BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049O02

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q03686.1|BIP8_TOBAC  RecName: Full=Luminal-binding protein 8; ...    286   1e-92   Nicotiana tabacum [American tobacco]
sp|Q03681.1|BIP1_TOBAC  RecName: Full=Luminal-binding protein 1; ...    285   5e-92   Nicotiana tabacum [American tobacco]
sp|Q03682.1|BIP2_TOBAC  RecName: Full=Luminal-binding protein 2; ...    285   6e-92   Nicotiana tabacum [American tobacco]
ref|XP_011084527.1|  PREDICTED: luminal-binding protein 5-like          292   3e-90   Sesamum indicum [beniseed]
ref|XP_010445753.1|  PREDICTED: mediator of RNA polymerase II tra...    278   6e-90   
ref|XP_011075955.1|  PREDICTED: luminal-binding protein 5               290   2e-89   Sesamum indicum [beniseed]
gb|KHG19744.1|  Luminal-binding 5                                       280   1e-88   Gossypium arboreum [tree cotton]
ref|XP_009773333.1|  PREDICTED: luminal-binding protein 5               287   2e-88   Nicotiana sylvestris
ref|XP_010671405.1|  PREDICTED: luminal-binding protein                 287   2e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU25252.1|  hypothetical protein MIMGU_mgv1a002497mg                283   4e-88   Erythranthe guttata [common monkey flower]
gb|KJB18917.1|  hypothetical protein B456_003G074600                    283   5e-88   Gossypium raimondii
ref|XP_009588550.1|  PREDICTED: luminal-binding protein 4               286   5e-88   Nicotiana tomentosiformis
sp|Q03684.1|BIP4_TOBAC  RecName: Full=Luminal-binding protein 4; ...    286   5e-88   Nicotiana tabacum [American tobacco]
ref|XP_009788736.1|  PREDICTED: luminal-binding protein 4               286   6e-88   Nicotiana sylvestris
gb|ACK55195.1|  ER luminal-binding protein                              286   6e-88   Nicotiana benthamiana
ref|XP_009592769.1|  PREDICTED: luminal-binding protein 5               285   9e-88   Nicotiana tomentosiformis
gb|EPS69483.1|  luminal-binding protein 5                               285   9e-88   Genlisea aurea
ref|XP_009593820.1|  PREDICTED: luminal-binding protein                 285   1e-87   Nicotiana tomentosiformis
sp|Q42434.1|BIP_SPIOL  RecName: Full=Luminal-binding protein; Sho...    285   2e-87   Spinacia oleracea
gb|KDO76634.1|  hypothetical protein CISIN_1g0059551mg                  280   2e-87   Citrus sinensis [apfelsine]
ref|XP_009802727.1|  PREDICTED: luminal-binding protein                 285   2e-87   Nicotiana sylvestris
gb|KDP35832.1|  hypothetical protein JCGZ_10646                         284   3e-87   Jatropha curcas
emb|CDP05035.1|  unnamed protein product                                283   4e-87   Coffea canephora [robusta coffee]
ref|XP_006350519.1|  PREDICTED: luminal-binding protein 5-like          283   7e-87   Solanum tuberosum [potatoes]
gb|EYU25251.1|  hypothetical protein MIMGU_mgv1a002497mg                283   1e-86   Erythranthe guttata [common monkey flower]
gb|KJB18907.1|  hypothetical protein B456_003G074600                    282   1e-86   Gossypium raimondii
gb|ACJ11746.1|  luminal binding protein                                 282   1e-86   Gossypium hirsutum [American cotton]
ref|XP_009125214.1|  PREDICTED: mediator of RNA polymerase II tra...    282   2e-86   Brassica rapa
gb|KJB39585.1|  hypothetical protein B456_007G020600                    279   2e-86   Gossypium raimondii
gb|AGS42239.1|  ER luminal-binding protein                              282   2e-86   Capsicum annuum
gb|KDP25255.1|  hypothetical protein JCGZ_20411                         282   2e-86   Jatropha curcas
gb|AJF19166.1|  endoplasmic reticulum chaperone binding protein         281   2e-86   Lycium chinense [Chinese boxthorn]
ref|XP_009102505.1|  PREDICTED: mediator of RNA polymerase II tra...    281   2e-86   
ref|XP_002299448.1|  BiP isoform A family protein                       281   3e-86   Populus trichocarpa [western balsam poplar]
gb|AAB57695.1|  HSP70-related protein                                   269   3e-86   Helianthus annuus
ref|XP_007040596.1|  Heat shock protein 70 (Hsp 70) family protein      281   4e-86   
gb|KJB39580.1|  hypothetical protein B456_007G020300                    281   5e-86   Gossypium raimondii
gb|KDO76633.1|  hypothetical protein CISIN_1g0059551mg                  279   5e-86   Citrus sinensis [apfelsine]
gb|KFK32977.1|  hypothetical protein AALP_AA6G313600                    280   6e-86   Arabis alpina [alpine rockcress]
ref|XP_002303672.1|  BiP isoform A family protein                       280   7e-86   Populus trichocarpa [western balsam poplar]
ref|XP_004234985.1|  PREDICTED: luminal-binding protein 5               280   7e-86   Solanum lycopersicum
ref|XP_006405286.1|  hypothetical protein EUTSA_v10027674mg             280   7e-86   Eutrema salsugineum [saltwater cress]
emb|CDP12195.1|  unnamed protein product                                280   9e-86   Coffea canephora [robusta coffee]
gb|KHG03675.1|  Luminal-binding 5                                       280   1e-85   Gossypium arboreum [tree cotton]
ref|XP_010473721.1|  PREDICTED: mediator of RNA polymerase II tra...    280   1e-85   Camelina sativa [gold-of-pleasure]
ref|XP_011022455.1|  PREDICTED: luminal-binding protein 5-like          280   1e-85   Populus euphratica
ref|XP_009132761.1|  PREDICTED: mediator of RNA polymerase II tra...    280   1e-85   Brassica rapa
ref|XP_010107258.1|  Luminal-binding protein 5                          280   1e-85   Morus notabilis
ref|XP_002317789.2|  BiP isoform A family protein                       280   1e-85   Populus trichocarpa [western balsam poplar]
gb|KDO76629.1|  hypothetical protein CISIN_1g0059551mg                  279   1e-85   Citrus sinensis [apfelsine]
ref|XP_010430591.1|  PREDICTED: mediator of RNA polymerase II tra...    280   1e-85   Camelina sativa [gold-of-pleasure]
emb|CDY13371.1|  BnaC06g13860D                                          280   1e-85   Brassica napus [oilseed rape]
ref|XP_002887878.1|  hypothetical protein ARALYDRAFT_892955             280   1e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_006439283.1|  hypothetical protein CICLE_v10019184mg             279   2e-85   Citrus clementina [clementine]
ref|XP_002868566.1|  hypothetical protein ARALYDRAFT_493781             279   2e-85   
ref|XP_008239207.1|  PREDICTED: luminal-binding protein 5               279   2e-85   Prunus mume [ume]
ref|XP_006476337.1|  PREDICTED: luminal-binding protein 5-like          279   2e-85   Citrus sinensis [apfelsine]
gb|KHG09348.1|  Luminal-binding 5                                       278   4e-85   Gossypium arboreum [tree cotton]
ref|XP_011026831.1|  PREDICTED: luminal-binding protein 5               278   4e-85   Populus euphratica
ref|XP_010446984.1|  PREDICTED: mediator of RNA polymerase II tra...    278   4e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010545034.1|  PREDICTED: luminal-binding protein 4               278   5e-85   Tarenaya hassleriana [spider flower]
ref|XP_006401475.1|  hypothetical protein EUTSA_v10012896mg             278   5e-85   Eutrema salsugineum [saltwater cress]
ref|XP_008796727.1|  PREDICTED: luminal-binding protein 5               278   5e-85   Phoenix dactylifera
ref|XP_010436161.1|  PREDICTED: mediator of RNA polymerase II tra...    278   5e-85   Camelina sativa [gold-of-pleasure]
ref|XP_008437399.1|  PREDICTED: luminal-binding protein 5               278   5e-85   Cucumis melo [Oriental melon]
gb|KJB39584.1|  hypothetical protein B456_007G020600                    278   5e-85   Gossypium raimondii
gb|AAZ95244.1|  putative luminal-binding protein                        278   6e-85   Isatis tinctoria [woad]
emb|CAC14168.1|  putative luminal binding protein                       278   8e-85   Corylus avellana [European hazelnut]
ref|XP_002518865.1|  heat shock protein, putative                       278   8e-85   Ricinus communis
ref|XP_009358650.1|  PREDICTED: luminal-binding protein 5-like          278   8e-85   Pyrus x bretschneideri [bai li]
ref|XP_010918502.1|  PREDICTED: luminal-binding protein 4-like          278   8e-85   Elaeis guineensis
ref|XP_002263323.1|  PREDICTED: luminal-binding protein 5               277   9e-85   Vitis vinifera
ref|XP_010055986.1|  PREDICTED: luminal-binding protein                 277   1e-84   Eucalyptus grandis [rose gum]
ref|NP_001234636.1|  luminal-binding protein precursor                  277   1e-84   
ref|XP_008390320.1|  PREDICTED: luminal-binding protein 5               277   1e-84   Malus domestica [apple tree]
dbj|BAA13947.1|  luminal binding protein                                277   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211088.1|  hypothetical protein PRUPE_ppa002489mg             277   1e-84   Prunus persica
ref|XP_006343810.1|  PREDICTED: luminal-binding protein-like            277   1e-84   Solanum tuberosum [potatoes]
ref|NP_198206.1|  Luminal-binding protein 1                             277   1e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143862.1|  PREDICTED: luminal-binding protein 5-like          277   1e-84   
gb|EYU19660.1|  hypothetical protein MIMGU_mgv1a002500mg                277   1e-84   Erythranthe guttata [common monkey flower]
emb|CAB72128.1|  heat shock protein 70                                  277   2e-84   Cucumis sativus [cucumbers]
ref|XP_010266594.1|  PREDICTED: luminal-binding protein 5               277   2e-84   Nelumbo nucifera [Indian lotus]
gb|AAW55475.1|  ER-binding protein                                      277   2e-84   Malus pumila [paradise apple]
ref|XP_002276268.2|  PREDICTED: luminal-binding protein 5-like is...    276   2e-84   Vitis vinifera
dbj|BAA13948.1|  luminal binding protein                                276   2e-84   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851119.1|  Luminal-binding protein 2                             276   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04866.1|  Luminal-binding 5                                       278   2e-84   Gossypium arboreum [tree cotton]
ref|XP_009770477.1|  PREDICTED: luminal-binding protein 4-like          276   2e-84   Nicotiana sylvestris
ref|XP_008337565.1|  PREDICTED: luminal-binding protein 5-like          276   2e-84   
gb|KCW72555.1|  hypothetical protein EUGRSUZ_E01024                     277   3e-84   Eucalyptus grandis [rose gum]
ref|XP_009619852.1|  PREDICTED: luminal-binding protein 4-like          276   4e-84   Nicotiana tomentosiformis
ref|XP_010662895.1|  PREDICTED: luminal-binding protein 5-like is...    276   4e-84   Vitis vinifera
ref|XP_004300491.1|  PREDICTED: luminal-binding protein                 276   4e-84   Fragaria vesca subsp. vesca
ref|XP_010934830.1|  PREDICTED: luminal-binding protein 4               275   4e-84   Elaeis guineensis
ref|XP_004503582.1|  PREDICTED: luminal-binding protein-like            275   7e-84   Cicer arietinum [garbanzo]
gb|KHM99873.1|  Luminal-binding protein 5                               275   9e-84   Glycine soja [wild soybean]
ref|XP_004503579.1|  PREDICTED: luminal-binding protein-like            275   1e-83   Cicer arietinum [garbanzo]
gb|AAA92743.1|  polypeptide chain-binding protein                       270   1e-83   Zea mays [maize]
ref|XP_003530453.1|  PREDICTED: luminal-binding protein 5               275   1e-83   Glycine max [soybeans]
dbj|BAA12348.1|  luminal binding protein (BiP)                          274   2e-83   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16716.1|  Luminal-binding protein 5                               275   3e-83   Glycine soja [wild soybean]
gb|KFK32162.1|  hypothetical protein AALP_AA6G205800                    273   6e-83   Arabis alpina [alpine rockcress]
gb|KJB24174.1|  hypothetical protein B456_004G131400                    272   8e-83   Gossypium raimondii
gb|KHG07305.1|  Luminal-binding 5                                       272   9e-83   Gossypium arboreum [tree cotton]
ref|XP_009418642.1|  PREDICTED: luminal-binding protein 2-like          271   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392825.1|  PREDICTED: luminal-binding protein 2               271   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105893.1|  luminal-binding protein 2 precursor                270   7e-82   
gb|ABK24469.1|  unknown                                                 262   1e-81   Picea sitchensis
gb|AAB86942.1|  endoplasmic reticulum HSC70-cognate binding prote...    269   2e-81   Glycine max [soybeans]
gb|AGT16206.1|  luminal-binding protein                                 268   2e-81   Saccharum hybrid cultivar R570
gb|AGT15890.1|  luminal-binding protein                                 268   2e-81   Saccharum hybrid cultivar R570
gb|AGT16055.1|  luminal-binding protein 2 precursor                     268   2e-81   Saccharum hybrid cultivar R570
ref|XP_004952156.1|  PREDICTED: luminal-binding protein 3-like          267   8e-81   Setaria italica
ref|XP_003573226.1|  PREDICTED: luminal-binding protein 3               267   8e-81   Brachypodium distachyon [annual false brome]
gb|AGN94841.1|  ER molecular chaperone                                  266   1e-80   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001234941.1|  BiP isoform A                                      266   1e-80   
gb|EMT16454.1|  Luminal-binding protein 4                               266   1e-80   
ref|XP_009396163.1|  PREDICTED: luminal-binding protein 2-like          265   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF86491.1|  unknown                                                 264   8e-80   Zea mays [maize]
ref|NP_001105894.1|  luminal-binding protein 3 precursor                264   9e-80   Zea mays [maize]
gb|EMS58484.1|  Luminal-binding protein 3                               264   3e-79   Triticum urartu
dbj|BAJ85675.1|  predicted protein                                      263   3e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006827760.1|  hypothetical protein AMTR_s00009p00264000          258   1e-77   Amborella trichopoda
gb|ACU23078.1|  unknown                                                 245   2e-77   Glycine max [soybeans]
emb|CAC27138.1|  glucose regulated protein homolog 4 precursor          249   3e-76   Picea abies
ref|XP_010105626.1|  Luminal-binding protein 5                          243   1e-75   
ref|XP_008246412.1|  PREDICTED: luminal-binding protein 5               253   1e-75   Prunus mume [ume]
ref|XP_006838409.1|  hypothetical protein AMTR_s00002p00096860          253   3e-75   Amborella trichopoda
ref|XP_007206318.1|  hypothetical protein PRUPE_ppa002572mg             252   3e-75   
ref|XP_007160200.1|  hypothetical protein PHAVU_002G301400g             250   2e-74   Phaseolus vulgaris [French bean]
gb|KHM99871.1|  Luminal-binding protein 4                               250   3e-74   Glycine soja [wild soybean]
gb|KEH21274.1|  heat shock 70 kDa protein                               248   9e-74   Medicago truncatula
ref|XP_008388543.1|  PREDICTED: luminal-binding protein 5-like          248   1e-73   
ref|XP_003525327.2|  PREDICTED: luminal-binding protein                 248   2e-73   
gb|ABR18447.1|  unknown                                                 248   3e-73   Picea sitchensis
ref|XP_010259649.1|  PREDICTED: luminal-binding protein 4-like          247   3e-73   Nelumbo nucifera [Indian lotus]
dbj|BAD95470.1|  BiP                                                    247   4e-73   Glycine max [soybeans]
gb|KHN16714.1|  Luminal-binding protein 5                               247   4e-73   Glycine soja [wild soybean]
ref|XP_004302398.1|  PREDICTED: luminal-binding protein 4               246   5e-73   Fragaria vesca subsp. vesca
emb|CDP15491.1|  unnamed protein product                                246   6e-73   Coffea canephora [robusta coffee]
gb|KEH21282.1|  heat shock cognate 70 kDa-like protein                  246   6e-73   Medicago truncatula
emb|CAA89834.2|  luminal binding protein                                246   1e-72   Pseudotsuga menziesii
ref|NP_001238736.1|  BiP isoform B precursor                            246   1e-72   
ref|XP_010255192.1|  PREDICTED: LOW QUALITY PROTEIN: luminal-bind...    243   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_002969949.1|  hypothetical protein SELMODRAFT_440900             244   4e-72   Selaginella moellendorffii
ref|XP_002981419.1|  hypothetical protein SELMODRAFT_444846             244   4e-72   Selaginella moellendorffii
ref|XP_006648229.1|  PREDICTED: luminal-binding protein 2-like          244   5e-72   Oryza brachyantha
ref|XP_001774724.1|  predicted protein                                  243   6e-72   
ref|XP_010108159.1|  Luminal-binding protein 5                          243   8e-72   
gb|KDP23486.1|  hypothetical protein JCGZ_23319                         243   1e-71   Jatropha curcas
gb|AAR23801.1|  putative luminal binding protein precursor              228   2e-71   Helianthus annuus
emb|CAC37635.1|  luminal binding protein, BiP                           241   6e-71   Scherffelia dubia
emb|CDY63497.1|  BnaC07g48050D                                          239   1e-70   Brassica napus [oilseed rape]
emb|CDX77423.1|  BnaA07g05610D                                          239   2e-70   
emb|CDY23972.1|  BnaC03g17190D                                          239   2e-70   Brassica napus [oilseed rape]
emb|CDY46766.1|  BnaA03g17100D                                          239   2e-70   Brassica napus [oilseed rape]
gb|KJB81015.1|  hypothetical protein B456_013G125300                    239   2e-70   Gossypium raimondii
ref|XP_007030985.1|  Heat shock protein 70 (Hsp 70) family protein      239   2e-70   
ref|NP_001045675.1|  Os02g0115900                                       238   7e-70   
emb|CDX79726.1|  BnaC03g20620D                                          237   9e-70   
ref|XP_007509021.1|  Luminal binding heat shock protein 70              231   1e-69   Bathycoccus prasinos
ref|XP_001780840.1|  predicted protein                                  238   1e-69   
ref|XP_006360204.1|  PREDICTED: LOW QUALITY PROTEIN: luminal-bind...    234   2e-69   
gb|AAB63469.1|  endosperm lumenal binding protein                       236   3e-69   Oryza sativa [red rice]
gb|ACH59039.1|  luminal binding protein                                 222   9e-69   Pseudotsuga menziesii
ref|XP_010475732.1|  PREDICTED: probable mediator of RNA polymera...    233   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010475731.1|  PREDICTED: probable mediator of RNA polymera...    233   5e-68   Camelina sativa [gold-of-pleasure]
sp|Q03683.1|BIP3_TOBAC  RecName: Full=Luminal-binding protein 3; ...    219   6e-68   Nicotiana tabacum [American tobacco]
gb|ACH59061.1|  luminal binding protein                                 219   7e-68   Pseudotsuga menziesii
ref|XP_003074861.1|  Bip Luminal binding protein precursor, proba...    232   1e-67   
emb|CEG00952.1|  Heat shock protein 70 family                           232   2e-67   Ostreococcus tauri
ref|XP_010659633.1|  PREDICTED: mediator of RNA polymerase II tra...    231   2e-67   
gb|ACH59062.1|  luminal binding protein                                 218   3e-67   Pseudotsuga macrocarpa
ref|XP_010674036.1|  PREDICTED: luminal-binding protein 5               231   3e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK43208.1|  hypothetical protein AALP_AA1G094300                    230   5e-67   Arabis alpina [alpine rockcress]
gb|KFK43207.1|  hypothetical protein AALP_AA1G094300                    230   5e-67   Arabis alpina [alpine rockcress]
gb|KDO56235.1|  hypothetical protein CISIN_1g006194mg                   230   5e-67   Citrus sinensis [apfelsine]
ref|XP_006433401.1|  hypothetical protein CICLE_v10000531mg             230   6e-67   Citrus clementina [clementine]
ref|XP_010458175.1|  PREDICTED: probable mediator of RNA polymera...    230   8e-67   
ref|XP_010458176.1|  PREDICTED: probable mediator of RNA polymera...    230   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006417615.1|  hypothetical protein EUTSA_v10009566mg             229   1e-66   Eutrema salsugineum [saltwater cress]
ref|NP_001184944.1|  protein BIP3                                       229   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001290009.1|  mediator of RNA polymerase II transcription ...    229   1e-66   Vitis vinifera
ref|NP_172382.4|  protein BIP3                                          229   1e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CBI23034.3|  unnamed protein product                                228   2e-66   Vitis vinifera
ref|XP_006848066.1|  hypothetical protein AMTR_s00029p00199940          218   8e-66   
ref|XP_006645985.1|  PREDICTED: luminal-binding protein-like            228   1e-65   
ref|XP_006306953.1|  hypothetical protein CARUB_v10008520mg             227   1e-65   Capsella rubella
gb|AFC88846.1|  putative luminal binding protein 7B4                    226   4e-65   Tetragonia tetragonioides
ref|XP_010553728.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    225   5e-65   
emb|CDX67525.1|  BnaA07g15650D                                          223   6e-65   
ref|XP_009376693.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    224   7e-65   
ref|XP_002318993.2|  heat shock protein 70 cognate                      224   9e-65   
gb|AAB70400.1|  Similar to Arabidopsis luminal binding protein (g...    223   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480058.1|  PREDICTED: luminal-binding protein 5-like          223   2e-64   
ref|XP_011092383.1|  PREDICTED: luminal-binding protein 5-like          223   2e-64   Sesamum indicum [beniseed]
ref|XP_002892480.1|  hypothetical protein ARALYDRAFT_311954             223   3e-64   
ref|XP_006286312.1|  hypothetical protein CARUB_v100065120mg            209   3e-64   
ref|XP_006480059.1|  PREDICTED: luminal-binding protein 5-like          219   6e-64   Citrus sinensis [apfelsine]
ref|XP_006344666.1|  PREDICTED: mediator of RNA polymerase II tra...    221   1e-63   Solanum tuberosum [potatoes]
gb|EMT08654.1|  Luminal-binding protein 5                               218   1e-63   
ref|XP_009118328.1|  PREDICTED: probable mediator of RNA polymera...    221   1e-63   Brassica rapa
ref|XP_005784200.1|  hypothetical protein EMIHUDRAFT_442092             221   2e-63   Emiliania huxleyi CCMP1516
ref|XP_004230233.1|  PREDICTED: mediator of RNA polymerase II tra...    221   2e-63   Solanum lycopersicum
gb|EEC79268.1|  hypothetical protein OsI_20053                          215   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_004971892.1|  PREDICTED: luminal-binding protein 3-like          220   3e-63   
emb|CDY22648.1|  BnaC08g42820D                                          219   3e-63   Brassica napus [oilseed rape]
emb|CDY06347.1|  BnaA09g48560D                                          220   3e-63   
ref|XP_006423186.1|  hypothetical protein CICLE_v10030032mg             220   3e-63   
gb|EEC83049.1|  hypothetical protein OsI_28153                          218   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_011023674.1|  PREDICTED: luminal-binding protein 4-like          220   4e-63   Populus euphratica
ref|XP_005651681.1|  binding protein 1                                  219   4e-63   Coccomyxa subellipsoidea C-169
ref|XP_001416181.1|  Luminal binding protein precursor, probable        219   6e-63   Ostreococcus lucimarinus CCE9901
ref|XP_004964075.1|  PREDICTED: luminal-binding protein 3-like          219   6e-63   Setaria italica
dbj|BAJ89190.1|  predicted protein                                      219   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006423179.1|  hypothetical protein CICLE_v10030400mg             219   1e-62   
ref|XP_002949576.1|  luminal binding protein Bip1                       218   1e-62   Volvox carteri f. nagariensis
ref|XP_009622355.1|  PREDICTED: mediator of RNA polymerase II tra...    219   1e-62   Nicotiana tomentosiformis
ref|XP_002456746.1|  hypothetical protein SORBIDRAFT_03g041830          218   2e-62   Sorghum bicolor [broomcorn]
ref|XP_004971898.1|  PREDICTED: luminal-binding protein 3-like          218   3e-62   
ref|NP_001061194.1|  Os08g0197700                                       218   4e-62   
ref|XP_002507118.1|  heat shock binding protein 70, ER luminal          216   7e-62   Micromonas commoda
ref|XP_009766974.1|  PREDICTED: luminal-binding protein 5-like          217   7e-62   Nicotiana sylvestris
ref|XP_001701685.1|  binding protein 1                                  216   1e-61   Chlamydomonas reinhardtii
gb|KCW61819.1|  hypothetical protein EUGRSUZ_H04513                     215   2e-61   Eucalyptus grandis [rose gum]
