   LKTIFSFIYPEQKSGKVELQYLHDYAGISTSIGLTATPTVNISAVLGNNLVSVGSDVSFE  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G   K N GL+ + +DLIASLT+ND+GD L ASYYH V PLTNTAVGAEL+HSFSSN
Sbjct  150  TSSGSLNKCNFGLNVTHADLIASLTVNDRGDSLNASYYHVVSPLTNTAVGAELSHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            EN LTIGTQH LDP T +KAKVNN+GKA ALIQH+W  ++ F++ GEVDT AI+K+AK
Sbjct  210  ENVLTIGTQHALDPVTLLKAKVNNYGKASALIQHDWSRQARFSLVGEVDTAAIQKTAK  267



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHE+A ++ S+GL  SP+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEFASVNASVGLNPSPMVNLSGVFGSKELSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+  ++TAVGAEL+H+F  N
Sbjct  149  TATSNFTKYNAALSLAYPDLIASLHLNNHGDTLTASYYHLVKSHSSTAVGAELSHNFPRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWRPKSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K I+S   P+Q+SGK+E QYLHEYAG++ S+GL ++P+V+ SG  G+  L++G DVSFD
Sbjct  90   VKAILSEKVPEQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA ++F    LI SLTLN+KGD L ASYYH + PL+NTAVG +++H FS+ 
Sbjct  150  TATSDFTKYNAAVNFVKDSLIGSLTLNEKGDLLSASYYHAINPLSNTAVGVDISHRFSTK  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN  T+GTQH LDP TTVK +V N GKA ALIQHEWRPKSL TIS EVDT+AIEKSAKIG
Sbjct  210  ENDFTLGTQHALDPLTTVKGRVTNSGKASALIQHEWRPKSLITISSEVDTKAIEKSAKIG  269

Query  211  LAVALK  194
            L++ALK
Sbjct  270  LSLALK  275



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHE+AGI+ S+GL  +P+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEFAGINASVGLNPNPMVNLSGVFGSKELSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+  ++TAVGAEL+H+F  N
Sbjct  149  TATSNFTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHLVKSHSSTAVGAELSHNFPRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWR KSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRAKSLVTISGEVDTKAIEKSTKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK ELQYLHEYAG++ SIGL  +P+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKFELQYLHEYAGVNASIGLNPNPMVNISGVFGSKALSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS ++ DLIASL LN+ GD L  SYYH V+  + TAVGAEL+HS S N
Sbjct  149  TATSNFTKYNAALSLTSPDLIASLHLNNHGDTLVGSYYHLVKHHSGTAVGAELSHSISRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS  TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I+S V PDQ+SGK+ELQYLHE+AGI+ S+GL  +P+V+ SGV G+  L++G DVSFD
Sbjct  89   LKSILSLVVPDQRSGKLELQYLHEFAGINASVGLNPNPMVNLSGVFGSKELSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+  ++TAVGAEL+H+F  N
Sbjct  149  TATSNFTKYNAALSLTYPDLIASLHLNNHGDTLTASYYHLVKYTSSTAVGAELSHNFPRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP T+VKA+ NN+G A AL+QHEWR KSL TISGEVDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTSVKARFNNYGMASALVQHEWRAKSLVTISGEVDTKAIEKSTKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+    PD KSGK E+QY H+YAGISTS+G TA+P+V+FSGV G N L+LGTDV+++
Sbjct  90   LKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAG +F+  DL ASL LNDKG+ L ASYY  V P  +T VGAE++H+F++ 
Sbjct  150  TESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSP--STVVGAEISHNFTTK  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS FT+SGEVD++AI+KSAK+G
Sbjct  208  ENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVG  267

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  268  IALALKP  274



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I++ V PDQ+SGK+ELQYLHEY G++ SIGL ++P+V+ SG  G+  L++G DVSFD
Sbjct  89   LKSILTLVVPDQRSGKLELQYLHEYTGVNASIGLNSNPMVNLSGAFGSKALSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T T  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+  + TAVGAEL+HS S N
Sbjct  149  TETSNFTKYNAALSLANPDLIASLHLNNHGDTLVASYYHLVKHHSGTAVGAELSHSISRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS  T+SGEVDTRAIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+    PD KSGK E+QY H+YAGISTS+G TA+P+V+FSGV G N L+LGTDV+++
Sbjct  90   LKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYN  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +G F  +NAG +F+  DL ASL LNDKG+ L ASYY  V P  +T VGAE++H+F++ 
Sbjct  150  TESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSP--STVVGAEISHNFTTK  207

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN +T+GTQH LDP TTVKA+VNN G A+ALIQHEWRPKS FT+SGEVD++AI+KSAK+G
Sbjct  208  ENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVG  267

Query  211  LAVALKP  191
            +A+ALKP
Sbjct  268  IALALKP  274



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+    P QKS K ELQYLH +AG++ S+GL A+P+V+ SGV G  T+A+G D SFD
Sbjct  92   LKAILCIPFPYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKTIAVGADASFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G  TKYNAGLS++  D +A+ TLN+KGD L ASYYH V   + TAVG ELTHSFSSN
Sbjct  152  TSSGDLTKYNAGLSYNAGDFVAAATLNNKGDSLAASYYHLVN--STTAVGGELTHSFSSN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LDP TTVKA+ NN+G A ALIQHEWRPKSL TIS EVDT+AIEKS+K+G
Sbjct  210  ENTLTFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISTEVDTKAIEKSSKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+I++ V PDQ+SGK+ELQYLHEY G++ SIGL ++P+V+ SG  G+  L++G DVSFD
Sbjct  89   LKSILTLVVPDQRSGKLELQYLHEYTGVNASIGLNSNPMVNLSGAFGSKALSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T +  FTKYNA LS +  DLIASL LN+ GD L ASYYH V+  + TAVGAEL+HS S N
Sbjct  149  TESSNFTKYNAALSLANPDLIASLHLNNHGDTLVASYYHLVKHHSGTAVGAELSHSISRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TTVKA+ NN+G A AL+QHEWRPKS  T+SGEVDTRAIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTVKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+II+ V PDQ+SGK+E QYLHEYAG++ S+GL ++P+V+ SG  G+  L++G DVSFD
Sbjct  91   LKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFD  150

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS ++ DLIASL LN+ GD L ASYYH V+  + TAVGAEL+HS S N
Sbjct  151  TATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRN  210

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS  TISG+VDT+AIEKS K+G
Sbjct  211  ESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVG  270