gb|KCW44694.1|  hypothetical protein EUGRSUZ_L01770                     214   2e-61   Eucalyptus grandis [rose gum]
ref|XP_006423178.1|  hypothetical protein CICLE_v10029824mg             213   2e-61   
gb|EEE63801.1|  hypothetical protein OsJ_18625                          215   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006423175.1|  hypothetical protein CICLE_v10027975mg             215   3e-61   
ref|XP_006479343.1|  PREDICTED: luminal-binding protein 5-like          215   3e-61   Citrus sinensis [apfelsine]
gb|EAY91599.1|  hypothetical protein OsI_13234                          210   3e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_010027237.1|  PREDICTED: luminal-binding protein 5-like          215   3e-61   
ref|NP_001055613.1|  Os05g0428600                                       215   4e-61   
ref|XP_003055985.1|  luminal binding heat shock protein 70              214   4e-61   Micromonas pusilla CCMP1545
gb|EMT02696.1|  Luminal-binding protein                                 214   5e-61   
gb|EJY69686.1|  hypothetical protein OXYTRI_09575                       214   6e-61   Oxytricha trifallax
ref|XP_005829514.1|  heat shock protein 70, ER luminal                  214   7e-61   Guillardia theta CCMP2712
ref|XP_010041040.1|  PREDICTED: luminal-binding protein 5-like          214   1e-60   Eucalyptus grandis [rose gum]
ref|XP_006655245.1|  PREDICTED: luminal-binding protein 4-like          213   1e-60   Oryza brachyantha
gb|AAA80655.1|  BiP                                                     212   4e-60   Phaeodactylum tricornutum
ref|XP_002178567.1|  ER luminal binding protein precursor               212   5e-60   Phaeodactylum tricornutum CCAP 1055/1
gb|AGC96524.1|  70kD heat shock protein                                 200   6e-60   Scylla paramamosain
ref|XP_006644572.1|  PREDICTED: luminal-binding protein 5-like          212   6e-60   Oryza brachyantha
ref|XP_011088129.1|  PREDICTED: luminal-binding protein 5-like          211   6e-60   Sesamum indicum [beniseed]
gb|EWM22457.1|  luminal binding protein                                 211   9e-60   Nannochloropsis gaditana
gb|AAA62325.1|  HSP70                                                   209   1e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001051048.1|  Os03g0710500                                       210   2e-59   
ref|XP_006650483.1|  PREDICTED: luminal-binding protein 4-like          210   2e-59   Oryza brachyantha
gb|EEE59790.1|  hypothetical protein OsJ_12307                          210   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|ABU41013.1|  heat shock protein 71                                   201   5e-59   Lepeophtheirus salmonis
ref|XP_002142079.1|  heat shock protein 70                              209   5e-59   Cryptosporidium muris RN66
ref|XP_008873726.1|  luminal-binding protein 5                          209   6e-59   Aphanomyces invadans
ref|XP_003885152.1|  Heat shock protein 70 (Precursor), related         209   7e-59   Neospora caninum Liverpool
ref|XP_008885842.1|  chaperonin protein BiP                             209   7e-59   
gb|AAC15519.1|  heat shock protein 70                                   208   7e-59   Toxoplasma gondii
ref|XP_002364404.1|  heat shock protein 70, putative                    208   8e-59   Toxoplasma gondii ME49
gb|KDO35486.1|  luminal-binding protein 2                               207   1e-58   Saprolegnia parasitica CBS 223.65
emb|CAA53368.1|  glucose regulated protein/BiP                          204   3e-58   Phytophthora cinnamomi
emb|CAA47951.1|  glucose-regulated protein 78                           201   3e-58   Trypanosoma cruzi
prf||2114356A  75-77kD antigen                                          201   4e-58
gb|EJK63068.1|  hypothetical protein THAOC_16293                        206   5e-58   Thalassiosira oceanica
gb|ABX89903.1|  inducible heat shock protein 70                         206   5e-58   Tigriopus japonicus
gb|KHJ78956.1|  DnaK family protein                                     195   6e-58   Oesophagostomum dentatum [nodule worm]
gb|ADV59560.1|  heat shock protein 70                                   206   7e-58   Paracyclopina nana
gb|ABG66420.1|  HSP70                                                   205   1e-57   Pseudourostyla cristata
ref|XP_001701884.1|  binding protein 2                                  204   3e-57   Chlamydomonas reinhardtii
gb|AAW63770.1|  PPAT5                                                   204   3e-57   Hyaloperonospora parasitica
gb|AAW63769.1|  PPAT5                                                   204   3e-57   Hyaloperonospora parasitica
emb|CDI75449.1|  heat shock protein 70, putative                        201   3e-57   Eimeria praecox
ref|XP_002288567.1|  heat shock protein/chaperone                       204   4e-57   Thalassiosira pseudonana CCMP1335
ref|XP_009529503.1|  hypothetical protein PHYSODRAFT_286376             204   5e-57   Phytophthora sojae
emb|CAA53369.1|  glucose regulated protein /BiP                         203   6e-57   Phytophthora cinnamomi
ref|XP_008901435.1|  luminal-binding protein                            203   6e-57   Phytophthora parasitica INRA-310
ref|XP_002466589.1|  hypothetical protein SORBIDRAFT_01g010460          203   6e-57   Sorghum bicolor [broomcorn]
emb|CDJ30684.1|  heat shock protein 70, putative                        202   6e-57   Eimeria mitis
ref|XP_006219886.1|  PREDICTED: heat shock 70 kDa protein-like          197   6e-57   Vicugna pacos
emb|CEI96781.1|  Putative Hsp70-like protein                            203   7e-57   Rhizopus microsporus
emb|CDW81972.1|  luminal binding protein                                203   7e-57   Stylonychia lemnae
emb|CDJ57867.1|  heat shock protein 70, putative                        203   8e-57   
emb|CCI50234.1|  unnamed protein product                                203   9e-57   
ref|XP_002909118.1|  luminal-binding protein 3 precursor                202   1e-56   
ref|XP_809817.1|  glucose-regulated protein 78                          202   2e-56   
gb|EKG01171.1|  glucose-regulated protein 78, putative                  202   2e-56   
gb|AAT80624.1|  heat shock protein 70                                   202   2e-56   
gb|EAY97768.1|  hypothetical protein OsI_19680                          197   2e-56   
emb|CEG66501.1|  Putative 70 kDa heat shock protein 3                   202   2e-56   
gb|EKF29592.1|  glucose-regulated protein 78, putative                  201   2e-56   
gb|ADC91992.1|  heat shock protein 70                                   194   2e-56   
gb|EYU18532.1|  hypothetical protein MIMGU_mgv1a022234mg                201   3e-56   
gb|AFQ62791.1|  Bip                                                     201   3e-56   
emb|CBJ48460.1|  Molecular chaperones GRP78/BiP/KAR2, HSP70 super...    201   4e-56   
gb|ABG74706.1|  putative heat shock cognate 70 protein                  189   4e-56   
emb|CDI83237.1|  heat shock protein 70, putative                        201   5e-56   
gb|AGE15504.1|  heat shock protein 70                                   201   5e-56   
ref|XP_668366.1|  heat shock protein 70 precursor                       197   5e-56   
gb|AFX84616.1|  heat shock protein 70 cognate                           201   6e-56   
emb|CDJ51855.1|  heat shock protein 70, putative                        201   6e-56   
ref|XP_004986284.1|  PREDICTED: luminal-binding protein 4-like          201   6e-56   
gb|ABN12067.1|  putative heat shock cognate 70 protein                  195   6e-56   
gb|EPY35738.1|  heat shock protein 70                                   191   7e-56   
gb|AAA28298.1|  heat shock protein 70                                   194   7e-56   
sp|P12794.1|GRP78_PLAFA  RecName: Full=78 kDa glucose-regulated p...    192   7e-56   
gb|EMT00551.1|  Luminal-binding protein 4                               190   7e-56   
gb|ABM92447.1|  glucose-regulated protein 78                            200   7e-56   
ref|XP_002949720.1|  luminal binding protein Bip2                       202   8e-56   
ref|XP_003876961.1|  putative glucose-regulated protein 78              200   8e-56   
gb|AAA27857.1|  heat shock protein 70, hsp70A2                          193   9e-56   
gb|AAL29192.1|AF322906_1  glucose-regulated protein 78                  199   9e-56   
ref|XP_003862230.1|  glucose-regulated protein 78, putative             200   1e-55   
gb|ACH61066.1|  heat shock protein 70 kDa                               189   1e-55   
gb|AAA29501.1|  BiP                                                     191   1e-55   
emb|CDJ62290.1|  heat shock protein 70, putative                        200   1e-55   
ref|XP_001470161.1|  putative glucose-regulated protein 78              200   1e-55   
emb|CDJ37887.1|  heat shock protein 70, putative                        200   1e-55   
ref|XP_003911999.2|  PREDICTED: 78 kDa glucose-regulated protein        193   1e-55   
gb|ACH61090.1|  heat shock protein 70 kDa                               189   1e-55   
ref|XP_001783063.1|  predicted protein                                  189   1e-55   
emb|CAA91253.1|  immunoglobulin heavy chain binding protein             200   1e-55   
gb|EYC11428.1|  hypothetical protein Y032_0050g1907                     199   1e-55   
ref|XP_001684402.1|  putative glucose-regulated protein 78              199   2e-55   
emb|CCA24936.1|  luminalbinding protein 3 precursor putative            199   2e-55   
ref|XP_001424324.1|  hypothetical protein                               199   2e-55   
emb|CDJ02411.1|  Heat shock 70 kDa protein                              190   2e-55   
ref|XP_006282977.1|  hypothetical protein CARUB_v100044650mg            186   3e-55   
gb|AAH08907.2|  HSPA8 protein                                           188   3e-55   
ref|XP_001446455.1|  hypothetical protein                               198   3e-55   
emb|CAI39094.1|  ER-type hsp70                                          198   3e-55   
ref|XP_008473538.1|  PREDICTED: heat shock 70 kDa protein cognate...    189   3e-55   
emb|CDS25068.1|  Heat shock 70 kDa protein                              189   4e-55   
gb|KFP48830.1|  78 kDa glucose-regulated protein                        194   4e-55   
emb|CEP13149.1|  hypothetical protein                                   198   4e-55   
emb|CCJ09763.1|  putative heat shock protein-70kDa                      188   5e-55   
dbj|BAE29904.1|  unnamed protein product                                189   5e-55   
dbj|BAJ98899.1|  predicted protein                                      193   5e-55   
gb|AFN08642.1|  glucose-regulated protein 78                            198   5e-55   
gb|AHA36969.1|  heat shock protein 70b                                  198   5e-55   
ref|XP_008476889.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    198   5e-55   
gb|AFZ93094.1|  heat shock protein 70                                   198   5e-55   
gb|ABF85672.1|  70 kD heat shock protein                                197   5e-55   
gb|ACL30943.1|  70 kDa heat shock protein form 3                        198   6e-55   
ref|XP_010357616.1|  PREDICTED: heat shock 70 kDa protein cognate 4     186   6e-55   
gb|EPY33334.1|  glucose-regulated protein 78                            187   6e-55   
ref|XP_002105706.1|  GD15970                                            194   7e-55   
ref|XP_010150685.1|  PREDICTED: heat shock 70 kDa protein               197   7e-55   
gb|AGC96522.1|  heat shock protein 70                                   189   7e-55   
gb|AAL14448.1|AF397035_1  heat shock protein Hsc70t                     189   7e-55   
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    187   8e-55   
gb|ETN71512.1|  putative chaperone protein DnaK                         197   8e-55   
gb|AAQ63611.1|  70kD heat shock-like protein                            191   9e-55   
gb|KFM61591.1|  glucose-regulated protein                               197   9e-55   
ref|XP_011092073.1|  PREDICTED: luminal-binding protein 5-like          197   9e-55   
gb|EEE63461.1|  hypothetical protein OsJ_18274                          197   9e-55   
dbj|GAN05474.1|  78 kDa glucose-regulated protein precursor             197   1e-54   
gb|ENN75771.1|  hypothetical protein YQE_07729                          197   1e-54   
gb|ERL92029.1|  hypothetical protein D910_09351                         197   1e-54   
gb|EPB86036.1|  glucose-regulated protein                               197   1e-54   
gb|AIU47022.1|  heat shock protein                                      194   1e-54   
gb|AEI70667.1|  heat shock protein 70 cognate                           186   1e-54   
ref|NP_001156420.1|  heat shock protein cognate 3 precursor             197   1e-54   
ref|XP_008607422.1|  luminal-binding protein 1                          197   1e-54   
ref|XP_009562682.1|  PREDICTED: heat shock-related 70 kDa protein 2     197   1e-54   
gb|ACB11341.1|  heat shock protein 70                                   197   1e-54   
gb|EIE83965.1|  heat shock 70 kDa protein                               197   1e-54   
ref|XP_006276258.1|  PREDICTED: heat shock 70 kDa protein-like          196   1e-54   
dbj|BAF94142.1|  heat shock protein 70A                                 196   1e-54   
ref|NP_001055339.1|  Os05g0367800                                       197   1e-54   
gb|AAH15699.1|  Unknown (protein for IMAGE:3906958)                     188   1e-54   
ref|XP_009911291.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-54   
gb|AHE77386.1|  heat shock protein 70                                   197   1e-54   
ref|NP_001049719.2|  Os03g0277300                                       192   1e-54   
ref|XP_010787967.1|  PREDICTED: heat shock cognate 70 kDa protein...    192   1e-54   
ref|XP_007061007.1|  PREDICTED: 78 kDa glucose-regulated protein        194   2e-54   
ref|XP_009673875.1|  PREDICTED: heat shock-related 70 kDa protein 2     196   2e-54   
ref|XP_009332629.1|  PREDICTED: 78 kDa glucose-regulated protein        194   2e-54   
ref|XP_011493320.1|  AAEL017349-PA                                      196   2e-54   
gb|AAS45710.1|  heat shock protein 70                                   196   2e-54   
gb|AIR72266.1|  Hsp70B                                                  196   2e-54   
ref|XP_628228.1|  heat shock protein, Hsp70                             196   2e-54   
ref|XP_006075738.1|  PREDICTED: heat shock cognate 71 kDa protein...    187   2e-54   
gb|AGM50430.1|  heat shock protein 70                                   196   2e-54   
gb|KGB31695.1|  hypothetical protein MS3_11411                          191   2e-54   
gb|ADI58833.1|  heat shock 70kDa protein 5                              187   2e-54   
ref|XP_008486283.1|  PREDICTED: heat shock 70 kDa protein cognate...    189   2e-54   
ref|XP_003728714.1|  PREDICTED: LOW QUALITY PROTEIN: 78 kDa gluco...    196   2e-54   
gb|EAW87621.1|  heat shock 70kDa protein 5 (glucose-regulated pro...    192   2e-54   
gb|EAY89457.1|  hypothetical protein OsI_10990                          192   2e-54   
ref|XP_002588195.1|  hypothetical protein BRAFLDRAFT_113824             196   2e-54   
gb|ACS75352.1|  ER protein gp78                                         196   2e-54   
gb|AIR72271.1|  Hsp70B                                                  196   2e-54   
gb|ADM94257.1|  heat shock protein 70                                   196   2e-54   
gb|ABG45886.1|  heat shock cognate 70                                   196   2e-54   
gb|EFX81902.1|  hypothetical protein DAPPUDRAFT_302856                  196   2e-54   
dbj|BAN20624.1|  heat shock protein cognate 3                           196   3e-54   
gb|KFD56098.1|  hypothetical protein M513_02876                         196   3e-54   
ref|XP_002044125.1|  GM13044                                            194   3e-54   
gb|AAA30201.1|  heat shock protein                                      196   3e-54   
gb|ACJ12782.1|  cognate 70 kDa heat shock protein                       189   3e-54   
ref|XP_001845218.1|  78 kDa glucose-regulated protein                   196   3e-54   
ref|XP_010213150.1|  PREDICTED: heat shock-related 70 kDa protein 2     195   3e-54   
ref|XP_009308651.1|  putative glucose-regulated protein 78              196   3e-54   
gb|AAF64243.1|AF252299_1  hsp70 BiP                                     193   3e-54   
dbj|BAD89540.1|  heat shock protein 70                                  196   3e-54   
ref|XP_003474008.1|  PREDICTED: heat shock 70 kDa protein 1-like        196   4e-54   
emb|CCD14872.1|  unnamed protein product                                190   4e-54   
ref|WP_032228209.1|  molecular chaperone DnaK                           185   4e-54   
gb|ESL08562.1|  glucose-regulated protein 78                            195   4e-54   
ref|XP_009973348.1|  PREDICTED: heat shock 70 kDa protein               195   4e-54   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    195   4e-54   
gb|ABJ97377.1|  heat shock protein 70                                   195   5e-54   
gb|ACU57188.1|  HSP 70                                                  186   5e-54   
emb|CDQ70518.1|  unnamed protein product                                186   5e-54   
ref|XP_004333159.1|  high molecular weight heat shock protein           195   5e-54   
ref|XP_009585599.1|  PREDICTED: 78 kDa glucose-regulated protein        193   5e-54   
gb|EDL08617.1|  heat shock 70kD protein 5 (glucose-regulated prot...    193   5e-54   
ref|XP_010165300.1|  PREDICTED: heat shock 70 kDa protein               195   5e-54   
gb|KFZ46941.1|  Heat shock 70 kDa protein                               195   5e-54   
ref|XP_009068137.1|  PREDICTED: 78 kDa glucose-regulated protein        192   5e-54   
ref|XP_003206814.2|  PREDICTED: LOW QUALITY PROTEIN: heat shock-r...    195   5e-54   
gb|KFV89508.1|  78 kDa glucose-regulated protein                        193   5e-54   
gb|ADI54942.1|  heat shock protein 70                                   195   6e-54   
ref|XP_009643150.1|  PREDICTED: heat shock-related 70 kDa protein 2     195   6e-54   
ref|XP_009910427.1|  PREDICTED: heat shock 70 kDa protein               195   6e-54   
ref|XP_010143013.1|  PREDICTED: heat shock 70 kDa protein               194   6e-54   
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    185   6e-54   
ref|XP_011135831.1|  PREDICTED: heat shock 70 kDa protein cognate...    195   6e-54   
gb|ACD47154.2|  heat shock protein 70                                   195   6e-54   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          195   6e-54   
ref|XP_009809039.1|  PREDICTED: heat shock 70 kDa protein isoform X3    194   6e-54   
ref|XP_010163517.1|  PREDICTED: 78 kDa glucose-regulated protein        194   6e-54   
ref|XP_005022715.1|  PREDICTED: heat shock 70 kDa protein-like          195   6e-54   
gb|KFO84158.1|  Heat shock 70 kDa protein                               194   6e-54   
ref|XP_002258451.1|  heat shock protein                                 195   6e-54   
gb|KFZ46593.1|  78 kDa glucose-regulated protein                        194   7e-54   
gb|KFZ48689.1|  Heat shock 70 kDa protein                               194   7e-54   
gb|EDL93171.1|  heat shock 70kDa protein 5 (glucose-regulated pro...    192   7e-54   
ref|XP_003388275.2|  PREDICTED: heat shock cognate 71 kDa protein...    187   7e-54   
gb|KFZ50485.1|  78 kDa glucose-regulated protein                        193   7e-54   
ref|XP_009809037.1|  PREDICTED: heat shock 70 kDa protein isoform X1    194   7e-54   
ref|XP_009976003.1|  PREDICTED: heat shock 70 kDa protein               194   7e-54   
gb|EAY89450.1|  hypothetical protein OsI_10982                          191   7e-54   
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     188   7e-54   
ref|XP_009946714.1|  PREDICTED: heat shock 70 kDa protein               194   7e-54   
ref|XP_008945152.1|  PREDICTED: heat shock-related 70 kDa protein 2     194   7e-54   
ref|XP_009871171.1|  PREDICTED: heat shock 70 kDa protein               194   7e-54   
ref|XP_005241874.1|  PREDICTED: heat shock 70 kDa protein-like          194   7e-54   
ref|XP_005024501.1|  PREDICTED: LOW QUALITY PROTEIN: 78 kDa gluco...    194   7e-54   
ref|XP_010582441.1|  PREDICTED: heat shock-related 70 kDa protein 2     194   7e-54   
pdb|4PO2|A  Chain A, Crystal Structure Of The Stress-inducible Hu...    185   8e-54   
ref|XP_010296761.1|  PREDICTED: heat shock 70 kDa protein               194   8e-54   
ref|XP_009901866.1|  PREDICTED: heat shock-related 70 kDa protein 2     194   8e-54   
ref|XP_009460485.1|  PREDICTED: heat shock-related 70 kDa protein 2     194   8e-54   
ref|XP_009506853.1|  PREDICTED: heat shock 70 kDa protein               194   8e-54   
ref|XP_009941163.1|  PREDICTED: heat shock-related 70 kDa protein 2     194   8e-54   
gb|KFQ85887.1|  78 kDa glucose-regulated protein                        194   8e-54   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          194   8e-54   
ref|XP_009998966.1|  PREDICTED: heat shock-related 70 kDa protein 2     194   8e-54   
gb|AGV07534.1|  heat shock protein 70 form 1                            194   8e-54   
gb|ACB11340.1|  heat shock protein 70                                   194   8e-54   
ref|XP_009708932.1|  PREDICTED: heat shock 70 kDa protein               194   8e-54   
ref|XP_009487413.1|  PREDICTED: heat shock 70 kDa protein               194   9e-54   
gb|KFQ67680.1|  78 kDa glucose-regulated protein                        194   9e-54   
gb|ADM13382.1|  heat shock protein 70                                   194   9e-54   
emb|CDH60531.1|  glucose-regulated protein                              194   9e-54   
gb|EEC71767.1|  hypothetical protein OsI_04375                          190   9e-54   
ref|XP_005437288.1|  PREDICTED: 78 kDa glucose-regulated protein        194   9e-54   
emb|CDP96755.1|  Protein BM-HSP-1, isoform h                            194   1e-53   
gb|KFV82722.1|  78 kDa glucose-regulated protein                        194   1e-53   
gb|KFU90502.1|  78 kDa glucose-regulated protein                        194   1e-53   
ref|XP_005513063.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
gb|EFZ12530.1|  hypothetical protein SINV_15088                         192   1e-53   
gb|AAD31042.1|AF144646_1  heat shock protein 70                         194   1e-53   
ref|XP_009675941.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
ref|XP_009960006.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
ref|XP_009499023.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
ref|XP_003311205.1|  PREDICTED: heat shock 70 kDa protein 1-like        184   1e-53   
gb|KFV14483.1|  78 kDa glucose-regulated protein                        194   1e-53   
ref|XP_009707412.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
gb|EJW86287.1|  heat shock protein 70                                   194   1e-53   
emb|CDJ88360.1|  Lipoma HMGIC fusion partner protein and Heat sho...    196   1e-53   
ref|XP_001614712.1|  78 kDa glucose-regulated protein precursor (...    194   1e-53   
ref|XP_001748113.1|  hypothetical protein                               194   1e-53   
ref|XP_009819573.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    194   1e-53   
gb|KFO82587.1|  78 kDa glucose-regulated protein                        194   1e-53   
ref|XP_009488320.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
gb|ABA02165.1|  heat shock protein 70                                   194   1e-53   
ref|XP_008489796.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
ref|XP_008944470.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
gb|ACR77532.1|  70 kDa heat shock protein form 2                        194   1e-53   
dbj|BAG53534.1|  unnamed protein product                                190   1e-53   
ref|XP_005231480.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
gb|KFQ20529.1|  78 kDa glucose-regulated protein                        194   1e-53   
sp|P27541.1|HSP70_BRUMA  RecName: Full=Heat shock 70 kDa protein        194   1e-53   
ref|XP_005497347.1|  PREDICTED: heat shock cognate 71 kDa protein...    187   1e-53   
ref|XP_011153497.1|  PREDICTED: heat shock 70 kDa protein cognate 4     194   1e-53   
ref|XP_009278914.1|  PREDICTED: 78 kDa glucose-regulated protein        194   1e-53   
gb|AFN65688.1|  heat shock cognate protein 70                           194   1e-53   
ref|XP_002075480.1|  GK18328                                            194   1e-53   
gb|ACC85671.1|  inducible heat shock protein 70                         194   1e-53   