Query  211  LAVALK  194
            L++ LK
Sbjct  271  LSLVLK  276



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+II+ V PDQ+SGK+E QYLHEYAG++ S+GL ++P+V+ SG  G+  L++G DVSFD
Sbjct  89   LKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS ++ DLIASL LN+ GD L ASYYH V+  + TAVGAEL+HS S N
Sbjct  149  TATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS  TISG+VDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+II+ V PDQ+SGK+E QYLHEYAG++ S+GL ++P+V+ SG  G+  L++G DVSFD
Sbjct  89   LKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNA LS ++ DLIASL LN+ GD L ASYYH V+  + TAVGAEL+HS S N
Sbjct  149  TATSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS  TISG+VDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK+II+ V PDQ+SGK+E QYLHEYAG++ S+GL ++P+V+ SG  G+  L++G DVSFD
Sbjct  89   LKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TA+  FTKYNA LS ++ DLIASL LN+ GD L ASYYH V+  + TAVGAEL+HS S N
Sbjct  149  TASSDFTKYNAALSLTSPDLIASLHLNNHGDTLVASYYHLVKNHSGTAVGAELSHSMSRN  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            E+TL  G+QH LDP TT+K + NN+G A AL+QHEWRPKS  TISG+VDT+AIEKS K+G
Sbjct  209  ESTLIFGSQHSLDPHTTIKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVG  268

Query  211  LAVALK  194
            L++ LK
Sbjct  269  LSLVLK  274



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 150/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI  F  PDQ+SGK++LQYL+EYA IS+SIGLT +P+V+FSGV G N LALGTD+SF+
Sbjct  145  LKTIFGFKVPDQRSGKIKLQYLYEYARISSSIGLTTNPIVNFSGVFGTNVLALGTDISFN  204

Query  571  TATGKFTKYNAGLSFSTSDLIASLTL----NDKGDFLGASYYHTVRPLTNTAVGAELTHS  404
               G FTK NAGLSF+ +DLIASL L    N+KGD + ASYYH V P TN  VGAE+T+S
Sbjct  205  MKFGNFTKCNAGLSFTNADLIASLALHVVMNEKGDSVNASYYHIVNPSTNIVVGAEVTYS  264

Query  403  FSSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKS  224
            F++N NT+T+GTQ+ LDP TT+KA VNN     ALIQHEW  KSLFTI GEVDT +I+KS
Sbjct  265  FTTNVNTITVGTQYALDPLTTIKAWVNNASMVSALIQHEWLSKSLFTIYGEVDTESIDKS  324

Query  223  AKIGLAVALKP  191
             K+GLA+ALKP
Sbjct  325  PKVGLALALKP  335



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   P QKS K E+QYLH +AG++  +GL A+PLVSFSGV G    A+GTDV+FD
Sbjct  96   LKGILSIPFPYQKSAKAEVQYLHPHAGLNAIVGLNANPLVSFSGVFGTGAFAVGTDVAFD  155

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAGLS +T DL A+L LN+KGD L ASYYH V     +AVGAEL HSFSSN
Sbjct  156  TATGDFTKYNAGLSHTTPDLTAALLLNNKGDSLAASYYHKVSK--TSAVGAELAHSFSSN  213

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTLT GTQH LD  TTVKA+ NNFG A ALIQHE+RPKSL TIS EVDT+AI+KS+K+G
Sbjct  214  ENTLTFGTQHALDELTTVKARFNNFGMASALIQHEFRPKSLVTISTEVDTKAIDKSSKVG  273

Query  211  LAVALKP  191
            L++ LKP
Sbjct  274  LSLVLKP  280



>ref|XP_002440144.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
 gb|EES18574.1| hypothetical protein SORBIDRAFT_09g026790 [Sorghum bicolor]
Length=276

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+    P QKS K ELQYLH +AG++ S+GL A+P+V+ SGV G  T+A+G D ++D
Sbjct  92   LKGILCIPFPYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKTIAVGADAAYD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G  TKYNAGLS++TSD +A+ TLN KGD + ASYYH V P   TAVG EL+HSFS+N
Sbjct  152  TSSGDLTKYNAGLSYTTSDFVAAATLNHKGDNIAASYYHLVSP--TTAVGGELSHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T GTQH LDP TTVKA+ NN+G A ALIQHEWRPKSL TIS EVDT+AIEKS+K+G
Sbjct  210  GNTITFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISAEVDTKAIEKSSKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   245 bits (626),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I++   P+Q +GK E+QYLH+YAGI+ S GL + PLV+ SGV G   +A+G DV++D
Sbjct  89   LKKIVTIPFPNQAAGKAEVQYLHDYAGINASFGLNSKPLVNLSGVFGTKAIAVGADVAYD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTKYNAGL+F+ +DLIAS+TLN+KGD L ASYYH V    NTAVGAE+T SFSS 
Sbjct  149  TATGDFTKYNAGLNFTNTDLIASVTLNNKGDSLTASYYHLVNAEKNTAVGAEVTRSFSSK  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            +N +T GTQH LDP+TTVKA+ N+ G A ALIQHEWRPKS  T++ EVDT+A EKS+K+G
Sbjct  209  KNIVTFGTQHALDPSTTVKARYNSNGMASALIQHEWRPKSFVTLTTEVDTKAFEKSSKVG  268

Query  211  LAVALKP  191
            L++ LKP
Sbjct  269  LSLVLKP  275



>ref|NP_001104949.1| voltage-dependent anion channel protein2 [Zea mays]
 gb|AAD56653.1|AF178952_1 voltage-dependent anion channel protein 2 [Zea mays]
 gb|ACF85067.1| unknown [Zea mays]
 gb|ACG34248.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|AFW78894.1| outer membrane protein porinVoltage-dependent anion channel protein 
2 [Zea mays]
Length=276

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+    P QKS K ELQYLH +AG++ S+GL A+P+V+ SGV G   +A+G D +FD
Sbjct  92   LKAILCVPFPYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKAIAVGADAAFD  151

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G  TKYNAGLS++T D +A+ TLN+KGD + ASYYH+V P   TAVG EL+HSFS+N
Sbjct  152  TSSGDLTKYNAGLSYTTPDFVAAATLNNKGDNIAASYYHSVSP--TTAVGGELSHSFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T GTQH LDP TTVKA+ NN+G A ALIQHEWRPKSL TIS EVDT+AIEKS+K+G
Sbjct  210  GNTITFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISTEVDTKAIEKSSKVG  269

Query  211  LAVALKP  191
            L++ LKP
Sbjct  270  LSLVLKP  276



>gb|KJB31318.1| hypothetical protein B456_005G186100, partial [Gossypium raimondii]
Length=247

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 8/187 (4%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I  F   DQ+S K        YAGIS+SIGLTA+P+V+ SGV G N LALGTD+SFD
Sbjct  69   LKAIFGFRVSDQRSCK--------YAGISSSIGLTANPIVNLSGVLGTNVLALGTDISFD  120

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T T  FTK NA LSF+ +DLIASL LN+KG+ + ASYYH V P TNT VG E+THSFS+N
Sbjct  121  TKTKNFTKCNARLSFTNADLIASLALNEKGNSINASYYHIVNPSTNTVVGVEVTHSFSTN  180