>sp|Q03686.1|BIP8_TOBAC RecName: Full=Luminal-binding protein 8; Short=BiP 8; AltName: 
Full=78 kDa glucose-regulated protein homolog 8; Short=GRP-78-8, 
partial [Nicotiana tabacum]
 emb|CAA42664.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=293

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  90   YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  149

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  150  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  209

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  210  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  269

Query  216  VYQR  205
            VYQ+
Sbjct  270  VYQK  273



>sp|Q03681.1|BIP1_TOBAC RecName: Full=Luminal-binding protein 1; Short=BiP 1; AltName: 
Full=78 kDa glucose-regulated protein homolog 1; Short=GRP-78-1, 
partial [Nicotiana tabacum]
 emb|CAA42662.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=290

 Score =   285 bits (729),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  87   YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  146

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  147  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  206

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEA+CNPIITA
Sbjct  207  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAICNPIITA  266

Query  216  VYQR  205
            VYQR
Sbjct  267  VYQR  270



>sp|Q03682.1|BIP2_TOBAC RecName: Full=Luminal-binding protein 2; Short=BiP 2; AltName: 
Full=78 kDa glucose-regulated protein homolog 2; Short=GRP-78-2, 
partial [Nicotiana tabacum]
 emb|CAA42661.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=292

 Score =   285 bits (729),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  87   YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  146

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  147  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  206

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  207  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  266

Query  216  VYQR  205
            VYQR
Sbjct  267  VYQR  270



>ref|XP_011084527.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=665

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASGRSEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  523  EDKASGRSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE++EKEKIETATKEALEW+DDNQNAEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLEADEKEKIETATKEALEWMDDNQNAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010445753.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
Length=261

 Score =   278 bits (712),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  55   YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  114

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  115  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNALETYVYNMK  174

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  175  NQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  234

Query  216  VYQR  205
            VYQR
Sbjct  235  VYQR  238



>ref|XP_011075955.1| PREDICTED: luminal-binding protein 5 [Sesamum indicum]
Length=665

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASGRSEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  523  EDKASGRSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE++EKEKIETATKEALEW+DDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLEADEKEKIETATKEALEWMDDNQNAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KHG19744.1| Luminal-binding 5 [Gossypium arboreum]
Length=403

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT V+IQVFEGER +TKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  199  YQDQQTIVSIQVFEGERSMTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  258

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  259  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  318

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQNAEK D++EKLKEVEAVCNPIITA
Sbjct  319  NQINDKDKLADKLESDEKEKVETAAKEALEWLDDNQNAEKEDFEEKLKEVEAVCNPIITA  378

Query  216  VYQR  205
            VYQR
Sbjct  379  VYQR  382



>ref|XP_009773333.1| PREDICTED: luminal-binding protein 5 [Nicotiana sylvestris]
 sp|Q03685.1|BIP5_TOBAC RecName: Full=Luminal-binding protein 5; Short=BiP 5; AltName: 
Full=78 kDa glucose-regulated protein homolog 5; Short=GRP-78-5; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42660.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=668

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI VFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTISVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010671405.1| PREDICTED: luminal-binding protein [Beta vulgaris subsp. vulgaris]
Length=665

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTG+APAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGVAPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKASGKSEKITITNDKGRLSQEEIERMVQEAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLES+EK+KIE A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQVNDKDKLADKLESDEKDKIEGAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|EYU25252.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=547

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRG PQIEVTFEVDANGILNVKA
Sbjct  345  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGIPQIEVTFEVDANGILNVKA  404

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  405  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  464

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE++EKEKIETATKEALEWLD+NQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  465  NQINDKDKLADKLETDEKEKIETATKEALEWLDENQSAEKEDYEEKLKEVEAVCNPIITA  524

Query  216  VYQR  205
            VYQR
Sbjct  525  VYQR  528



>gb|KJB18917.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=548

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  345  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  404

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  405  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  464

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  465  NQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  524

Query  216  VYQR  205
            VYQR
Sbjct  525  VYQR  528



>ref|XP_009588550.1| PREDICTED: luminal-binding protein 4 [Nicotiana tomentosiformis]
Length=667

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  524  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  584  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  643

Query  216  VYQR  205
            VYQ+
Sbjct  644  VYQK  647



>sp|Q03684.1|BIP4_TOBAC RecName: Full=Luminal-binding protein 4; Short=BiP 4; AltName: 
Full=78 kDa glucose-regulated protein homolog 4; Short=GRP-78-4; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42659.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=667

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  524  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  584  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  643

Query  216  VYQR  205
            VYQ+
Sbjct  644  VYQK  647



>ref|XP_009788736.1| PREDICTED: luminal-binding protein 4 [Nicotiana sylvestris]
Length=667

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  524  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  584  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  643

Query  216  VYQR  205
            VYQ+
Sbjct  644  VYQK  647



>gb|ACK55195.1| ER luminal-binding protein [Nicotiana benthamiana]
Length=667

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  524  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  584  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  643

Query  216  VYQR  205
            VYQ+
Sbjct  644  VYQK  647



>ref|XP_009592769.1| PREDICTED: luminal-binding protein 5 [Nicotiana tomentosiformis]
Length=668

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI VFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTISVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|EPS69483.1| luminal-binding protein 5, partial [Genlisea aurea]
Length=661

 Score =   285 bits (729),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  461  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  521  EDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMR  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKL+S+EKEKIETATKEALEWLDDNQ AEK DY+EKLKEVEAVCNPIITA
Sbjct  581  NQISDKDKLADKLDSDEKEKIETATKEALEWLDDNQAAEKEDYEEKLKEVEAVCNPIITA  640

Query  216  VYQR  205
            VYQR
Sbjct  641  VYQR  644



>ref|XP_009593820.1| PREDICTED: luminal-binding protein [Nicotiana tomentosiformis]
Length=668

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>sp|Q42434.1|BIP_SPIOL RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Spinacia oleracea]
 gb|AAA21808.1| ER-lumenal protein [Spinacia oleracea]
 gb|AAA21806.1| ER-lumenal protein [Spinacia oleracea]
Length=668

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARNSLETY+YNMK
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNSLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+D DKLADKLES+EKEKIE A KEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQISDADKLADKLESDEKEKIEGAVKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KDO76634.1| hypothetical protein CISIN_1g0059551mg [Citrus sinensis]
Length=487

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  283  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  342

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  343  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  402

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  403  NQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  462

Query  216  VYQR  205
            VYQR
Sbjct  463  VYQR  466



>ref|XP_009802727.1| PREDICTED: luminal-binding protein [Nicotiana sylvestris]
Length=666

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEA+CNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAICNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KDP35832.1| hypothetical protein JCGZ_10646 [Jatropha curcas]
Length=666

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNV+A
Sbjct  463  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLA+KLES+EKEKIETA KEALEWLD+NQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLAEKLESDEKEKIETAVKEALEWLDENQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>emb|CDP05035.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEED+KVKE+IDARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDRKVKEKIDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEAL+WLDDNQNAEK DY+EKLKEVEAVCNPI+TA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALDWLDDNQNAEKEDYEEKLKEVEAVCNPIVTA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_006350519.1| PREDICTED: luminal-binding protein 5-like [Solanum tuberosum]
Length=668

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI VFEGER + KD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTISVFEGERSMVKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKER+DARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERVDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQNAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|EYU25251.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=667

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD RLLGKFDLTGIAPAPRG PQIEVTFEVDANGILNVKA
Sbjct  465  YQDQQTTVTIQVFEGERSLTKDCRLLGKFDLTGIAPAPRGIPQIEVTFEVDANGILNVKA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  525  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE++EKEKIETATKEALEWLD+NQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  585  NQINDKDKLADKLETDEKEKIETATKEALEWLDENQSAEKEDYEEKLKEVEAVCNPIITA  644

Query  216  VYQR  205
            VYQR
Sbjct  645  VYQR  648



>gb|KJB18907.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=666

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|ACJ11746.1| luminal binding protein [Gossypium hirsutum]
Length=666

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_009125214.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=665

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  461  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  521  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE++EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  581  NQVNDKDKLADKLEADEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  640

Query  216  VYQR  205
            VYQR
Sbjct  641  VYQR  644



>gb|KJB39585.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=549

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  345  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  404

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKK+KE+IDARNSLETYVYNMK
Sbjct  405  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKLKEKIDARNSLETYVYNMK  464

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNAEK D++EKLKEVEAVCNPIITA
Sbjct  465  NQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNAEKEDFEEKLKEVEAVCNPIITA  524

Query  216  VYQR  205
            VYQR
Sbjct  525  VYQR  528



>gb|AGS42239.1| ER luminal-binding protein [Capsicum annuum]
Length=668

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI VFEGER + KD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTISVFEGERSMVKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKER+DARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERVDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEAL+WLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALDWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KDP25255.1| hypothetical protein JCGZ_20411 [Jatropha curcas]
Length=665

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ AEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQTAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|AJF19166.1| endoplasmic reticulum chaperone binding protein [Lycium chinense]
Length=664

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD R LGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVTIQVFEGERSLTKDCRQLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG++EKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  520  EDKASGKAEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEW+DDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  580  NQINDKDKLADKLESDEKEKIETATKEALEWMDDNQSAEKEDYEEKLKEVEAVCNPIITA  639

Query  216  VYQR  205
            VYQ+
Sbjct  640  VYQK  643



>ref|XP_009102505.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Brassica rapa]
Length=666

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_002299448.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE84253.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTG+ PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDK VKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKMVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKE LEWLDDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLESDEKEKIETATKETLEWLDDNQNAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|AAB57695.1| HSP70-related protein [Helianthus annuus]
Length=264

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT V+I+V+EGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  60   YQDQQTVVSIKVYEGERSLTKDCRLLGTFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  119

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  120  EDKASGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNALETYVYNMK  179

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIE ATKEAL+ LDDNQ+AEK +YDEKLKEVEAVCNPI+TA
Sbjct  180  NQINDKDKLADKLESDEKEKIEAATKEALDRLDDNQSAEKEEYDEKLKEVEAVCNPIVTA  239

Query  216  VYQR  205
            VYQR
Sbjct  240  VYQR  243



>ref|XP_007040596.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY25097.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=665

 Score =   281 bits (719),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KJB39580.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=667

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQNAEK D++EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQNAEKEDFEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KDO76633.1| hypothetical protein CISIN_1g0059551mg [Citrus sinensis]
Length=599

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  395  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  454

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  455  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  514

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  515  NQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  574

Query  216  VYQR  205
            VYQR
Sbjct  575  VYQR  578



>gb|KFK32977.1| hypothetical protein AALP_AA6G313600 [Arabis alpina]
Length=662

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  459  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  518

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  519  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  578

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK DY+EKLKEVEAVCNPIITA
Sbjct  579  NQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEDYEEKLKEVEAVCNPIITA  638

Query  216  VYQR  205
            VYQR
Sbjct  639  VYQR  642



>ref|XP_002303672.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE78651.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   280 bits (717),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLT I PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTSIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITND+GRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNDRGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATK+ALEWLDDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLESDEKEKIETATKDALEWLDDNQNAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_004234985.1| PREDICTED: luminal-binding protein 5 [Solanum lycopersicum]
Length=668

 Score =   280 bits (717),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI VFEGER + KD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVTISVFEGERSMVKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKER+DARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERVDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNP+ITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPVITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_006405286.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
 dbj|BAJ34315.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46739.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
Length=669

 Score =   280 bits (717),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE++EK+KIE ATKEALEWLD+NQN+EK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEADEKDKIEAATKEALEWLDENQNSEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>emb|CDP12195.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   280 bits (716),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKK+KERIDARN LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKMKERIDARNGLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIE A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIEAAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KHG03675.1| Luminal-binding 5 [Gossypium arboreum]
 gb|KHG17377.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+AEK DY+EKL EVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSAEKEDYEEKLNEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010473721.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  457  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFA+EDKKVKERIDARNSLETYVYNMK
Sbjct  517  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFADEDKKVKERIDARNSLETYVYNMK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE+++KEKIE ATKEALEWLD+NQNAEK DYDEKLKEVEAVCNPIITA
Sbjct  577  NQVNDKDKLADKLEADDKEKIEAATKEALEWLDENQNAEKEDYDEKLKEVEAVCNPIITA  636

Query  216  VYQR  205
            VYQ+
Sbjct  637  VYQK  640



>ref|XP_011022455.1| PREDICTED: luminal-binding protein 5-like [Populus euphratica]
Length=666

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLT I PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTSIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  522  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNGLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQNAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_009132761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=669

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_010107258.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC14452.1| Luminal-binding protein 5 [Morus notabilis]
Length=667

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R+LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRMLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            +QINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  SQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_002317789.2| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE96009.2| BiP isoform A family protein [Populus trichocarpa]
Length=668

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER LTKD R LGKFDL+GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTIQVFEGERSLTKDCRSLGKFDLSGIAPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAE+DKKVKE+IDARNSLETYVYNMK
Sbjct  524  EDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEDDKKVKEKIDARNSLETYVYNMK  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE++EKEKIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIIT+
Sbjct  584  NQVNDKDKLADKLEADEKEKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITS  643

Query  216  VYQR  205
            VYQR
Sbjct  644  VYQR  647



>gb|KDO76629.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=647

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  443  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  502

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  503  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  562

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  563  NQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  622

Query  216  VYQR  205
            VYQR
Sbjct  623  VYQR  626



>ref|XP_010430591.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  457  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFA+EDKKVKERIDARNSLETYVYNMK
Sbjct  517  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFADEDKKVKERIDARNSLETYVYNMK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE+++KEKIE ATKEALEWLD+NQNAEK DYDEKLKEVEAVCNPIITA
Sbjct  577  NQVNDKDKLADKLEADDKEKIEAATKEALEWLDENQNAEKEDYDEKLKEVEAVCNPIITA  636

Query  216  VYQR  205
            VYQ+
Sbjct  637  VYQK  640



>emb|CDY13371.1| BnaC06g13860D [Brassica napus]
Length=673

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  469  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  528

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  529  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  588

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE+EEKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  589  NQVSDKDKLADKLEAEEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  648

Query  216  VYQR  205
            VYQR
Sbjct  649  VYQR  652



>ref|XP_002887878.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64137.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  457  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFA+EDKKVKERIDARNSLETYVYNMK
Sbjct  517  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFADEDKKVKERIDARNSLETYVYNMK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE+++KEKIE ATK+ALEWLD+NQNAEK DYDEKLKEVEAVCNPIITA
Sbjct  577  NQVNDKDKLADKLEADDKEKIEAATKDALEWLDENQNAEKEDYDEKLKEVEAVCNPIITA  636

Query  216  VYQR  205
            VYQ+
Sbjct  637  VYQK  640



>ref|XP_006439283.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
 gb|ESR52523.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
Length=667

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_002868566.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44825.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_008239207.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=667

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_006476337.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=667

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KHG09348.1| Luminal-binding 5 [Gossypium arboreum]
Length=667

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKK+KE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKLKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNAEK D++EKLKEVEAVCNPIITA
Sbjct  583  NQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNAEKEDFEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_011026831.1| PREDICTED: luminal-binding protein 5 [Populus euphratica]
Length=666

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTG+ PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDK VKE+IDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKMVKEKIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_010446984.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010447007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010436160.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X1 [Camelina sativa]
Length=668

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_010545034.1| PREDICTED: luminal-binding protein 4 [Tarenaya hassleriana]
Length=665

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  461  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKER+DARNSLETYVYNMK
Sbjct  521  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERVDARNSLETYVYNMK  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLA+KLE +EKEKIETA KEALEWLDDNQ+AEK DY+EKLKEVE+VCNPIITA
Sbjct  581  NQVNDKDKLAEKLEEDEKEKIETAVKEALEWLDDNQSAEKEDYEEKLKEVESVCNPIITA  640

Query  216  VYQR  205
            VYQR
Sbjct  641  VYQR  644



>ref|XP_006401475.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
 gb|ESQ42928.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
Length=668

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE++EK+KIE ATKEALEWLD+NQN+EK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEADEKDKIEAATKEALEWLDENQNSEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_008796727.1| PREDICTED: luminal-binding protein 5 [Phoenix dactylifera]
Length=664

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKDNR+LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDNRMLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEEDKK+KE+IDARN LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKIKEKIDARNQLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N IN+KDKLADKLESEEK+KI+ A K+ALEWLDDNQNAEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NTINEKDKLADKLESEEKDKIDAALKDALEWLDDNQNAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010436161.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X2 [Camelina sativa]
Length=668

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_008437399.1| PREDICTED: luminal-binding protein 5 [Cucumis melo]
Length=665

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA K+ALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KJB39584.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=667

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKK+KE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKLKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNAEK D++EKLKEVEAVCNPIITA
Sbjct  583  NQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNAEKEDFEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|AAZ95244.1| putative luminal-binding protein [Isatis tinctoria]
Length=668

 Score =   278 bits (711),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE++EKEKIE ATKEALEWLD+NQN+EK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEADEKEKIEAATKEALEWLDENQNSEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>emb|CAC14168.1| putative luminal binding protein [Corylus avellana]
Length=668

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTG+ PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVQEAEEFAEEDKKVKERIDARNTLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLES+EK+KIE+A K+ALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQVNDKDKLADKLESDEKDKIESAVKDALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_002518865.1| heat shock protein, putative [Ricinus communis]
 gb|EEF43398.1| heat shock protein, putative [Ricinus communis]
Length=664

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLT I PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTSIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETY+YNMK
Sbjct  522  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYIYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEKIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQISDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_009358650.1| PREDICTED: luminal-binding protein 5-like [Pyrus x bretschneideri]
Length=667

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL+GI PAPRGTPQIEVTFEVDANGILNV+A
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010918502.1| PREDICTED: luminal-binding protein 4-like [Elaeis guineensis]
Length=664

 Score =   278 bits (710),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKDNR+LGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDNRMLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKK+KE+IDARN LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKIKEKIDARNQLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N IN+KDKLADKLESEEKEKI+ A K+ALEWLDDNQNAEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NTINEKDKLADKLESEEKEKIDAALKDALEWLDDNQNAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_002263323.1| PREDICTED: luminal-binding protein 5 [Vitis vinifera]
Length=667

 Score =   277 bits (709),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRQLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010055986.1| PREDICTED: luminal-binding protein [Eucalyptus grandis]
Length=667

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKEKIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE +EK+KIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NQINDKDKLADKLEEDEKDKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|NP_001234636.1| luminal-binding protein precursor [Solanum lycopersicum]
 sp|P49118.1|BIP_SOLLC RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34139.1| glucose-regulated protein 78 [Solanum lycopersicum]
Length=666

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G++EKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  523  EDKGTGKAEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNALETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_008390320.1| PREDICTED: luminal-binding protein 5 [Malus domestica]
 ref|XP_009344042.1| PREDICTED: luminal-binding protein 5 [Pyrus x bretschneideri]
Length=667

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNV+A
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G++EKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKAEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>dbj|BAA13947.1| luminal binding protein [Arabidopsis thaliana]
Length=669

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_007211088.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
 gb|EMJ12287.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
Length=667

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFA+EDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFADEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_006343810.1| PREDICTED: luminal-binding protein-like [Solanum tuberosum]
Length=667

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G++EKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  523  EDKGTGKAEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNALETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+AEK DYDEKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|NP_198206.1| Luminal-binding protein 1 [Arabidopsis thaliana]
 sp|Q9LKR3.1|MD37A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37a; AltName: Full=Heat shock 70 kDa protein 11; AltName: 
Full=Heat shock protein 70-11; Short=AtHsp70-11; AltName: 
Full=Luminal-binding protein 1; Short=AtBP1; Short=BiP1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF88019.1| Hypothetical protein T26D3.10 [Arabidopsis thaliana]
 gb|AAN17430.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN65099.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93812.1| Luminal-binding protein 1 [Arabidopsis thaliana]
Length=669

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_004143862.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 ref|XP_004169474.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 gb|KGN50013.1| hypothetical protein Csa_5G149330 [Cucumis sativus]
Length=665

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNSLETY YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSLETYTYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA K+ALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|EYU19660.1| hypothetical protein MIMGU_mgv1a002500mg [Erythranthe guttata]
Length=666

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRSLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNM+
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE++EKEKIETATKEALEW+DDNQ AEK D++EKLKEVEA CNPIITA
Sbjct  583  NQINDKDKLADKLEADEKEKIETATKEALEWMDDNQAAEKEDFEEKLKEVEAACNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>emb|CAB72128.1| heat shock protein 70 [Cucumis sativus]
Length=665

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNSLETY YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSLETYTYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA K+ALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010266594.1| PREDICTED: luminal-binding protein 5 [Nelumbo nucifera]
Length=666