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T+GTQH LDP TT KA+VN+ GKA  LIQH+WRPKSLFTIS EVDT++I+KS K+G
Sbjct  181  VNTITVGTQHVLDPLTTTKARVNHAGKASTLIQHKWRPKSLFTISREVDTKSIDKSPKVG  240

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  241  LALALKP  247



>gb|ADE76112.1| unknown [Picea sitchensis]
Length=174

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -1

Query  706  KVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSF  527
            +VELQYLH+YAGISTSIGLTA+P+V  S V GN  +ALG + +FDTA+G FTKYNAGL+F
Sbjct  3    QVELQYLHDYAGISTSIGLTAAPVVETSVVIGNEGVALGGEFAFDTASGNFTKYNAGLNF  62

Query  526  STSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPA  347
               D I+SL L D+GD L ASY HTV PLT TAVGAE+ HS S NENT T+GTQH  DP 
Sbjct  63   VQPDFISSLNLTDRGDTLKASYLHTVSPLTKTAVGAEIAHSISRNENTFTMGTQHAFDPF  122

Query  346  TTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  191
            TTVKA++NN GK  AL+QHEWRPKSL T+SGEVD++A++ SAKIGL++ LKP
Sbjct  123  TTVKARLNNHGKVAALVQHEWRPKSLITLSGEVDSKALDNSAKIGLSLVLKP  174



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LKTI SF+ PDQ+SGKVELQYLHEYAGISTSIGLTA+P+V+FSGV GNNTL+LGTD+SFD
Sbjct  90   LKTIFSFIIPDQRSGKVELQYLHEYAGISTSIGLTANPIVNFSGVVGNNTLSLGTDLSFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TATG FTK NAGL FS +DLIA+LTLNDKGD L ASYYHTV PLTNTAVGAEL+H FS+N
Sbjct  150  TATGNFTKCNAGLGFSNADLIAALTLNDKGDTLNASYYHTVSPLTNTAVGAELSHCFSTN  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGK  311
            ENTLTIGTQH LDP T VKA+ NN GK
Sbjct  210  ENTLTIGTQHALDPLTKVKARANNSGK  236



>gb|AFW82970.1| outer membrane protein porin, partial [Zea mays]
Length=206

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK  +    P +KS K ELQYLH +AG++ S+GL A+P+V  SGV G  T+A+G DV+FD
Sbjct  22   LKAFLCIPFPYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVAVGADVAFD  81

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G  TKYNAGLS+STSD +A+ TLN+KGD + ASYYH+V P   TAVG EL+HSFS+N
Sbjct  82   TSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSHSFSTN  139

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T GTQH LD  TTVKA+ NN G A ALIQH+WRPKSL TIS EVDT+AIEKS+KIG
Sbjct  140  GNTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEKSSKIG  199

Query  211  LAVALKP  191
            L++ LKP
Sbjct  200  LSLVLKP  206



>gb|EEC71387.1| hypothetical protein OsI_03508 [Oryza sativa Indica Group]
 gb|EEE55296.1| hypothetical protein OsJ_03247 [Oryza sativa Japonica Group]
Length=305

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   P Q +GK ELQYLH+YAGIS  +GLT+ PLV+ SGV GN ++A+G DV+ D
Sbjct  119  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  178

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH V   + TA GAELTHSFS+ 
Sbjct  179  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  238

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS  T+S EVDT+AI+K++K+G
Sbjct  239  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVG  298

Query  211  LAVALKP  191
            L++ LKP
Sbjct  299  LSLVLKP  305



>sp|Q0JJV1.3|VDAC4_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 4; AltName: 
Full=Voltage-dependent anion-selective channel protein 
4; Short=OsVDAC4 [Oryza sativa Japonica Group]
Length=317

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   P Q +GK ELQYLH+YAGIS  +GLT+ PLV+ SGV GN ++A+G DV+ D
Sbjct  131  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  190

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH V   + TA GAELTHSFS+ 
Sbjct  191  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  250

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS  T+S EVDT+AI+K++K+G
Sbjct  251  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVG  310

Query  211  LAVALKP  191
            L++ LKP
Sbjct  311  LSLVLKP  317



>ref|NP_001044063.2| Os01g0715500 [Oryza sativa Japonica Group]
 dbj|BAF05977.2| Os01g0715500 [Oryza sativa Japonica Group]
Length=318

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   P Q +GK ELQYLH+YAGIS  +GLT+ PLV+ SGV GN ++A+G DV+ D
Sbjct  132  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  191

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH V   + TA GAELTHSFS+ 
Sbjct  192  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  251

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS  T+S EVDT+AI+K++K+G
Sbjct  252  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVG  311

Query  211  LAVALKP  191
            L++ LKP
Sbjct  312  LSLVLKP  318



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K IIS   PD  SGKVELQYLH+YAGIS +IGL A+P+V+ SGV G N LA G D+S+D
Sbjct  91   VKAIISCKVPDPASGKVELQYLHDYAGISGNIGLKANPVVNLSGVFGTNALAFGGDISYD  150

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T   + TK N G+SF   DL+ +LTLN+KGD L ASYYH + P+TNTAVG ++ H FS+ 
Sbjct  151  TKLRELTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHVINPVTNTAVGVDMGHRFSTR  210

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN  T+G QH LDP TT+K ++ N  KA ALIQHEWRPKSL TIS E+DT+AIEKSAK+G
Sbjct  211  ENNFTLGVQHALDPLTTLKGRITNSAKASALIQHEWRPKSLITISTELDTKAIEKSAKVG  270

Query  211  LAVALKP  191
            L++ LKP
Sbjct  271  LSLVLKP  277



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K IIS   PD  SGKVELQYLH+YAGIS +IGL A+P+V+ SGV G N LA G D+S+D
Sbjct  91   VKAIISCKVPDPASGKVELQYLHDYAGISGNIGLKANPVVNLSGVFGTNALAFGGDISYD  150

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T   + TK N G+SF   DL+ +LTLN+KGD L ASYYH + P+TNTAVG ++ H FS+ 
Sbjct  151  TKLRELTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHVINPVTNTAVGVDMGHRFSTR  210

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN  T+G QH LDP TT+K ++ N  KA ALIQHEWRPKSL TIS E+DT+AIEKSAK+G
Sbjct  211  ENNFTLGVQHALDPLTTLKGRITNSAKASALIQHEWRPKSLITISTELDTKAIEKSAKVG  270

Query  211  LAVALKP  191
            L++ LKP
Sbjct  271  LSLVLKP  277



>gb|AFW82971.1| hypothetical protein ZEAMMB73_507543 [Zea mays]
Length=238

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK  +    P +KS K ELQYLH +AG++ S+GL A+P+V  SGV G  T+A+G DV+FD
Sbjct  54   LKAFLCIPFPYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVAVGADVAFD  113

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G  TKYNAGLS+STSD +A+ TLN+KGD + ASYYH+V P   TAVG EL+HSFS+N
Sbjct  114  TSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSHSFSTN  171

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             NT+T GTQH LD  TTVKA+ NN G A ALIQH+WRPKSL TIS EVDT+AIEKS+KIG
Sbjct  172  GNTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEKSSKIG  231

Query  211  LAVALKP  191
            L++ LKP
Sbjct  232  LSLVLKP  238



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKV-ELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSF  575
            LKTI+SF  PDQKSGKV ELQYLH+YAGI+ SIGLTA+P+V+ SG  G + LALG DVS 
Sbjct  90   LKTILSFAVPDQKSGKVVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALALGADVSL  149

Query  574  DTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSS  395
            DTAT  FTKYNA LS++  DLIASL LN+KGD L ASYYH V   + TAVGAELTHSFSS
Sbjct  150  DTATKNFTKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFSS  208

Query  394  NENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            NEN+LT GTQH LDP T VKA++NN GKA ALIQHE+ PKSL TIS EVDT+AIEKS+K
Sbjct  209  NENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFMPKSLCTISAEVDTKAIEKSSK  267



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +K IIS   PD  SGKVELQYLH+YAGIS +IGL A+P+V+ SGV G N LA G D+S+D
Sbjct  91   VKAIISCKVPDPASGKVELQYLHDYAGISGNIGLKANPVVNLSGVFGTNALAFGGDISYD  150

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T   + TK N G+SF   DL+ +LTLN+KGD L ASYYH + P+TNTAVG ++ H FS+ 
Sbjct  151  TKLRELTKSNVGVSFIKDDLLGALTLNEKGDVLNASYYHVINPVTNTAVGVDMGHRFSTR  210

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN  T+G QH LDP TT+K ++ N  KA ALIQHEWRPKSL TI  E+DT+AIEKSAK+G
Sbjct  211  ENNFTLGVQHALDPLTTLKGRITNSAKASALIQHEWRPKSLITIFTELDTKAIEKSAKVG  270

Query  211  LAVALKP  191
            L++ LKP
Sbjct  271  LSLVLKP  277



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            K I+S   P QKS K E+QYLH +AG++  +GL+A+PLVSFSG  G    A+G DV+FDT
Sbjct  98   KGILSIPFPYQKSAKAEVQYLHPHAGLNACVGLSANPLVSFSGAFGTRAFAVGADVTFDT  157

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            ATG FTKYNA LS +T DL ASL LN+KGD L  SYYH+V  +  +AVGAEL HSFSSNE
Sbjct  158  ATGDFTKYNAALSHTTEDLTASLLLNNKGDSLVTSYYHSVSKV--SAVGAELAHSFSSNE  215

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NTLT GTQH LD  TTVKA+ NNFG A ALIQHE+RPKSL TIS EVDT+AI+KS+K+GL
Sbjct  216  NTLTFGTQHALDELTTVKARFNNFGLASALIQHEFRPKSLITISTEVDTKAIDKSSKVGL  275

Query  208  AVALKP  191
            ++ LKP
Sbjct  276  SLVLKP  281



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 144/189 (76%), Gaps = 4/189 (2%)
 Frame = -1

Query  751  LKTIISFVAPDQKS--GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVS  578
            LK ++S   P QKS  GK ELQYLH + GI+ S+GL ++PLV+FSGV G    A G DV+
Sbjct  87   LKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSGVIGTKAFAFGVDVA  146

Query  577  FDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFS  398
            FDTA+G FTKYNAGLS +  DL ASL LN+K + L ASYYH V+    TAVGAE+ HSFS
Sbjct  147  FDTASGDFTKYNAGLSHTNQDLTASLNLNNKVNTLAASYYHQVQ--RTTAVGAEIAHSFS  204

Query  397  SNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            SNENT+TIGTQH+LDP TTVK + NNFG A ALIQH WRPKSL T S EVDT+AIEKS K
Sbjct  205  SNENTITIGTQHELDPLTTVKGRYNNFGVASALIQHAWRPKSLITFSTEVDTKAIEKSPK  264

Query  217  IGLAVALKP  191
             GLA++LKP
Sbjct  265  FGLALSLKP  273



>gb|KHG11726.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=205

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = -1

Query  688  LHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSDLI  509
            LHEY GIS+SIGLTA+P+V+FSGV G N LAL  D SFDT  G FTK NAGLSF+  DLI
Sbjct  38   LHEYVGISSSIGLTANPIVNFSGVLGTNVLALRIDTSFDTKIGNFTKCNAGLSFTNVDLI  97

Query  508  ASLTL--NDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPATTVK  335
            A L L  N+KGD + ASYYH V P TN  VG E+THSFS+N NT+T+GTQH LDP TT+K
Sbjct  98   ACLALHVNEKGDSVNASYYHIVNPSTNIVVGVEVTHSFSTNVNTITVGTQHALDPLTTIK  157

Query  334  AKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  191
            A+ NN GKA  LIQHEW PKSLFTISGEVDT +I+KS  +GLA+ALKP
Sbjct  158  AQANNAGKASVLIQHEWHPKSLFTISGEVDTESIDKSPNVGLALALKP  205



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKV-ELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSF  575
            LKTI+SF  PDQKSGKV ELQYLH+YAGI+ SIGLTA+P+V+ SG  G + LA+G DVS 
Sbjct  90   LKTILSFAVPDQKSGKVVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSL  149

Query  574  DTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSS  395
            DTAT  FTKYNA LS++  DLIASL LN+KGD L ASYYH V   + TAVGAELTHSF S
Sbjct  150  DTATKNFTKYNAALSYTNQDLIASLNLNNKGDSLTASYYHIVEK-SGTAVGAELTHSFLS  208

Query  394  NENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            NEN+LT GTQH LDP T VKA++NN GKA ALIQHE+RPKSL TIS EVDT+AIEKS+K
Sbjct  209  NENSLTFGTQHTLDPLTLVKARINNSGKASALIQHEFRPKSLCTISAEVDTKAIEKSSK  267



>dbj|BAJ99317.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 4/189 (2%)
 Frame = -1

Query  751  LKTIISFVAPDQKS--GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVS  578
            LK ++S   P QKS  GK ELQYLH + GI+ S+GL  +PLV+ SGV G   LA G DV+
Sbjct  104  LKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGLNPNPLVNISGVIGTKALAFGLDVA  163

Query  577  FDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFS  398
            FDTA+G FTKYNAG+S +  DL ASL LN+KG+ L ASYYH V+ LT TAVGAE+ HSFS
Sbjct  164  FDTASGDFTKYNAGMSHTNQDLTASLMLNNKGNTLAASYYHQVQ-LT-TAVGAEIAHSFS  221