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R+LGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRMLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +GRSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARNSLETY+YN+K
Sbjct  523  EDKGTGRSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNSLETYIYNLK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLESEEK+KIETA KEALEWLDDNQ+AEK DYDEKLKEVEAVCNPII A
Sbjct  583  NQISDKDKLADKLESEEKDKIETAVKEALEWLDDNQSAEKEDYDEKLKEVEAVCNPIIAA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|AAW55475.1| ER-binding protein [Malus pumila]
Length=667

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANG+LNV+A
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGVLNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G++EKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKAEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_002276268.2| PREDICTED: luminal-binding protein 5-like isoform X2 [Vitis vinifera]
Length=667

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL+GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRELGKFDLSGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKK+KE+IDARNSLE+YVYNMK
Sbjct  523  EDKASGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKIKEKIDARNSLESYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
             QINDKDKLADKLESEEKEKIETA KEALEWLDDNQNAE  DY EKLKEVEAVCNPIITA
Sbjct  583  TQINDKDKLADKLESEEKEKIETAVKEALEWLDDNQNAETEDYQEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>dbj|BAA13948.1| luminal binding protein [Arabidopsis thaliana]
Length=668

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTG+ PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|NP_851119.1| Luminal-binding protein 2 [Arabidopsis thaliana]
 sp|Q39043.2|MD37F_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37f; AltName: Full=Heat shock 70 kDa protein 12; AltName: 
Full=Heat shock protein 70-12; Short=AtHsp70-12; AltName: 
Full=Luminal-binding protein 2; Short=AtBP2; Short=BiP2; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB08435.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAO00752.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAP37765.1| At5g42020 [Arabidopsis thaliana]
 gb|AED94755.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=668

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTG+ PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|KHG04866.1| Luminal-binding 5 [Gossypium arboreum]
Length=733

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  529  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  588

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKK+KE+IDARNSLETYVYNMK
Sbjct  589  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKLKEKIDARNSLETYVYNMK  648

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNAEK D++EKLKEVEAVCNPIITA
Sbjct  649  NQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNAEKEDFEEKLKEVEAVCNPIITA  708

Query  216  VYQR  205
            VYQR
Sbjct  709  VYQR  712



>ref|XP_009770477.1| PREDICTED: luminal-binding protein 4-like [Nicotiana sylvestris]
Length=666

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI V+EGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTISVYEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  524  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNGLETYVYNMK  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  584  NQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  643

Query  216  VYQR  205
            VYQR
Sbjct  644  VYQR  647



>ref|XP_008337565.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=667

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNV+A
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPII+ 
Sbjct  583  NQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISX  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KCW72555.1| hypothetical protein EUGRSUZ_E01024 [Eucalyptus grandis]
Length=719

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  515  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  574

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKE+IDARNSLETYVYNMK
Sbjct  575  EDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKEKIDARNSLETYVYNMK  634

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE +EK+KIETATKEALEWLDDNQ AEK DYDEKLKEVEAVCNPII+A
Sbjct  635  NQINDKDKLADKLEEDEKDKIETATKEALEWLDDNQTAEKEDYDEKLKEVEAVCNPIISA  694

Query  216  VYQR  205
            VYQR
Sbjct  695  VYQR  698



>ref|XP_009619852.1| PREDICTED: luminal-binding protein 4-like [Nicotiana tomentosiformis]
Length=666

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI V+EGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVTISVYEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK SG+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  524  EDKGSGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNGLETYVYNMK  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPIITA
Sbjct  584  NQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIITA  643

Query  216  VYQR  205
            VYQ+
Sbjct  644  VYQK  647



>ref|XP_010662895.1| PREDICTED: luminal-binding protein 5-like isoform X1 [Vitis vinifera]
Length=697

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL+GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  493  YQDQQTTVSIQVFEGERSLTKDCRELGKFDLSGIAPAPRGTPQIEVTFEVDANGILNVKA  552

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITNDKGRLSQEEI+RMVREAEEFAEEDKK+KE+IDARNSLE+YVYNMK
Sbjct  553  EDKASGKSEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKIKEKIDARNSLESYVYNMK  612

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
             QINDKDKLADKLESEEKEKIETA KEALEWLDDNQNAE  DY EKLKEVEAVCNPIITA
Sbjct  613  TQINDKDKLADKLESEEKEKIETAVKEALEWLDDNQNAETEDYQEKLKEVEAVCNPIITA  672

Query  216  VYQR  205
            VYQR
Sbjct  673  VYQR  676



>ref|XP_004300491.1| PREDICTED: luminal-binding protein [Fragaria vesca subsp. vesca]
Length=667

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVKE+IDARNSLETY YNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKEKIDARNSLETYTYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ AEK DY+EKLKEVEAVCNPIITA
Sbjct  583  NQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQTAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_010934830.1| PREDICTED: luminal-binding protein 4 [Elaeis guineensis]
Length=661

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R+LGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  459  YQDQQTTVSIQVFEGERSLTKDCRMLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  518

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKE+IDARN LETYVYNMK
Sbjct  519  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNQLETYVYNMK  578

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N INDKDKLADKLESEEKEK+E A K+ALEWLDDNQNAEK DYDEKLKEVEAVCNPII+A
Sbjct  579  NTINDKDKLADKLESEEKEKVEEALKDALEWLDDNQNAEKEDYDEKLKEVEAVCNPIISA  638

Query  216  VYQR  205
            VYQR
Sbjct  639  VYQR  642



>ref|XP_004503582.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNGLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK DY+EKLKEVEAVCNPIITA
Sbjct  582  NQVNDKDKLADKLESDEKEKIETAVKEALEWLDDNQSVEKEDYEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|KHM99873.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   275 bits (703),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK DY+EKLKEVEAVCNPII+A
Sbjct  582  NQISDKDKLADKLESDEKEKIETAVKEALEWLDDNQSMEKEDYEEKLKEVEAVCNPIISA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_004503579.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG F+LTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGNFELTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLES+EKEKIETA KEALEWLDDNQN EK D++EKLKEVEAVCNPIITA
Sbjct  582  NQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQNVEKEDFEEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|AAA92743.1| polypeptide chain-binding protein, partial [Zea mays]
Length=486

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  264  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLNGIAPAPRGTPQIEVTFEVDANGILNVKA  323

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  324  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  383

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  384  NTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  443

Query  216  VYQR  205
            VYQR
Sbjct  444  VYQR  447



>ref|XP_003530453.1| PREDICTED: luminal-binding protein 5 [Glycine max]
Length=667

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK DY+EKLKEVEAVCNPII+A
Sbjct  582  NQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSVEKEDYEEKLKEVEAVCNPIISA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>dbj|BAA12348.1| luminal binding protein (BiP) [Arabidopsis thaliana]
Length=668

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD  LLGKFDLTG+ PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCSLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKE+IDARN+LETYVYNMK
Sbjct  522  EDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  582  NQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|KHN16716.1| Luminal-binding protein 5 [Glycine soja]
Length=726

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  521  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  580

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  581  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  640

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK DY+EKLKEVEAVCNPII+A
Sbjct  641  NQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSVEKEDYEEKLKEVEAVCNPIISA  700

Query  216  VYQR  205
            VYQR
Sbjct  701  VYQR  704



>gb|KFK32162.1| hypothetical protein AALP_AA6G205800 [Arabis alpina]
Length=663

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLG FDL+GI P+PRGTPQIEVTFEVDANGILNVKA
Sbjct  457  YQDQQTTVSIQVFEGERSMTKDCRLLGNFDLSGIPPSPRGTPQIEVTFEVDANGILNVKA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITN+KGRLSQEEIE+MVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  517  EDKASGKSEKITITNEKGRLSQEEIEKMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE+++KEKIE ATKEALEWLD+NQNAEK +YDEKLKEVEAVCNPIIT 
Sbjct  577  NQVSDKDKLADKLEADDKEKIEAATKEALEWLDENQNAEKTEYDEKLKEVEAVCNPIITK  636

Query  216  VYQR  205
            VYQ+
Sbjct  637  VYQK  640



>gb|KJB24174.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=666

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK + ++EKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNS+ETYVYN+K
Sbjct  523  EDKGTHKTEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSIETYVYNLK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            +QI+DKDKLADKLES+EKEKIE A KEALEWLDDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  583  SQISDKDKLADKLESDEKEKIEAAVKEALEWLDDNQNAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KHG07305.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   272 bits (696),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK + ++EKITITNDKGRLSQEEI+RMVREAEEFAEEDKKVKERIDARNS+ETYVYN+K
Sbjct  523  EDKGTHKTEKITITNDKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNSIETYVYNLK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            +QI+DKDKLADKLES+EKEKIE A KEALEWLDDNQNAEK DY+EKLKEVEAVCNPIITA
Sbjct  583  SQISDKDKLADKLESDEKEKIEAAVKEALEWLDDNQNAEKEDYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_009418642.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIAPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRL+QEEIERMV+EAEEFAEEDKKVKE+IDARN LETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLTQEEIERMVQEAEEFAEEDKKVKEKIDARNQLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N IN+KDKLADK+E+EEKEKIE A K+ALEWLDDNQ+AEK DY+EKLKEVEAVCNP+I+A
Sbjct  582  NTINEKDKLADKIETEEKEKIEAALKDALEWLDDNQSAEKEDYEEKLKEVEAVCNPVISA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>ref|XP_009392825.1| PREDICTED: luminal-binding protein 2 [Musa acuminata subsp. malaccensis]
Length=668

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT V++QVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNV+A
Sbjct  463  YQDQQTVVSVQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKE+IDARN LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKEKIDARNQLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N INDKDKLADK+ESEEKEKIE A K+ALEWLDDNQNAEK DYDEKLKEVEAVCNPII+A
Sbjct  583  NTINDKDKLADKIESEEKEKIEAALKDALEWLDDNQNAEKEDYDEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQ+
Sbjct  643  VYQK  646



>ref|NP_001105893.1| luminal-binding protein 2 precursor [Zea mays]
 ref|NP_001278725.1| NHP2-like protein 1 precursor [Zea mays]
 sp|P24067.3|BIP2_MAIZE RecName: Full=Luminal-binding protein 2; Short=BiP2; AltName: 
Full=B-70; Short=B70; AltName: Full=Heat shock protein 70 homolog 
2; Flags: Precursor [Zea mays]
 gb|AAC49899.1| lumenal binding protein cBiPe2 [Zea mays]
 gb|ACF86383.1| unknown [Zea mays]
 gb|AEW66883.1| ER luminal binding protein [Zea mays]
 gb|AFW69798.1| binding protein-like protein [Zea mays]
Length=663

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLNGIAPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>gb|ABK24469.1| unknown [Picea sitchensis]
Length=396

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LG+F+L+GI PAPRG PQIEVTFEVDANGILNVKA
Sbjct  194  YQDQQTTVSIQVFEGERSLTKDCRELGRFELSGIPPAPRGVPQIEVTFEVDANGILNVKA  253

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  254  EDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNGLETYVYNMK  313

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N INDKDKLADK+ES++KEKI+ A KEALEWLD+NQ+AEK DY+EKLKEVE+VCNPI+T 
Sbjct  314  NTINDKDKLADKIESDDKEKIDAALKEALEWLDENQSAEKEDYEEKLKEVESVCNPIVTK  373

Query  216  VYQR  205
            VYQ+
Sbjct  374  VYQQ  377



>gb|AAB86942.1| endoplasmic reticulum HSC70-cognate binding protein precursor 
[Glycine max]
Length=668

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGT QIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTAQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVRE ++FAEE+KKVKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLSQEEIERMVREEKDFAEEEKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK DY+EKLKEVEAVCNPII+A
Sbjct  582  NQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSMEKEDYEEKLKEVEAVCNPIISA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|AGT16206.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>gb|AGT15890.1| luminal-binding protein [Saccharum hybrid cultivar R570]
 gb|AGT16047.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEK+K+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLEAEEKKKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>gb|AGT16055.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
 gb|AGT16312.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
Length=664

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>ref|XP_004952156.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=665

 Score =   267 bits (683),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKE+IDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKEKIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I DKDKLADKLESEEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPII+A
Sbjct  580  NTIGDKDKLADKLESEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIISA  639

Query  216  VYQR  205
            VYQ+
Sbjct  640  VYQK  643



>ref|XP_003573226.1| PREDICTED: luminal-binding protein 3 [Brachypodium distachyon]
Length=665

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>gb|AGN94841.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>ref|NP_001234941.1| BiP isoform A [Glycine max]
 gb|AAA81956.1| BiP isoform A [Glycine max]
Length=664

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 176/184 (96%), Gaps = 1/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TV+IQVFEGER LTKD RLLGKF+L+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQSTVSIQVFEGERSLTKDCRLLGKFELSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEK+ETA KEALEWLDDNQ+ EK  Y+EKLKEVEAVCNPII+A
Sbjct  580  NQVSDKDKLADKLESDEKEKVETAVKEALEWLDDNQSVEK-RYEEKLKEVEAVCNPIISA  638

Query  216  VYQR  205
            VYQR
Sbjct  639  VYQR  642



>gb|EMT16454.1| Luminal-binding protein 4 [Aegilops tauschii]
 gb|AGN94840.1| ER molecular chaperone [Triticum aestivum]
 gb|AGN94842.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>ref|XP_009396163.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT V+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTIVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEED+KVKE+IDARN LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDRKVKEKIDARNQLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N +N+KDKLADK+E+EEKEKIE A K+ALEWLDDNQ+AEK DY+EKLKEVEAVC+PII+A
Sbjct  583  NTVNEKDKLADKIENEEKEKIEAALKDALEWLDDNQSAEKEDYEEKLKEVEAVCSPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|ACF86491.1| unknown [Zea mays]
 gb|AFW66784.1| luminal-binding protein 3 Precursor [Zea mays]
Length=663

 Score =   264 bits (675),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL GI  APRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLNGIPSAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>ref|NP_001105894.1| luminal-binding protein 3 precursor [Zea mays]
 sp|O24581.1|BIP3_MAIZE RecName: Full=Luminal-binding protein 3; Short=BiP3; Flags: Precursor 
[Zea mays]
 gb|AAC49900.1| lumenal binding protein cBiPe3 [Zea mays]
Length=663

 Score =   264 bits (675),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL GI  APRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLNGIPSAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>gb|EMS58484.1| Luminal-binding protein 3 [Triticum urartu]
Length=709

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
             YQR
Sbjct  640  GYQR  643



>dbj|BAJ85675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI  APRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ AEK DY+EKLKEVEAVCNPI++A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEDYEEKLKEVEAVCNPIVSA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>ref|XP_006827760.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
 gb|ERM95176.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
Length=665

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKF+L+GI PAPRG PQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRELGKFELSGIPPAPRGVPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRL+Q EI+ M+REAE++AEEDKKVKE+IDARN+LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNDKGRLTQAEIDEMIREAEKYAEEDKKVKEKIDARNALETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I DKDKL +K+E+ EKE+IE A KEALEW+D+NQ+AEK DYDEKLKEVEAVCNP+I++
Sbjct  583  NTIGDKDKLGEKIEASEKEQIEAALKEALEWMDENQSAEKEDYDEKLKEVEAVCNPVISS  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|ACU23078.1| unknown [Glycine max]
Length=226

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKF+L+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  22   YQDQQTTVSIQVFEGERSLTKDCRLLGKFELSGIPPAPRGTPQIEVTFEVDANGILNVKA  81

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFA EDKKVKERIDARNSLETYVYNMK
Sbjct  82   EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAGEDKKVKERIDARNSLETYVYNMK  141

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI DKDKLADKLE +EKEKIETA KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPII+A
Sbjct  142  NQIGDKDKLADKLEFDEKEKIETAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIISA  201

Query  216  VYQR  205
            VYQR
Sbjct  202  VYQR  205



>emb|CAC27138.1| glucose regulated protein homolog 4 precursor [Picea abies]
Length=432

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+A
Sbjct  228  YQDQQTTVSIKVYEGERSLTKDCRELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRA  287

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK + +SEKITITNDKGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  288  EDKGTKKSEKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNNLETYVYNMK  347

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IN+KDKLADK++SE+KEKIE A KEAL+WLD+NQ+AEK D++EKLKEVEAVC+PII  
Sbjct  348  STINEKDKLADKIDSEDKEKIEDALKEALDWLDENQSAEKDDFEEKLKEVEAVCSPIIKK  407

Query  216  VYQR  205
            VY++
Sbjct  408  VYEK  411



>ref|XP_010105626.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC51262.1| Luminal-binding protein 5 [Morus notabilis]
Length=278

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LGKFDL+ I PAPRG PQIEVTFEVDA+GIL+V A
Sbjct  41   YQDQQTTVSIKVYEGERSLTKDCRELGKFDLSRIPPAPRGIPQIEVTFEVDADGILHVTA  100

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITN+KGRLSQEEIE+MV+EAEEFAEEDKK++E+ID+RN LETY+YNMK
Sbjct  101  EDKAAKKSQSITITNEKGRLSQEEIEKMVKEAEEFAEEDKKLREKIDSRNKLETYIYNMK  160

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N +NDKDKL DK++S +KEKIE A KEALEWLDDNQNAEK DYDEKLKEVEA+CNP+I  
Sbjct  161  NMVNDKDKLTDKMKSSDKEKIERALKEALEWLDDNQNAEKEDYDEKLKEVEAICNPVIKQ  220