Query  397  SNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            SNENT+T+GTQH+LDP TT+K + NNFG A ALIQH WRPKS+ T S EVDT+A+EKS K
Sbjct  222  SNENTITVGTQHELDPLTTLKGRYNNFGIASALIQHAWRPKSVITFSTEVDTKAVEKSPK  281

Query  217  IGLAVALKP  191
             GLA++LKP
Sbjct  282  FGLALSLKP  290



>ref|NP_001152335.1| outer mitochondrial membrane protein porin [Zea mays]
 gb|ACG47097.1| outer mitochondrial membrane protein porin [Zea mays]
Length=314

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 145/187 (78%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK  +    P +KS K ELQYLH +AG++ S+GL A+P+V  SGV G  T+++G DV+FD
Sbjct  130  LKAFLCIPFPYKKSAKAELQYLHHHAGVAASVGLNANPVVKLSGVFGTKTVSVGADVAFD  189

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T++G  TKYNAGLS+STSD +A+ TLN+KGD + ASYYH+V P   TAVG EL+HSFS+N
Sbjct  190  TSSGNLTKYNAGLSYSTSDFVAAATLNNKGDKIAASYYHSVSP--TTAVGGELSHSFSTN  247

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
             +T+T GTQH LD  TTVKA+ NN G A ALIQH+WRPKSL TIS EVDT+AIEKS+KI 
Sbjct  248  GSTITFGTQHALDRLTTVKARFNNCGMASALIQHKWRPKSLVTISMEVDTKAIEKSSKIE  307

Query  211  LAVALKP  191
            L++ LKP
Sbjct  308  LSLVLKP  314



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   233 bits (593),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 140/189 (74%), Gaps = 4/189 (2%)
 Frame = -1

Query  751  LKTIISFVAPDQKS--GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVS  578
            LK ++    P  KS  GK ELQYLH +AGI+ S+GL A+PLV+ SGV G   LA G DV+
Sbjct  92   LKGMLCVPIPYNKSASGKAELQYLHAHAGINASVGLNANPLVNLSGVLGTKDLAFGADVA  151

Query  577  FDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFS  398
            FDTA+G FTKYNAG+S +  DL AS+ LN+KGD L ASYY  V+   +TAVGAEL HSFS
Sbjct  152  FDTASGDFTKYNAGVSLTNEDLTASVVLNNKGDTLAASYYQQVK--GSTAVGAELAHSFS  209

Query  397  SNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            SN NTLTIGTQH LDP TTVK + NN G A ALIQH WRP SL T+S E DT+A+EKS K
Sbjct  210  SNANTLTIGTQHALDPLTTVKGRFNNNGIASALIQHAWRPNSLVTVSTEFDTKAMEKSPK  269

Query  217  IGLAVALKP  191
             GLA+ALKP
Sbjct  270  FGLALALKP  278



>dbj|BAD87377.1| putative 36kDA porin II [Oryza sativa Japonica Group]
 dbj|BAD87575.1| putative 36kDA porin II [Oryza sativa Japonica Group]
Length=379

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I+S   P Q +GK ELQYLH+YAGIS  +GLT+ PLV+ SGV GN ++A+G DV+ D
Sbjct  184  LKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVD  243

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            T+TG FTKY+AGL+ + SDL A LTLN+KGD L ASYYH V   + TA GAELTHSFS+ 
Sbjct  244  TSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTK  303

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENTL+ G QH LDP TTVKA+ NN G   ALIQHEWRPKS  T+S EVDT+AI+K++K G
Sbjct  304  ENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKDG  363

Query  211  LA  206
            + 
Sbjct  364  IV  365



>gb|KJB29688.1| hypothetical protein B456_005G114000, partial [Gossypium raimondii]
Length=208

 Score =   228 bits (581),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = -1

Query  694  QYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKFTKYNAGLSFSTSD  515
             YLHE A IS+SIGLT +P+V+F GV G N LALGTD+SFDT TG FTK N GLSF+  D
Sbjct  37   NYLHECARISSSIGLTDNPIVNFLGVLGTNVLALGTDISFDTKTGNFTKRNVGLSFNNPD  96

Query  514  LIASLTL----NDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNENTLTIGTQHKLDPA  347
            LIASL L    N+KG  + +S YH V P TN  VG E+THSFS+N NT+T+GTQH LDP 
Sbjct  97   LIASLALHVVMNEKGYPVNSSSYHIVNPSTNIVVGVEVTHSFSTNVNTITVGTQHALDPL  156

Query  346  TTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP  191
            TT+KA+VNN   A ALIQHEWRPKSLFTIS EVDT++I+KS K+ LA+ALKP
Sbjct  157  TTIKARVNNIDNASALIQHEWRPKSLFTISREVDTKSIDKSPKVRLALALKP  208



>ref|XP_003569678.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=327

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK I++   P+Q +GKVE+QYLH+YAG++ S+GL + PL++ SGV GN  LA G DV++D
Sbjct  143  LKKIVTIPFPNQTAGKVEVQYLHDYAGLNVSVGLNSKPLINLSGVFGNKALAAGADVAYD  202

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +ATG FTKYNAG+S +  DL A++ LN+KGD L ASYYH+V     TAVGAE+THSFSS 
Sbjct  203  SATGNFTKYNAGVSLTNEDLSAAVMLNNKGDSLTASYYHSVN--KETAVGAEVTHSFSSK  260

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT T G+Q+ LDP TT K + NN G    LIQHEWRPKS   +S EVDT+AI+KS+KIG
Sbjct  261  ENTFTFGSQYSLDPLTTAKLRYNNLGMVSTLIQHEWRPKSFLALSTEVDTKAIDKSSKIG  320

Query  211  LAVALKP  191
            L++ L+P
Sbjct  321  LSLVLEP  327



>gb|EMT20213.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=902

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 144/189 (76%), Gaps = 4/189 (2%)
 Frame = -1

Query  751  LKTIISFVAPDQKS--GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVS  578
            LK ++S   P QKS  GK ELQYLH + GI+ S+GL ++PLV+FSGV G    A G DV+
Sbjct  716  LKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSGVIGTKAFAFGVDVA  775

Query  577  FDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFS  398
            FDTA+G FTKYNAGLS +  DL ASL LN+K + L ASYYH V+    TAVGAE+ HSFS
Sbjct  776  FDTASGDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQVQ--RTTAVGAEIAHSFS  833

Query  397  SNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            SNENT+T+GTQH+LDP TTVK + NNFG A ALIQH WRPKSL T S EVDT+AIEKS K
Sbjct  834  SNENTITVGTQHELDPLTTVKGRYNNFGIASALIQHAWRPKSLITFSTEVDTKAIEKSPK  893

Query  217  IGLAVALKP  191
             GLA++LKP
Sbjct  894  FGLALSLKP  902



>gb|EMS62963.1| Mitochondrial outer membrane protein porin [Triticum urartu]
Length=981

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 144/189 (76%), Gaps = 4/189 (2%)
 Frame = -1

Query  751  LKTIISFVAPDQKS--GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVS  578
            LK ++S   P QKS  GK ELQYLH + GI+ S+GL ++PLV+FSGV G    A G DV+
Sbjct  795  LKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSVGLNSNPLVNFSGVIGTKAFAFGVDVA  854

Query  577  FDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFS  398
            FDTA+G FTKYNAGLS +  DL ASL LN+K + L ASYYH V+    TAVGAE+ HSFS
Sbjct  855  FDTASGDFTKYNAGLSHTNQDLTASLNLNNKANTLAASYYHQVQ--RTTAVGAEIAHSFS  912

Query  397  SNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAK  218
            SNENT+TIGTQH+LDP TTVK + NNFG A ALIQH WRPKSL T S EVDT+AIEKS K
Sbjct  913  SNENTITIGTQHELDPLTTVKGRYNNFGVASALIQHAWRPKSLITFSTEVDTKAIEKSPK  972

Query  217  IGLAVALKP  191
             GLA++LKP
Sbjct  973  FGLALSLKP  981



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            KTI SF  PDQKSGKV+LQY H++ G+S+SIGLT +P+V  SG  G++ +++G +++FDT
Sbjct  91   KTIFSFKIPDQKSGKVDLQYFHDHVGLSSSIGLTPTPIVEVSGALGSDGISVGGEMAFDT  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            A+  F+KY+AG+  S  +  A++ L DKGD + ASY H V P+T TAV AE TH FS+NE
Sbjct  151  ASSTFSKYSAGIGVSKPEYTAAVILADKGDTVKASYTHIVNPITKTAVAAEFTHKFSTNE  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT T+G+ H +D  TT+K++++N GK  ALIQHEWRPKSL TISGE DT+A++KSAKIGL
Sbjct  211  NTYTVGSSHAIDRLTTMKSRLDNRGKLAALIQHEWRPKSLVTISGEFDTKALDKSAKIGL  270

Query  208  AVALKP  191
            ++ALKP
Sbjct  271  SLALKP  276



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            LK  ++   P +  GK E+QYLH+YAGIS S G+ A PLV+ S V GN  +A G DV++D
Sbjct  89   LKKTMTIPFPHRGFGKFEIQYLHDYAGISASAGMNAKPLVNLSAVFGNKAIAAGADVAYD  148

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            TAT  FTKYNAGLSF+ +DLIA++TLN+KG+ L ASYYH V    NTAVGAE+TH+FS+ 
Sbjct  149  TATRDFTKYNAGLSFTNADLIAAVTLNNKGESLTASYYHIVNTEKNTAVGAEVTHNFSTK  208

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRA--IEKSAK  218
             +T+T GTQH LDP TTVKA+ ++ G A ALIQHEWRPKS FT+S EVD  A  ++KS K
Sbjct  209  GSTVTFGTQHALDPTTTVKARYSSNGMASALIQHEWRPKSFFTLSTEVDIDASGVKKSPK  268

Query  217  IGLAVALKP  191
            +GL++ LKP
Sbjct  269  VGLSLVLKP  277



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            K++ +F  PD KSGK+EL Y  +Y GIS SIGLT SP+V  +G  GN   ++G +++FDT
Sbjct  91   KSVFTFTIPDHKSGKLELLYKQDYCGISGSIGLTPSPIVEATGALGNEGFSVGGELAFDT  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            A+G   KYNAG+ F   D  ASL L +KGD L ASY HTV P++ T V AE+ H FS NE
Sbjct  151  ASGSLIKYNAGVGFVKPDFNASLMLAEKGDLLKASYLHTVSPVSRTTVAAEIAHKFSKNE  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT T+G  ++LD  TTVKA++NN GK  AL+QHEWRPKSL T SGEVDT++++K+AKIGL
Sbjct  211  NTFTVGGLYELDTLTTVKARLNNHGKLAALLQHEWRPKSLITFSGEVDTKSLDKTAKIGL  270

Query  208  AVALKP  191
            A+ALKP
Sbjct  271  ALALKP  276



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            K++ SF  PD KSGK+E+QY  +Y GI+ SIGL+ SP+V  +G  GN+  ++G +V+FD+
Sbjct  91   KSVFSFTIPDHKSGKLEIQYKQDYCGITGSIGLSPSPIVEATGALGNDGFSVGGEVAFDS  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            A G   KYNAG+     D  AS+ L +KGD L ASY HTV P++ T + AE+ H FS NE
Sbjct  151  ANGSLIKYNAGVGLVKPDFNASIILAEKGDLLKASYLHTVSPISRTTMAAEIAHRFSKNE  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT T+G  ++LD  TTVKA++NN GK  AL+QHEWRPKSL T+SGEVDT++++K+AKIGL
Sbjct  211  NTFTVGGLYELDTLTTVKARLNNHGKLAALLQHEWRPKSLVTLSGEVDTKSLDKTAKIGL  270

Query  208  AVALKP  191
            A+ALKP
Sbjct  271  ALALKP  276



>emb|CDY70638.1| BnaCnng69120D [Brassica napus]
Length=250

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 135/190 (71%), Gaps = 17/190 (9%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDV---  581
            LK I+S    DQKS +VELQYLH + GI TS+GLTA+P+V+FSGV G + LALGTDV   
Sbjct  75   LKAIVSAKVSDQKSAEVELQYLHPHVGICTSVGLTANPVVNFSGVIGTSVLALGTDVYQV  134

Query  580  SFDTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSF  401
            SFDT +G F  +N G+SF+  DLIA+LTLNDKG+              NT VGAE+ H+ 
Sbjct  135  SFDTESGNFKHFNTGVSFTKDDLIAALTLNDKGE--------------NTVVGAEVNHNL  180

Query  400  SSNENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSA  221
             S   ++T+G QH LDP TTVKA+VNN G A+ LIQHEWRPKS  TI GEVD+R IEKSA
Sbjct  181  KSQVISITVGAQHSLDPLTTVKARVNNAGIANPLIQHEWRPKSFITIFGEVDSRGIEKSA  240

Query  220  KIGLAVALKP  191
            K+G  +ALKP
Sbjct  241  KVGFTIALKP  250



>ref|XP_002973372.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
 gb|EFJ25746.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
Length=278

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            + I +F  PDQKSGK+ELQY H+YAG++ S+GL +SP+V  +   G+N + +G + +FDT
Sbjct  93   RAIFNFSLPDQKSGKMELQYCHQYAGVTASVGLASSPVVECTSAFGSNDVVIGGEAAFDT  152