Query  216  VYQR  205
            VY +
Sbjct  221  VYDK  224



>ref|XP_008246412.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=664

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD RLLGKFDLTGIAPAPRG PQIEVTFEVDANGIL V+A
Sbjct  461  YQDQQTTVSIKVYEGERSLTKDCRLLGKFDLTGIAPAPRGVPQIEVTFEVDANGILQVRA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ RS+ ITITNDKGRLSQEEIERMV+EAEEFAEED KV+E+IDARN LETY+Y+MK
Sbjct  521  EDKAAKRSQSITITNDKGRLSQEEIERMVKEAEEFAEEDNKVREKIDARNKLETYIYSMK  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK++S++KE+IE+  KEALEWLDDNQNA+K D+DEKLKEVEAVCNP+I  
Sbjct  581  STINDKDKLADKIDSDDKERIESTLKEALEWLDDNQNADKDDFDEKLKEVEAVCNPVIKQ  640

Query  216  VYQR  205
            VY+R
Sbjct  641  VYER  644



>ref|XP_006838409.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
 gb|ERN00978.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
Length=671

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+A
Sbjct  469  YQDQQTTVSIKVYEGERSLTKDCRELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRA  528

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK + ++EKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVY+MK
Sbjct  529  EDKGTKKAEKITITNDKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYSMK  588

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK+ES++KEK+ETA KEALEWLDDNQ AEK D++EKLKEVEAVCNPII  
Sbjct  589  STINDKDKLADKIESDDKEKVETALKEALEWLDDNQTAEKEDFEEKLKEVEAVCNPIIKQ  648

Query  216  VYQR  205
            VY++
Sbjct  649  VYEK  652



>ref|XP_007206318.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
 gb|EMJ07517.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
Length=657

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD RLLGKFDLTGIAPAPRG PQIEVTFEVDANGIL V+A
Sbjct  455  YQDQQTTVSIKVYEGERSLTKDCRLLGKFDLTGIAPAPRGVPQIEVTFEVDANGILQVRA  514

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ RS+ ITITNDKGRLSQEEIERMV+EAEEFAEED KV+E+IDARN LETY+Y+MK
Sbjct  515  EDKAAKRSQSITITNDKGRLSQEEIERMVKEAEEFAEEDNKVREKIDARNKLETYIYSMK  574

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK++S++KEKIE+  KEALEWLDDNQNA+K D+DEKLKEVEAVCNP+I  
Sbjct  575  STINDKDKLADKIDSDDKEKIESTLKEALEWLDDNQNADKDDFDEKLKEVEAVCNPVIKQ  634

Query  216  VYQR  205
            VY++
Sbjct  635  VYEK  638



>ref|XP_007160200.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
 gb|ESW32194.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
Length=666

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  581

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEKIE+A KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPII+A
Sbjct  582  NQISDKDKLADKLESDEKEKIESAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIISA  641

Query  216  VYQR  205
            VYQR
Sbjct  642  VYQR  645



>gb|KHM99871.1| Luminal-binding protein 4 [Glycine soja]
Length=668

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  464  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  524  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPII+A
Sbjct  584  NQIGDKDKLADKLESDEKEKIETAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIISA  643

Query  216  VYQR  205
            VYQR
Sbjct  644  VYQR  647



>gb|KEH21274.1| heat shock 70 kDa protein [Medicago truncatula]
Length=668

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNALETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPIITA
Sbjct  583  NQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_008388543.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=662

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI+V+EGER LTKD R LGKFDLTGI PAPRG PQIEVTFEVDANGIL+V+A
Sbjct  461  YQDQQTTVTIKVYEGERSLTKDCRELGKFDLTGIPPAPRGVPQIEVTFEVDANGILHVRA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEIERMV+EAEEFAEED KV+E+IDARN LETY+Y+MK
Sbjct  521  EDKAAKKSQSITITNDKGRLSQEEIERMVKEAEEFAEEDNKVREKIDARNKLETYIYSMK  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +NDKDKLADK++S++KEKIE+  KEALEWLDDNQNAEK D+DEKLKEVEAVCNP+I  
Sbjct  581  STVNDKDKLADKIDSDDKEKIESTLKEALEWLDDNQNAEKDDFDEKLKEVEAVCNPVIKQ  640

Query  216  VYQR  205
            VY++
Sbjct  641  VYEK  644



>ref|XP_003525327.2| PREDICTED: luminal-binding protein [Glycine max]
Length=701

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKF+L+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  497  YQDQQTTVSIQVFEGERSLTKDCRLLGKFELSGIPPAPRGTPQIEVTFEVDANGILNVKA  556

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  557  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  616

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPII+A
Sbjct  617  NQIGDKDKLADKLESDEKEKIETAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIISA  676

Query  216  VYQR  205
            VYQR
Sbjct  677  VYQR  680



>gb|ABR18447.1| unknown [Picea sitchensis]
Length=687

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+A
Sbjct  483  YQDQQTTVSIKVYEGERSLTKDCRELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRA  542

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK + +SEKITITNDKGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  543  EDKGTKKSEKITITNDKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNNLETYVYNMK  602

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IN+KDKLADK++SE+KEKIE A KEAL+WLD+NQ+AEK D++EKLKEVEAVC+PII  
Sbjct  603  STINEKDKLADKIDSEDKEKIEDALKEALDWLDENQSAEKDDFEEKLKEVEAVCSPIIKK  662

Query  216  VYQR  205
            VY++
Sbjct  663  VYEK  666



>ref|XP_010259649.1| PREDICTED: luminal-binding protein 4-like [Nelumbo nucifera]
Length=661

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTV+I+V+EGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGIL+V+A
Sbjct  460  YEDQQTTVSIKVYEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGILHVRA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +SE ITITNDKGRLSQEEIERMV+EAEEFAEED+KVKE+IDARN LETYVYNMK
Sbjct  520  EDKAAKKSESITITNDKGRLSQEEIERMVKEAEEFAEEDRKVKEKIDARNKLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKL+DK++S++KEKIE+  KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPII  
Sbjct  580  STINDKDKLSDKIDSDDKEKIESTLKEALEWLDDNQSAEKDDYEEKLKEVEAVCNPIIKQ  639

Query  216  VYQR  205
            VY++
Sbjct  640  VYEK  643



>dbj|BAD95470.1| BiP [Glycine max]
Length=668

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TV+IQVFEGER LTKD RLLGKF+L+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQSTVSIQVFEGERSLTKDCRLLGKFELSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEK+ETA KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPII+A
Sbjct  583  NQVSDKDKLADKLESDEKEKVETAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>gb|KHN16714.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TV+IQVFEGER LTKD RLLGKF+L+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQSTVSIQVFEGERSLTKDCRLLGKFELSGIPPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  523  EDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLES+EKEK+ETA KEALEWLDDNQ+ EK +Y+EKLKEVEAVCNPII+A
Sbjct  583  NQVSDKDKLADKLESDEKEKVETAVKEALEWLDDNQSVEKEEYEEKLKEVEAVCNPIISA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>ref|XP_004302398.1| PREDICTED: luminal-binding protein 4 [Fragaria vesca subsp. vesca]
Length=662

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT V+I+VFEGER LTKD   LGKFDLTGIAPAPRG PQIEVTFEVDANGIL VKA
Sbjct  459  YQDQQTVVSIKVFEGERSLTKDCHELGKFDLTGIAPAPRGVPQIEVTFEVDANGILQVKA  518

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEEFAEEDKK++E+IDARN LETY+YNM+
Sbjct  519  EDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEFAEEDKKLREKIDARNKLETYIYNMR  578

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + I DKDKLADK++S++KE IE+  KEAL WLDDNQNAEK D+DEKLKEVEAVCNP+I  
Sbjct  579  STIGDKDKLADKIDSDDKENIESTLKEALGWLDDNQNAEKDDFDEKLKEVEAVCNPVIKQ  638

Query  216  VYQR  205
            VY++
Sbjct  639  VYEK  642



>emb|CDP15491.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI+VFEGER LTKD R LG+F+L+GI PAPRG PQIEVTFE+DANGILNV+A
Sbjct  463  YQDQQTTVTIKVFEGERSLTKDCRELGRFELSGIPPAPRGVPQIEVTFELDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +++ ITITNDKGRLSQEEIERMV+EAEEFAEEDKKV ERIDARN LETY+YNMK
Sbjct  523  EDKAAKKAQSITITNDKGRLSQEEIERMVKEAEEFAEEDKKVSERIDARNKLETYIYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK++S++K KIE+A K+ALEWLDDNQNA+K DYDEK+KEVEAVCNP+I  
Sbjct  583  STINDKDKLADKIDSDDKTKIESALKDALEWLDDNQNADKDDYDEKMKEVEAVCNPVIKM  642

Query  216  VY  211
             Y
Sbjct  643  AY  644



>gb|KEH21282.1| heat shock cognate 70 kDa-like protein [Medicago truncatula]
Length=669

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDL+GI PAPRGTPQIEVTFEVDANGILNV+A
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLSGIPPAPRGTPQIEVTFEVDANGILNVRA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN+LETYVYNMK
Sbjct  523  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNALETYVYNMK  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQI+DKDKLADKLES+EKEKIE A KEALEWLDDNQ  EK +++EKLKEVEAVCNPIITA
Sbjct  583  NQISDKDKLADKLESDEKEKIEAAVKEALEWLDDNQTVEKEEFEEKLKEVEAVCNPIITA  642

Query  216  VYQR  205
            VYQR
Sbjct  643  VYQR  646



>emb|CAA89834.2| luminal binding protein [Pseudotsuga menziesii]
Length=675

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+A
Sbjct  473  YQDQQTTVSIKVYEGERSLTKDCRELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRA  532

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK + ++EKITITNDKGRLSQEEIERMV+EAEEFAEEDKKVK++IDARN+LETYVYNMK
Sbjct  533  EDKGTKKTEKITITNDKGRLSQEEIERMVKEAEEFAEEDKKVKDKIDARNNLETYVYNMK  592

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IN+KDKLADK++SE+KEKIETA KEALEWLDDNQ+AEK D++EKLKEVEAVC+PII  
Sbjct  593  STINEKDKLADKIDSEDKEKIETAIKEALEWLDDNQSAEKEDFEEKLKEVEAVCSPIIKQ  652

Query  216  VYQR  205
            VY++
Sbjct  653  VYEK  656



>ref|NP_001238736.1| BiP isoform B precursor [Glycine max]
 gb|AAA81954.1| BiP isoform B [Glycine max]
Length=666

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 171/186 (92%), Gaps = 3/186 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDA-NGILNVK  580
            YQDQQTTV+IQVFEGER LTKD RLLGKFDL+GI PAPRGTPQIEVTFEVDA  GILNVK
Sbjct  459  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDAERGILNVK  518

Query  579  A-EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYN  403
            A   K +G+SE+  I+N+KGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYN
Sbjct  519  ARRAKGTGKSERSPISNEKGRLSQEEIERMVREAEEFAEEDKKVKERIDARNSLETYVYN  578

Query  402  MKNQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            MKNQI+DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ EK DY+EKLKE EAVCNPII
Sbjct  579  MKNQISDKDKLADKLESDEKEKIETAVKEALEWLDDNQSMEKEDYEEKLKE-EAVCNPII  637

Query  222  TAVYQR  205
            +AVYQR
Sbjct  638  SAVYQR  643



>ref|XP_010255192.1| PREDICTED: LOW QUALITY PROTEIN: luminal-binding protein 8-like 
[Nelumbo nucifera]
Length=554

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTV+I+V+EGER LTKD   LG+FDL+GI PAPRG PQ+EVTFEVD NGIL+V+A
Sbjct  353  YEDQQTTVSIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQLEVTFEVDTNGILHVRA  412

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +SE ITITNDKGRLSQEEI RMV+EAEEFAEED+KVKE+IDARN LETYVYNMK
Sbjct  413  EDKAAKKSESITITNDKGRLSQEEIARMVKEAEEFAEEDRKVKEKIDARNKLETYVYNMK  472

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKL+DK++S++KEKIE+  KEALEWLDDNQ+AEK DY+EKLKEVEAVCNPII  
Sbjct  473  STINDKDKLSDKIDSDDKEKIESTLKEALEWLDDNQSAEKDDYEEKLKEVEAVCNPIIKQ  532

Query  216  VYQ  208
            VY+
Sbjct  533  VYE  535



>ref|XP_002969949.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
 gb|EFJ29073.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
Length=660

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+ V+I V+EGER +TKDNR LGKFDL GI PAPRG PQIEVTFE+DANGILNV+A
Sbjct  455  YQDQQSAVSIHVYEGERSMTKDNRELGKFDLAGIPPAPRGVPQIEVTFEIDANGILNVRA  514

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRL+QEEI+RMVREA+E AEEDKK KER+D+RN LETY+YNM+
Sbjct  515  EDKGTGKSEKITITNDKGRLTQEEIDRMVREADEMAEEDKKQKERVDSRNGLETYLYNMR  574

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N INDKDKLADK+E E+KEKIE   KEALEWLDDN  AEK D+D+KLKEVEAVCNPIIT 
Sbjct  575  NTINDKDKLADKIEKEDKEKIEETLKEALEWLDDNNTAEKEDFDDKLKEVEAVCNPIITQ  634

Query  216  VYQR  205
            +YQ+
Sbjct  635  IYQK  638



>ref|XP_002981419.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
 gb|EFJ17607.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
Length=660

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+ V+I V+EGER +TKDNR LGKFDL GI PAPRG PQIEVTFE+DANGILNV+A
Sbjct  455  YQDQQSAVSIHVYEGERSMTKDNRELGKFDLAGIPPAPRGVPQIEVTFEIDANGILNVRA  514

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRL+QEEI+RMVREA+E AEEDKK KER+D+RN LETY+YNM+
Sbjct  515  EDKGTGKSEKITITNDKGRLTQEEIDRMVREADEMAEEDKKQKERVDSRNGLETYLYNMR  574

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N INDKDKLADK+E E+KEKIE   KEALEWLDDN  AEK D+D+KLKEVEAVCNPIIT 
Sbjct  575  NTINDKDKLADKIEKEDKEKIEETLKEALEWLDDNNTAEKEDFDDKLKEVEAVCNPIITQ  634

Query  216  VYQR  205
            +YQ+
Sbjct  635  IYQK  638



>ref|XP_006648229.1| PREDICTED: luminal-binding protein 2-like [Oryza brachyantha]
Length=665

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I DKDKLADKLESEEKEK+E A KEALEWLDDNQ AEK +Y+EKLKEVEAVCNPII+A
Sbjct  580  NTIGDKDKLADKLESEEKEKVEEALKEALEWLDDNQTAEKEEYEEKLKEVEAVCNPIISA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>ref|XP_001774724.1| predicted protein [Physcomitrella patens]
 gb|EDQ60395.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD   LGKFDLTGI  APRG PQIEVTFE+DANGILNVKA
Sbjct  458  YQDQQTTVSIQVFEGERSLTKDCHELGKFDLTGIPAAPRGVPQIEVTFEIDANGILNVKA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKI ITNDKGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  518  EDKGTGKSEKIVITNDKGRLSQEEIDRMVQEAEEFAEEDKKVKERIDARNSLETYVYNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+   DKL +K+ +E+KE IETA KEALEWLD+NQ+AEK D+ EKLKEVE +CNPI+T 
Sbjct  578  NQLG--DKLGEKISAEDKETIETAMKEALEWLDENQSAEKEDFQEKLKEVEGICNPIVTK  635

Query  216  VYQ  208
            +YQ
Sbjct  636  LYQ  638



>ref|XP_010108159.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC17991.1| Luminal-binding protein 5 [Morus notabilis]
Length=657

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDA+GIL+V A
Sbjct  457  YQDQQTTVSIKVYEGERSLTKDCRELGKFDLSGIPPAPRGIPQIEVTFEVDADGILHVTA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITN+KGRLSQEEIE+MV+EAEEFAEEDKK++E+ID+RN LETY+YNMK
Sbjct  517  EDKAAKKSQSITITNEKGRLSQEEIEKMVKEAEEFAEEDKKLREKIDSRNKLETYIYNMK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N +NDKDKL DK++S +KEKIE A KEALEWLDDNQNAEK DYDEKLKEVEA+CNP+I  
Sbjct  577  NMVNDKDKLTDKMKSSDKEKIERALKEALEWLDDNQNAEKEDYDEKLKEVEAICNPVIKQ  636

Query  216  VYQR  205
            VY +
Sbjct  637  VYDK  640



>gb|KDP23486.1| hypothetical protein JCGZ_23319 [Jatropha curcas]
Length=662

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGIL+VKA
Sbjct  459  YQDQQTTVSIKVYEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGILHVKA  518

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEI+RM++EAEE AEEDKKVKE+IDARN LETY+YNM+
Sbjct  519  EDKAAKKSQSITITNDKGRLSQEEIDRMIKEAEEMAEEDKKVKEKIDARNKLETYIYNMR  578

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IND DKLA+K++S++KEKIE A KEALEWLDDNQN EK DYDEKLKEVEAVCNP+I  
Sbjct  579  STINDNDKLAEKIDSDDKEKIENALKEALEWLDDNQNVEKEDYDEKLKEVEAVCNPVIKQ  638

Query  216  VYQR  205
            VY++
Sbjct  639  VYEK  642



>gb|AAR23801.1| putative luminal binding protein precursor [Helianthus annuus]
Length=175

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = -2

Query  675  KFDLTGIAPAPRGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeier  496
            KFDL+GIAPAPRGTPQIEVTFEVDANGILNVKAEDK  G++EKITITN+KGRLSQEEIER
Sbjct  1    KFDLSGIAPAPRGTPQIEVTFEVDANGILNVKAEDKGXGKAEKITITNEKGRLSQEEIER  60