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            A+G FTKYNAG+  +  +  A++ + DKGD L ASY H + P T T VGAE++H  S+  
Sbjct  153  ASGNFTKYNAGVGINKPEFTAAVVVADKGDTLKASYSHVLSPFTRTTVGAEISHKLSTKA  212

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT +IG  + LD  TT+KA++NN G+  A++QHEWRPKS+ +ISGEVDT+A+EKSAK+GL
Sbjct  213  NTFSIGGMYGLDALTTIKARLNNHGRIAAVVQHEWRPKSVISISGEVDTKALEKSAKLGL  272

Query  208  AVALKP  191
            A++LKP
Sbjct  273  ALSLKP  278



>ref|XP_002976531.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
 gb|EFJ22200.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
Length=278

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            + I +F  PDQKSGK+ELQY H+YAG++ S+GL +SP+V  +   G+N + +G + +FDT
Sbjct  93   RAIFNFSLPDQKSGKMELQYCHQYAGVTGSVGLASSPVVECTSAFGSNDVVIGGEAAFDT  152

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            A+G FTKYNAG+  +  +  A++ + DKGD L ASY H + P T T VGAE++H  S+  
Sbjct  153  ASGNFTKYNAGVGINKPEFTAAVVVADKGDTLKASYSHVLSPFTRTTVGAEISHKLSTKA  212

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT +IG  + LD  TT+KA++NN G+  A++QHEWRPKS+ ++SGEVDT+A+EKSAK+GL
Sbjct  213  NTFSIGGMYGLDALTTIKARLNNHGRIAAVVQHEWRPKSVISMSGEVDTKALEKSAKLGL  272

Query  208  AVALKP  191
            A++LKP
Sbjct  273  ALSLKP  278



>ref|XP_010918628.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X2 [Elaeis guineensis]
Length=271

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 133/187 (71%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +KT  SF  PDQKS K+++QYLH++A I++SIGLT +PL+  +   G+  LALG +V FD
Sbjct  85   VKTSFSFKIPDQKSSKLDVQYLHDHAAINSSIGLTPTPLLELAAAVGSKELALGVEVGFD  144

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +A+   TKYNAG+ F+  D  A+L L DKG+ L ASY H V P+T  AV AE+ H F++ 
Sbjct  145  SASASVTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGAAVAAEIVHRFNTY  204

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT TIG+ H LDP TT+K + NN GKA  + QHEWRPKSL T+S E D +AI   +++G
Sbjct  205  ENTFTIGSCHSLDPLTTLKTRFNNSGKAAVVCQHEWRPKSLITLSAEYDPKAISAPSRVG  264

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  265  LALALKP  271



>ref|XP_010918626.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
 ref|XP_010918627.1| PREDICTED: mitochondrial outer membrane protein porin 6 isoform 
X1 [Elaeis guineensis]
Length=276

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 133/187 (71%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +KT  SF  PDQKS K+++QYLH++A I++SIGLT +PL+  +   G+  LALG +V FD
Sbjct  90   VKTSFSFKIPDQKSSKLDVQYLHDHAAINSSIGLTPTPLLELAAAVGSKELALGVEVGFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +A+   TKYNAG+ F+  D  A+L L DKG+ L ASY H V P+T  AV AE+ H F++ 
Sbjct  150  SASASVTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGAAVAAEIVHRFNTY  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            ENT TIG+ H LDP TT+K + NN GKA  + QHEWRPKSL T+S E D +AI   +++G
Sbjct  210  ENTFTIGSCHSLDPLTTLKTRFNNSGKAAVVCQHEWRPKSLITLSAEYDPKAISAPSRVG  269

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  270  LALALKP  276



>ref|XP_008453611.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453612.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453613.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
 ref|XP_008453614.1| PREDICTED: mitochondrial outer membrane protein porin 4 [Cucumis 
melo]
Length=276

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            K  +SF  PD KSGK+++QY H +A I +SIGL  SPL+ FS   G+   +LG DV FDT
Sbjct  91   KATLSFRVPDHKSGKLDVQYFHPHAAIDSSIGLHPSPLLEFSAAIGSKNFSLGGDVGFDT  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
             +  FTKYNAG+S + SD  A+L L DKG  L ASY H++ PL  T V AE+TH FS++E
Sbjct  151  TSASFTKYNAGISLNKSDFSAALMLTDKGQALKASYIHSLDPLNETMVAAEMTHKFSTSE  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            N+ TIG+ H LDP T +K + ++ GKA  L Q EWRPKSL T+S E D++AI+ S KIGL
Sbjct  211  NSFTIGSSHVLDPVTLMKTRFSDKGKAAMLFQREWRPKSLVTLSAEYDSKAIDSSPKIGL  270

Query  208  AVALKP  191
            A+ALKP
Sbjct  271  AIALKP  276



>ref|XP_006644617.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Oryza brachyantha]
Length=323

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = -1

Query  751  LKTIISFVAP-DQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSF  575
            LK IISF  P  Q +GKVELQYL +YAGIS  +GL + PLV+ S V GN T+A+G DV+F
Sbjct  136  LKKIISFPIPYQQTAGKVELQYLDDYAGISLGVGLNSKPLVNLSCVFGNKTVAVGADVAF  195

Query  574  DTATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSS  395
            D++T  FT+YNAGL F+T DL A+L L +KG+ L ASYY  V   + +AVG ELTHSFS 
Sbjct  196  DSSTEDFTEYNAGLKFTTPDLAAALMLINKGESLAASYYQLVNEESGSAVGGELTHSFSR  255

Query  394  NENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKI  215
             +N+  IG  H LDP TTVK + ++ G   ALI+HEWRPK+ FT+S +VDT AI K+ ++
Sbjct  256  KKNSFAIGALHALDPLTTVKIRYSSRGMIGALIKHEWRPKTSFTLSTQVDTNAINKAPEV  315

Query  214  GLAVALKP  191
            GLAVALKP
Sbjct  316  GLAVALKP  323



>ref|XP_004172904.1| PREDICTED: mitochondrial outer membrane protein porin 4-like, 
partial [Cucumis sativus]
Length=248

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            K  +SF  PD KSGK+++QY H +A I +SIGL  SPL+ FS   G+   +LG DV FDT
Sbjct  63   KATLSFRVPDHKSGKLDVQYFHPHAAIDSSIGLHPSPLLEFSAAIGSKNCSLGGDVGFDT  122

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
             +  FTKYNAG+S + SD  A+L L DKG  L ASY H++ PL  T V AE+TH FS++E
Sbjct  123  TSASFTKYNAGISLNKSDFSAALMLTDKGQGLKASYVHSLDPLNETMVAAEMTHKFSTSE  182