Query  495  mvreaeEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatke  316
            MVREAEEFAEEDKKVKE+IDARN+LETYVYNMKNQI+DKDKLADKLE++EK+KIE ATKE
Sbjct  61   MVREAEEFAEEDKKVKEKIDARNALETYVYNMKNQISDKDKLADKLEADEKDKIEAATKE  120

Query  315  alEWLDDNQNAEK*DYDEKLKEVEAVCNPIITAVYQR  205
            ALEWLDDNQ+AEK +YDEKLKEVEAVCNPIITAVYQR
Sbjct  121  ALEWLDDNQSAEKEEYDEKLKEVEAVCNPIITAVYQR  157



>emb|CAC37635.1| luminal binding protein, BiP, partial [Scherffelia dubia]
Length=665

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +T+D  LLGKFDL GI PAPRG PQIEVTFEVDANGILNV A
Sbjct  464  YQDQQTTVSIQVFEGERTMTRDCHLLGKFDLNGIPPAPRGVPQIEVTFEVDANGILNVAA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+ EKI ITNDKGRLSQEEIERMV+EAEEFA+EDKKVKERIDARNSLETY YNMK
Sbjct  524  EDKGTGKKEKIVITNDKGRLSQEEIERMVQEAEEFADEDKKVKERIDARNSLETYCYNMK  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + D DKLADKL  E+KEK++ A +EAL+W+D+NQ AE  +Y EKLKE+E VCNPI++A
Sbjct  584  NTVEDSDKLADKLAEEDKEKVKEAVQEALDWMDENQTAEADEYKEKLKELEDVCNPIVSA  643

Query  216  VYQ  208
             YQ
Sbjct  644  AYQ  646



>emb|CDY63497.1| BnaC07g48050D [Brassica napus]
Length=642

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 152/184 (83%), Gaps = 27/184 (15%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKAS                           EEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKAS---------------------------EEFAEEDKKVKERIDARNSLETYVYNMK  554

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE++EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  555  NQVSDKDKLADKLEADEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  614

Query  216  VYQR  205
            VYQR
Sbjct  615  VYQR  618



>emb|CDX77423.1| BnaA07g05610D [Brassica napus]
Length=642

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 152/184 (83%), Gaps = 27/184 (15%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKAS                           EEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKAS---------------------------EEFAEEDKKVKERIDARNSLETYVYNMK  554

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ++DKDKLADKLE++EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  555  NQVSDKDKLADKLEADEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  614

Query  216  VYQR  205
            VYQR
Sbjct  615  VYQR  618



>emb|CDY23972.1| BnaC03g17190D [Brassica napus]
 emb|CDX84809.1| BnaA03g14210D [Brassica napus]
Length=642

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 150/184 (82%), Gaps = 27/184 (15%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKAS                           EEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKAS---------------------------EEFAEEDKKVKERIDARNSLETYVYNMK  554

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQINDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  555  NQINDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  614

Query  216  VYQR  205
            VYQR
Sbjct  615  VYQR  618



>emb|CDY46766.1| BnaA03g17100D [Brassica napus]
Length=642

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 151/184 (82%), Gaps = 27/184 (15%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKAS                           EEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKAS---------------------------EEFAEEDKKVKERIDARNSLETYVYNMK  554

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLADKLE++EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  555  NQVNDKDKLADKLEADEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  614

Query  216  VYQR  205
            VYQR
Sbjct  615  VYQR  618



>gb|KJB81015.1| hypothetical protein B456_013G125300 [Gossypium raimondii]
Length=656

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQ+TV+I+V+EGER LTKD R LG+FDLTGI PAPRG PQIEVTFEVDANGIL+V A
Sbjct  458  YEDQQSTVSIKVYEGERSLTKDCRELGRFDLTGIPPAPRGVPQIEVTFEVDANGILHVTA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +++ ITITNDKGRLSQEEIERMV+EAEEFAEEDKKV+E+ID+RN LETY+YNM+
Sbjct  518  EDKAAKKAQSITITNDKGRLSQEEIERMVKEAEEFAEEDKKVREKIDSRNKLETYIYNMR  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + I+DKDKLADK++S+EKEKIE   +EALEWLDDNQN EK D+DEKLKEVEAVCNPII  
Sbjct  578  SSIDDKDKLADKIDSDEKEKIENTLREALEWLDDNQNGEKEDFDEKLKEVEAVCNPIIKQ  637

Query  216  VYQR  205
            VY +
Sbjct  638  VYGK  641



>ref|XP_007030985.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY11487.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=659

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LG+FDLTGI PAPRG PQIEVTFEVDANGIL+V A
Sbjct  458  YQDQQTTVSIKVYEGERSLTKDCRELGRFDLTGIPPAPRGVPQIEVTFEVDANGILHVTA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEIE+MV+EAEEFAEED+KV+E+ID+RN LETY+YNM+
Sbjct  518  EDKAAKKSQSITITNDKGRLSQEEIEKMVKEAEEFAEEDRKVREKIDSRNKLETYIYNMR  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + I+DKDKLADKL S++KE+IE+  KEALEWLDDNQN  K D+DEKLKEVEAVCNPII  
Sbjct  578  STIDDKDKLADKLGSDDKERIESTLKEALEWLDDNQNGGKEDFDEKLKEVEAVCNPIIKQ  637

Query  216  VY  211
            VY
Sbjct  638  VY  639



>ref|NP_001045675.1| Os02g0115900 [Oryza sativa Japonica Group]
 dbj|BAD07938.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAD07713.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAF07589.1| Os02g0115900 [Oryza sativa Japonica Group]
 gb|EAY84196.1| hypothetical protein OsI_05577 [Oryza sativa Indica Group]
 gb|EAZ21491.1| hypothetical protein OsJ_05115 [Oryza sativa Japonica Group]
 gb|ACA50500.1| dnak-type molecular chaperone Bip [Oryza sativa Japonica Group]
Length=665

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI  APRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ AEK +Y+EKLKEVEAVCNPII+A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISA  639

Query  216  VYQR  205
            VYQR
Sbjct  640  VYQR  643



>emb|CDX79726.1| BnaC03g20620D [Brassica napus]
Length=642

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 151/184 (82%), Gaps = 27/184 (15%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLG FDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  462  YQDQQTTVSIQVFEGERSLTKDCRLLGNFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  521

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKAS                           EEFAEEDKKVKERIDARNSLETYVYNMK
Sbjct  522  EDKAS---------------------------EEFAEEDKKVKERIDARNSLETYVYNMK  554

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+NDKDKLA+KLE++EKEKIE ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  555  NQVNDKDKLAEKLEADEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  614

Query  216  VYQR  205
            VYQR
Sbjct  615  VYQR  618



>ref|XP_007509021.1| Luminal binding heat shock protein 70 [Bathycoccus prasinos]
 emb|CCO19478.1| Luminal binding heat shock protein 70 [Bathycoccus prasinos]
Length=393

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q TV IQVFEGER +TKDN LLGKF+LT I PAPRG PQIEVTFE+DANGILNV A
Sbjct  194  YQDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA  253

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEEDKK+KERID+RNSLETY YNMK
Sbjct  254  EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDKKIKERIDSRNSLETYAYNMK  313

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N ++D DKL DKLE  +K  I+ A KE LEWLD+NQ A+  +Y+EKLKE+E +CNPI++ 
Sbjct  314  NTVSDSDKLGDKLEESDKSTIQDAVKEVLEWLDENQEADTEEYEEKLKEIEGICNPIVSQ  373

Query  216  VYQR  205
             YQ+
Sbjct  374  AYQQ  377



>ref|XP_001780840.1| predicted protein [Physcomitrella patens]
 gb|EDQ54319.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I VFEGER LTKD R LG+F+LTG+  APRG PQIEVTFEVDANGILNVKA
Sbjct  458  YQDQQTTVSILVFEGERSLTKDCRELGRFELTGVPGAPRGVPQIEVTFEVDANGILNVKA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKI ITNDKGRLSQE+I+RMV+EAEEFAEEDKK+KERIDARNSLETYVYNMK
Sbjct  518  EDKGTGKSEKIVITNDKGRLSQEDIDRMVKEAEEFAEEDKKMKERIDARNSLETYVYNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ+   DKL +K+  E+KE IETATKEALEWLD+NQ+AEK D+ EKLKEVE +CNPI++ 
Sbjct  578  NQVG--DKLGEKMSVEDKETIETATKEALEWLDENQSAEKEDFAEKLKEVEGICNPIVSK  635

Query  216  VYQ  208
            VYQ
Sbjct  636  VYQ  638



>ref|XP_006360204.1| PREDICTED: LOW QUALITY PROTEIN: luminal-binding protein 4-like 
[Solanum tuberosum]
Length=557

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 162/184 (88%), Gaps = 9/184 (5%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQ+FEGER LTKD R LGKFD T +APAPRGTPQIEVTF VDANGIL VK 
Sbjct  363  YQDQQTTVTIQLFEGERSLTKDCRQLGKFDSTRVAPAPRGTPQIEVTFAVDANGILTVKD  422

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+S+KITITNDKGRLS+EEIE MV+E    AEEDKKVKERID+RNSLETYVYNM+
Sbjct  423  EDKASGKSDKITITNDKGRLSREEIEHMVKE----AEEDKKVKERIDSRNSLETYVYNMR  478

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQIND+DKLADKLES+EKEKIETATKEAL      Q+ EK DYDEKLKEV AVCNPIITA
Sbjct  479  NQINDQDKLADKLESDEKEKIETATKEAL-----XQSVEKEDYDEKLKEVVAVCNPIITA  533

Query  216  VYQR  205
            VYQR
Sbjct  534  VYQR  537



>gb|AAB63469.1| endosperm lumenal binding protein [Oryza sativa]
Length=663

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI  APRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + DKDKLADKLESEEKEK+E A KEALEWLD+NQ AEK +Y+EKLKEVEAVCNPII+A
Sbjct  580  NTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISA  639

Query  216  VYQ  208
            VYQ
Sbjct  640  VYQ  642



>gb|ACH59039.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59040.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59041.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59042.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59043.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59044.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59045.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59046.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59047.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59048.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59049.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59050.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59051.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59052.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59053.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59054.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59055.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59056.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59057.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59058.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59059.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59060.1| luminal binding protein, partial [Pseudotsuga menziesii]
Length=188

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  711  ERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITN  532
            ER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+AEDK + ++EKITITN
Sbjct  1    ERSLTKDCRELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRAEDKGTKKTEKITITN  60

Query  531  DKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDKLADkles  352
            DKGRLSQEEIERMV+EAEEFAEEDKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++S
Sbjct  61   DKGRLSQEEIERMVKEAEEFAEEDKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDS  120

Query  351  eekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITAVYQR  205
            E+KEKIETA KEALEWLDDNQ+AEK D++EKLKEVEAVC+PII  VY++
Sbjct  121  EDKEKIETAIKEALEWLDDNQSAEKEDFEEKLKEVEAVCSPIIKQVYEK  169



>ref|XP_010475732.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=665

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTVTI+V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  465  YEDQQTTVTIRVYEGERSMTKDNRELGKFDLTGIIPAPRGVPQIEVTFEVDANGILQVKA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEED+ V+E+IDARN LETYVYNMK
Sbjct  525  EDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEEDRIVREKIDARNKLETYVYNMK  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEK+E   KE LEWLD+N NAEK DYDEK+KEVE+VCNP+I +
Sbjct  585  STVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNAEKEDYDEKMKEVESVCNPVIKS  644

Query  216  VYQR  205
             Y++
Sbjct  645  AYEK  648



>ref|XP_010475731.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=666

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTVTI+V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  466  YEDQQTTVTIRVYEGERSMTKDNRELGKFDLTGIIPAPRGVPQIEVTFEVDANGILQVKA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEED+ V+E+IDARN LETYVYNMK
Sbjct  526  EDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEEDRIVREKIDARNKLETYVYNMK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEK+E   KE LEWLD+N NAEK DYDEK+KEVE+VCNP+I +
Sbjct  586  STVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNAEKEDYDEKMKEVESVCNPVIKS  645

Query  216  VYQR  205
             Y++
Sbjct  646  AYEK  649



>sp|Q03683.1|BIP3_TOBAC RecName: Full=Luminal-binding protein 3; Short=BiP 3; AltName: 
Full=78 kDa glucose-regulated protein homolog 3; Short=GRP-78-3, 
partial [Nicotiana tabacum]
 emb|CAA42663.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=168

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 140/149 (94%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = -2

Query  651  PAPRGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEF  472
            PAPRGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEF
Sbjct  1    PAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEF  60

Query  471  AEEDKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDN  292
            AEEDKKVKERIDARN LETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDN
Sbjct  61   AEEDKKVKERIDARNGLETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDN  120

Query  291  QNAEK*DYDEKLKEVEAVCNPIITAVYQR  205
            Q+AEK DY+EKLKEVEAVCNPIITAVYQR
Sbjct  121  QSAEKEDYEEKLKEVEAVCNPIITAVYQR  149



>gb|ACH59061.1| luminal binding protein, partial [Pseudotsuga menziesii]
Length=188

 Score =   219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  711  ERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITN  532
            ER LTKD R LG FDL+GI PAPRG PQIEVTFEVDANGILNV+AEDK + ++EKITITN
Sbjct  1    ERSLTKDCRELGNFDLSGIPPAPRGVPQIEVTFEVDANGILNVRAEDKGTKKTEKITITN  60

Query  531  DKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDKLADkles  352
            DKGRLSQEEIERMV+EAEEFAEEDKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++S
Sbjct  61   DKGRLSQEEIERMVKEAEEFAEEDKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDS  120

Query  351  eekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITAVYQR  205
            E+KEKIETA KEALEWLDDNQ+AEK D++EKLKEVEAVC+PII  VY++
Sbjct  121  EDKEKIETAIKEALEWLDDNQSAEKEDFEEKLKEVEAVCSPIIKQVYEK  169



>ref|XP_003074861.1| Bip Luminal binding protein precursor, probable (IC) [Ostreococcus 
tauri]
Length=663

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q TV IQVFEGER +TKDN LLGKF+LT I PAPRG PQIEVTFE+DANGILNV A
Sbjct  465  YQDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEED+K KERID+RNSLET+ YNMK
Sbjct  525  EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDRKTKERIDSRNSLETFAYNMK  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N ++D DKLADKLE ++K  IE A KEAL+WLDDNQ+AEK DYDE+LK++E VCNPI+  
Sbjct  585  NTVSDSDKLADKLEEDDKSTIEEAVKEALDWLDDNQSAEKDDYDEQLKKLEEVCNPIVAK  644

Query  216  VYQ  208
             YQ
Sbjct  645  AYQ  647



>emb|CEG00952.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=656

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q TV IQVFEGER +TKDN LLGKF+LT I PAPRG PQIEVTFE+DANGILNV A
Sbjct  458  YQDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEED+K KERID+RNSLET+ YNMK
Sbjct  518  EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDRKTKERIDSRNSLETFAYNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N ++D DKLADKLE ++K  IE A KEAL+WLDDNQ+AEK DYDE+LK++E VCNPI+  
Sbjct  578  NTVSDSDKLADKLEEDDKSTIEEAVKEALDWLDDNQSAEKDDYDEQLKKLEEVCNPIVAK  637

Query  216  VYQ  208
             YQ
Sbjct  638  AYQ  640



>ref|XP_010659633.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Vitis vinifera]
Length=649

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ TV+I+V+EGER LTKD R LG+F+L+GI PAPRG PQIEVTFEVDANGIL+V+A
Sbjct  459  YQDQQPTVSIKVYEGERSLTKDCRELGRFELSGIPPAPRGVPQIEVTFEVDANGILHVRA  518

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEEFAEED++VKERIDARN LETY+Y+M+
Sbjct  519  EDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEFAEEDRQVKERIDARNKLETYLYSMR  578

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
              IND+DKLADK++SE+KEKIE A KEAL+WLDDNQNA+K +Y+EKL+ VEAVCNP+I  
Sbjct  579  ATINDRDKLADKIDSEDKEKIEAALKEALDWLDDNQNADKDEYNEKLRGVEAVCNPVIKQ  638

Query  216  VYQ  208
            VY+
Sbjct  639  VYE  641



>gb|ACH59062.1| luminal binding protein, partial [Pseudotsuga macrocarpa]
Length=188

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  711  ERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITN  532
            ER LTKD R LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+AE K + ++EKITITN
Sbjct  1    ERSLTKDCRELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRAEGKGTKKTEKITITN  60

Query  531  DKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMKNQINDKDKLADkles  352
            DKGRLSQEEIERMV+EAEEFAEEDKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++S
Sbjct  61   DKGRLSQEEIERMVKEAEEFAEEDKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDS  120

Query  351  eekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITAVYQR  205
            E+KEKIETA KEALEWLDDNQ+AEK D++EKLKEVEAVC+P+I  VY++
Sbjct  121  EDKEKIETAIKEALEWLDDNQSAEKEDFEEKLKEVEAVCSPLIKQVYEK  169



>ref|XP_010674036.1| PREDICTED: luminal-binding protein 5 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TV I+VFEGER LTKD R LG+F L+GI PAPRG PQIEVTFEVDANGIL+V A
Sbjct  463  YQDQQSTVDIKVFEGERTLTKDCRELGRFQLSGIPPAPRGVPQIEVTFEVDANGILHVTA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGRLSQ+EI+RMVREAEEFAEEDKK++E++DARN LETYVY+M+
Sbjct  523  EDKAAKNKQTITITNDKGRLSQDEIDRMVREAEEFAEEDKKMREKVDARNKLETYVYSMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + I+DKDKLADK++S++KEKIE A K+ALEWLDDNQNAEK DY+EK+KEVEAVCNP+I  
Sbjct  583  STIDDKDKLADKIDSDDKEKIEAALKDALEWLDDNQNAEKEDYEEKMKEVEAVCNPVIKQ  642