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            N+ TIG+ H LDP T +K + ++ GKA  L Q +WRPKSL T+S E D++AI+ S KIGL
Sbjct  183  NSFTIGSSHVLDPVTLMKTRFSDKGKAAMLFQRQWRPKSLVTLSAEYDSKAIDSSPKIGL  242

Query  208  AVALKP  191
            A+ALKP
Sbjct  243  AIALKP  248



>ref|XP_004146313.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Cucumis sativus]
 gb|KGN65451.1| hypothetical protein Csa_1G423090 [Cucumis sativus]
Length=276

 Score =   210 bits (535),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            K  +SF  PD KSGK+++QY H +A I +SIGL  SPL+ FS   G+   +LG DV FDT
Sbjct  91   KATLSFRVPDHKSGKLDVQYFHPHAAIDSSIGLHPSPLLEFSAAIGSKNCSLGGDVGFDT  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
             +  FTKYNAG+S + SD  A+L L DKG  L ASY H++ PL  T V AE+TH FS++E
Sbjct  151  TSASFTKYNAGISLNKSDFSAALMLTDKGQALKASYVHSLDPLNETMVAAEMTHKFSTSE  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            N+ TIG+ H LDP T +K + ++ GKA  L Q +WRPKSL T+S E D++AI+ S KIGL
Sbjct  211  NSFTIGSSHVLDPVTLMKTRFSDKGKAAMLFQRQWRPKSLVTLSAEYDSKAIDSSPKIGL  270

Query  208  AVALKP  191
            A+ALKP
Sbjct  271  AIALKP  276



>ref|XP_002964960.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
 gb|EFJ33798.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
Length=276

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            KT+ +F  PD K GK++ QY+H+  G++TSIGLT+SP+   S   GN+ +A+G ++SFDT
Sbjct  91   KTVFTFTIPDNKCGKIKFQYVHDLFGLATSIGLTSSPVADLSAALGNDVVAVGGELSFDT  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            A+GK ++Y+ G+  +  D  A+L   DKGD L ASY HTV   T T VGAE++HS S  +
Sbjct  151  ASGKLSRYSGGIGLTKPDYSAALITADKGDTLKASYCHTVNANTKTTVGAEVSHSISKKQ  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT TIG  + LDP T VKA++NN G+  AL+QHEWRPKS  T+ GEVDT+A+    KIGL
Sbjct  211  NTFTIGALYVLDPLTAVKARLNNHGQVGALLQHEWRPKSTVTLCGEVDTKALNSRPKIGL  270

Query  208  AVALKP  191
            AVALKP
Sbjct  271  AVALKP  276



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   209 bits (531),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            KTI+SF  PDQ+SGK+ELQYLH+YAGI+TS+GLTA+P+V+FSGV G  TLA G D+SFDT
Sbjct  112  KTILSFKVPDQRSGKLELQYLHDYAGITTSVGLTANPIVNFSGVLGTKTLAAGADLSFDT  171

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
              G  TKYN G SFS  DLIASL LNDKGD L ASYYH V PLT+T+VGAE+THSFSSNE
Sbjct  172  KEGALTKYNFGASFSNVDLIASLALNDKGDTLSASYYHIVNPLTSTSVGAEVTHSFSSNE  231

Query  388  NTLTIGTQHKLDPATTVKA  332
            NT+T+GTQH LDP TTVKA
Sbjct  232  NTITVGTQHALDPLTTVKA  250



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  748  KTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDT  569
            KT++SF  PD+KSGK++ QY HE+ G+S+S+GLT  P V FSG  G++   +G +V FDT
Sbjct  91   KTVLSFKLPDEKSGKLDFQYSHEHVGLSSSVGLTPKPQVDFSGAIGSDVFTVGGEVGFDT  150

Query  568  ATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSNE  389
            ++G FTKYN G+  +  +  A++   DKGD L ASY H + P+T T   AE++  FS+N+
Sbjct  151  SSGLFTKYNGGIGITKPEFSAAILFADKGDTLKASYLHELNPITKTCFAAEISRKFSANQ  210

Query  388  NTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIGL  209
            NT T+G+ + LDP TT+K ++NN GK   ++QHEW+PKSL T+S E DT+A++KS KIGL
Sbjct  211  NTFTVGSSYALDPLTTMKTRLNNHGKLGTVLQHEWKPKSLITLSSEFDTKALDKSPKIGL  270

Query  208  AVALKP  191
            A+A KP
Sbjct  271  ALAFKP  276



>ref|XP_008777257.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X2 [Phoenix dactylifera]
Length=269

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 130/187 (70%), Gaps = 0/187 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +KT  SF  PDQKSGK+++QYLH +A I++ IGLT +P++  +   G+  LALG +V FD
Sbjct  77   VKTSFSFKIPDQKSGKLDVQYLHGHAAINSGIGLTPTPVLELAAAVGSKELALGAEVGFD  136

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +A+  FTKYNAG+ F+  D  A+L L DKG+ L ASY H V P+T TAV AE+ H F+  
Sbjct  137  SASASFTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGTAVAAEIIHRFNKY  196

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+ TIG  H L+P TTVK + NN GKA  L QHEWRPKS  T+S E D + I   +++G
Sbjct  197  ENSFTIGGCHSLNPLTTVKTRFNNSGKASILCQHEWRPKSFITLSAEYDPKNISAPSRVG  256

Query  211  LAVALKP  191
            LA+ALKP
Sbjct  257  LALALKP  263



>ref|XP_008777255.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008777256.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
isoform X1 [Phoenix dactylifera]
Length=282

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 131/189 (69%), Gaps = 0/189 (0%)
 Frame = -1

Query  751  LKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFD  572
            +KT  SF  PDQKSGK+++QYLH +A I++ IGLT +P++  +   G+  LALG +V FD
Sbjct  90   VKTSFSFKIPDQKSGKLDVQYLHGHAAINSGIGLTPTPVLELAAAVGSKELALGAEVGFD  149

Query  571  TATGKFTKYNAGLSFSTSDLIASLTLNDKGDFLGASYYHTVRPLTNTAVGAELTHSFSSN  392
            +A+  FTKYNAG+ F+  D  A+L L DKG+ L ASY H V P+T TAV AE+ H F+  
Sbjct  150  SASASFTKYNAGIGFNKHDFSAALILADKGETLKASYVHVVNPITGTAVAAEIIHRFNKY  209

Query  391  ENTLTIGTQHKLDPATTVKAKVNNFGKAHALIQHEWRPKSLFTISGEVDTRAIEKSAKIG  212
            EN+ TIG  H L+P TTVK + NN GKA  L QHEWRPKS  T+S E D + I   +++G
Sbjct  210  ENSFTIGGCHSLNPLTTVKTRFNNSGKASILCQHEWRPKSFITLSAEYDPKNISAPSRVG  269

Query  211  LAVALKP*L  185
            LA+ALKP L
Sbjct  270  LALALKPRL  278



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840