Query  216  VYQR  205
             Y++
Sbjct  643  AYEK  646



>gb|KFK43208.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=659

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+VTI+V+EGER +TKDNR LG FDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  460  YQDQQTSVTIKVYEGERSMTKDNRELGTFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+KITITNDKGRLSQEEI+ M+REAEEFAEED+ VKE+IDA+N+LETYVYNMK
Sbjct  520  EDKVAKTSQKITITNDKGRLSQEEIDEMIREAEEFAEEDRIVKEKIDAKNNLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEKIE A KEALEWLD+N NAEK D++EKLK+VE+VC P+I +
Sbjct  580  SAVADKEKLAEKISEEDKEKIEEALKEALEWLDENVNAEKDDFEEKLKDVESVCKPVIKS  639

Query  216  VYQR  205
            VY++
Sbjct  640  VYEK  643



>gb|KFK43207.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=660

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+VTI+V+EGER +TKDNR LG FDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  461  YQDQQTSVTIKVYEGERSMTKDNRELGTFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+KITITNDKGRLSQEEI+ M+REAEEFAEED+ VKE+IDA+N+LETYVYNMK
Sbjct  521  EDKVAKTSQKITITNDKGRLSQEEIDEMIREAEEFAEEDRIVKEKIDAKNNLETYVYNMK  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEKIE A KEALEWLD+N NAEK D++EKLK+VE+VC P+I +
Sbjct  581  SAVADKEKLAEKISEEDKEKIEEALKEALEWLDENVNAEKDDFEEKLKDVESVCKPVIKS  640

Query  216  VYQR  205
            VY++
Sbjct  641  VYEK  644



>gb|KDO56235.1| hypothetical protein CISIN_1g006194mg [Citrus sinensis]
Length=657

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 163/184 (89%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGIL+V A
Sbjct  458  YQDQQSTVTIKVYEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGILHVTA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +   + ITI NDKGRLSQEEI+RMV+EAEEFAEEDKKV+ER+D+RN LETY+YNM+
Sbjct  518  EDKGAKNKQSITIINDKGRLSQEEIDRMVKEAEEFAEEDKKVRERVDSRNKLETYIYNMR  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IN  DKLADK++S++KE+IE+  KEALEWLDDNQNAEK D+DEK+KEVEAVCNP+I  
Sbjct  578  STIN--DKLADKIDSDDKERIESTLKEALEWLDDNQNAEKDDFDEKMKEVEAVCNPVIKQ  635

Query  216  VYQR  205
            VY++
Sbjct  636  VYEK  639



>ref|XP_006433401.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
 ref|XP_006472078.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
 gb|ESR46641.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
Length=657

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 163/184 (89%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGIL+V A
Sbjct  458  YQDQQSTVTIKVYEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGILHVTA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +   + ITI NDKGRLSQEEI+RMV+EAEEFAEEDKKV+ER+D+RN LETY+YNM+
Sbjct  518  EDKGAKNKQSITIINDKGRLSQEEIDRMVKEAEEFAEEDKKVRERVDSRNKLETYIYNMR  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IN  DKLADK++S++KE+IE+  KEALEWLDDNQNAEK D+DEK+KEVEAVCNP+I  
Sbjct  578  STIN--DKLADKIDSDDKERIESTLKEALEWLDDNQNAEKDDFDEKMKEVEAVCNPVIKQ  635

Query  216  VYQR  205
            VY++
Sbjct  636  VYEK  639



>ref|XP_010458175.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=665

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTV+I+V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  466  YEDQQTTVSIKVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEED+ V+E+IDARN LETYVYNMK
Sbjct  526  EDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEEDRIVREKIDARNKLETYVYNMK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEK+E   KE LEWLD+N NA+K DYDEK+KEVE+VCNP+I +
Sbjct  586  STVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNAKKEDYDEKMKEVESVCNPVIKS  645

Query  216  VYQR  205
             Y++
Sbjct  646  AYEK  649



>ref|XP_010458176.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=664

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTV+I+V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  465  YEDQQTTVSIKVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEED+ V+E+IDARN LETYVYNMK
Sbjct  525  EDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEEDRIVREKIDARNKLETYVYNMK  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEK+E   KE LEWLD+N NA+K DYDEK+KEVE+VCNP+I +
Sbjct  585  STVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNAKKEDYDEKMKEVESVCNPVIKS  644

Query  216  VYQR  205
             Y++
Sbjct  645  AYEK  648



>ref|XP_006417615.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
 gb|ESQ35968.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
Length=657

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKDNR LGKFDLTGI PAPRG PQ+EVTFEVDANGIL VKA
Sbjct  458  YQDQQTTVSIKVYEGERSLTKDNRELGKFDLTGILPAPRGVPQVEVTFEVDANGILQVKA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEED+ VKE+IDARN LETYVYNMK
Sbjct  518  EDKVAKTSQTITITNDKGRLTEEEIEEMIREAEEFAEEDRIVKEKIDARNKLETYVYNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +NDK+KLA+K+  E+KEK+E   KEALEWL++N NA+K DY++KLKE E+VCNP+I +
Sbjct  578  STLNDKEKLAEKISEEDKEKMEEVLKEALEWLEENVNADKDDYEQKLKETESVCNPVIKS  637

Query  216  VYQR  205
            VY++
Sbjct  638  VYEK  641



>ref|NP_001184944.1| protein BIP3 [Arabidopsis thaliana]
 gb|AEE28393.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=665

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  466  YQDQQTTVTINVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEEDK +KE+IDARN LETYVYNMK
Sbjct  526  EDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEEDKIMKEKIDARNKLETYVYNMK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA K+  E+KEK+E   KEALEWL++N NAEK DYDEKLKEVE VC+P+I +
Sbjct  586  STVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDYDEKLKEVELVCDPVIKS  645

Query  216  VYQR  205
            VY++
Sbjct  646  VYEK  649



>ref|NP_001290009.1| mediator of RNA polymerase II transcription subunit 37a precursor 
[Vitis vinifera]
 gb|AFJ20202.1| putative luminal-binding protein [Vitis vinifera]
Length=660

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ TV+I+V+EGER LTK  R LG+F+L+GI PAPRG PQIEVTFEVDANGIL+V+A
Sbjct  459  YQDQQPTVSIKVYEGERSLTKYCRELGRFELSGIPPAPRGVPQIEVTFEVDANGILHVRA  518

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEEFAEED++VKERIDARN LETY+Y+M+
Sbjct  519  EDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEFAEEDRQVKERIDARNKLETYLYSMR  578

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
              IND+DKLADK++SE+KEKIE A KEAL+WLDDNQNA+K +Y+EKL+ VEAVCNP+I  
Sbjct  579  ATINDRDKLADKIDSEDKEKIEAALKEALDWLDDNQNADKDEYNEKLRGVEAVCNPVIKQ  638

Query  216  VYQR  205
            VY++
Sbjct  639  VYEK  642



>ref|NP_172382.4| protein BIP3 [Arabidopsis thaliana]
 sp|Q8H1B3.1|MD37B_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37b; AltName: Full=BiP chaperone BIP-L; AltName: 
Full=Heat shock 70 kDa protein 13; AltName: Full=Heat shock 
protein 70-13; Short=AtHsp70-13; AltName: Full=Hsp70 protein 
BiP chaperone BIP-L; AltName: Full=Luminal-binding protein 
3; Short=AtBP3; Short=BiP3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAN60163.1| BiP chaperone BIP-L [Arabidopsis thaliana]
 gb|AEE28392.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=675

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  476  YQDQQTTVTINVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  535

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEEDK +KE+IDARN LETYVYNMK
Sbjct  536  EDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEEDKIMKEKIDARNKLETYVYNMK  595

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA K+  E+KEK+E   KEALEWL++N NAEK DYDEKLKEVE VC+P+I +
Sbjct  596  STVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDYDEKLKEVELVCDPVIKS  655

Query  216  VYQR  205
            VY++
Sbjct  656  VYEK  659



>emb|CBI23034.3| unnamed protein product [Vitis vinifera]
Length=648

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 156/184 (85%), Gaps = 19/184 (10%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD R LGKFDL+GIAPAPRGTPQIEVTFEVDANGILNVKA
Sbjct  463  YQDQQTTVSIQVFEGERSLTKDCRELGKFDLSGIAPAPRGTPQIEVTFEVDANGILNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKASG+SEKITITND                    EEDKK+KE+IDARNSLE+YVYNMK
Sbjct  523  EDKASGKSEKITITND-------------------KEEDKKIKEKIDARNSLESYVYNMK  563

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
             QINDKDKLADKLESEEKEKIETA KEALEWLDDNQNAE  DY EKLKEVEAVCNPIITA
Sbjct  564  TQINDKDKLADKLESEEKEKIETAVKEALEWLDDNQNAETEDYQEKLKEVEAVCNPIITA  623

Query  216  VYQR  205
            VYQR
Sbjct  624  VYQR  627



>ref|XP_006848066.1| hypothetical protein AMTR_s00029p00199940 [Amborella trichopoda]
 gb|ERN09647.1| hypothetical protein AMTR_s00029p00199940 [Amborella trichopoda]
Length=281

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQV+EGER LTKD   LGKFDL+GI PAPRG PQIEVTFEVDANGILNV+A
Sbjct  79   YQDQQTTVSIQVYEGERSLTKDCPELGKFDLSGIPPAPRGVPQIEVTFEVDANGILNVRA  138

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            ED+ + R+EKITITND  R S EE++  +REAEEFA+EDKKVKE ID RN LETYVYNMK
Sbjct  139  EDEGTKRAEKITITNDNRRFSDEELKEKIREAEEFAQEDKKVKETIDPRNGLETYVYNMK  198

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK+ES+++E+IET  KEALEWLDDNQNAEK D++EK+KEVE VCNPII  
Sbjct  199  STINDKDKLADKIESDDQERIETGLKEALEWLDDNQNAEKEDFEEKVKEVEEVCNPIIKH  258

Query  216  VYQ  208
            VY+
Sbjct  259  VYE  261



>ref|XP_006645985.1| PREDICTED: luminal-binding protein-like [Oryza brachyantha]
Length=728

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 164/184 (89%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLGKFDLTGIAPAPRGTPQI+VTFEVDANGIL+V+A
Sbjct  530  YKDRQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGTPQIDVTFEVDANGILSVRA  589

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+G+SE+ITI+ D  +LSQEEI+RMV EAEEFAEED++ +ER+DARNSLE YVYN+K
Sbjct  590  ADKATGKSEQITISGDDRKLSQEEIDRMVSEAEEFAEEDRRHRERVDARNSLEEYVYNVK  649

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N +  + K+AD +E+EEKEK+E A +EA EW+D NQ+A K DYDEKL+E+E VCNP+++A
Sbjct  650  NAV--EGKMADAMEAEEKEKVEEAVREAYEWMDSNQDAGKDDYDEKLRELEDVCNPVMSA  707

Query  216  VYQR  205
            VYQR
Sbjct  708  VYQR  711



>ref|XP_006306953.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
 gb|EOA39851.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
Length=665

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI+V+EGER +TKDNR LG FDLTGI PAPRG PQI VTF VDANGIL VKA
Sbjct  466  YQDQQTTVTIKVYEGERSMTKDNRELGNFDLTGILPAPRGVPQIMVTFVVDANGILQVKA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL++EEIE+M+REAEEFAEED+ VKE+IDARN LETYVYNMK
Sbjct  526  EDKVAKTSQSITITNDKGRLTEEEIEKMIREAEEFAEEDRIVKEKIDARNKLETYVYNMK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+KLA+K+  E+KEK+E   KE L+WL++N NAEK DYDEK+KEVE+VCNP+I +
Sbjct  586  STMADKEKLAEKISDEDKEKMEEVLKEVLDWLEENVNAEKEDYDEKMKEVESVCNPVIKS  645

Query  216  VYQR  205
            VY++
Sbjct  646  VYEK  649



>gb|AFC88846.1| putative luminal binding protein 7B4, partial [Tetragonia tetragonioides]
Length=699

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV I+VFEGER LTKD R LG+F L+G+ PAPRG PQIEVTFEVDANGIL+V A
Sbjct  499  YQDQQTTVDIRVFEGERTLTKDCRELGRFQLSGLPPAPRGVPQIEVTFEVDANGILHVTA  558

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGRLSQEEI++MVREAEEFAEEDKKV+E++D+RN LE+Y+YNM+
Sbjct  559  EDKAAKNKQTITITNDKGRLSQEEIDQMVREAEEFAEEDKKVREKVDSRNKLESYIYNMR  618

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + I +KDKLADK++S++KEKI+ A KEALEWLDDNQNA+K D++EK+KEVEAVCNP+I  
Sbjct  619  STIEEKDKLADKIDSDDKEKIKGALKEALEWLDDNQNADKDDFEEKMKEVEAVCNPVIKQ  678

Query  216  VYQR  205
             Y++
Sbjct  679  AYEK  682



>ref|XP_010553728.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37b [Tarenaya hassleriana]
Length=658

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 157/184 (85%), Gaps = 7/184 (4%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+DQQTTVTI+V+EGER LTKDNR LG+FDLTGI PAPRGTPQIEVTFEVDANGIL+V A
Sbjct  460  YEDQQTTVTIKVYEGERTLTKDNRELGRFDLTGIPPAPRGTPQIEVTFEVDANGILHVTA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+KITI+N++G LSQEEI RMVREAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKAAKKSQKITISNERGSLSQEEIYRMVREAEEFAEEDKKVKERIDARNKLETYVYNMK  579

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
              I DK+KL DK+E E+KE+IE   KE LEWLD+NQNA        LKEVE VCNP+I +
Sbjct  580  GTIGDKEKLGDKIEKEDKERIEGVLKETLEWLDENQNA-------XLKEVETVCNPVIKS  632

Query  216  VYQR  205
            VY++
Sbjct  633  VYEK  636



>emb|CDX67525.1| BnaA07g15650D [Brassica napus]
Length=577

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 138/184 (75%), Gaps = 39/184 (21%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER LTKD RLLGKFDLTGI PAPRGTPQIEVTFEVDANGILNVKA
Sbjct  412  YQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKA  471

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKAS                           EEF+EEDKKVKERIDARNSLETYVYNMK
Sbjct  472  EDKAS---------------------------EEFSEEDKKVKERIDARNSLETYVYNMK  504

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            NQ  +K+K+            E ATKEALEWLD+NQN+EK +YDEKLKEVEAVCNPIITA
Sbjct  505  NQAEEKEKI------------EAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITA  552

Query  216  VYQR  205
            VYQR
Sbjct  553  VYQR  556



>ref|XP_009376693.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 37f [Pyrus x bretschneideri]
Length=660

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQV--FEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNV  583
            YQDQ TTV+I+V  +EGER LTKD R LGKFD TGI PAPRG PQIEVTFEVDANGIL+V
Sbjct  457  YQDQXTTVSIEVCVYEGERSLTKDCRELGKFDPTGIPPAPRGVPQIEVTFEVDANGILHV  516

Query  582  KAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYN  403
            + EDKA+ +S+ +TITNDKGRLSQEEIERMV+EAEEFAEED KV+E++DARN LETY+Y+
Sbjct  517  RVEDKAAKKSQSVTITNDKGRLSQEEIERMVKEAEEFAEEDNKVREKVDARNKLETYIYS  576

Query  402  MKNQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            +K+ +N+KDK ADK++S++KEKIE+  KEALEWLDDNQNAEK D+D KLKEVEAVCNP+I
Sbjct  577  LKSTVNEKDKPADKIDSDDKEKIESTLKEALEWLDDNQNAEKDDFDGKLKEVEAVCNPVI  636

Query  222  TAVYQ  208
              VY+
Sbjct  637  KQVYE  641



>ref|XP_002318993.2| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE94916.2| heat shock protein 70 cognate [Populus trichocarpa]
Length=660

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGIL+VKA
Sbjct  461  YQDQQTTVSIKVYEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGILHVKA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEE AEEDKKV+E+IDARN LETY+YNM+
Sbjct  521  EDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEMAEEDKKVREKIDARNKLETYIYNMR  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK++S++KE+IETA KEALEWLDDNQNAEK DY+EKLKEVE VC+P+I  
Sbjct  581  STINDKDKLADKIDSDDKERIETALKEALEWLDDNQNAEKDDYEEKLKEVEEVCDPVIKQ  640

Query  216  VYQR  205
            VY++
Sbjct  641  VYEK  644



>gb|AAB70400.1| Similar to Arabidopsis luminal binding protein (gb|D89342) [Arabidopsis 
thaliana]
Length=655

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPR-----GTPQIEVTFEVDANGI  592
            YQDQQTTVTI V+EGER +TKDNR LGKFDLTGI PAPR     G PQIEVTFEVDANGI
Sbjct  448  YQDQQTTVTINVYEGERSMTKDNRELGKFDLTGILPAPRNQYFRGVPQIEVTFEVDANGI  507

Query  591  LNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETY  412
            L VKAEDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEEDK +KE+IDARN LETY
Sbjct  508  LQVKAEDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEEDKIMKEKIDARNKLETY  567

Query  411  VYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCN  232
            VYNMK+ + DK+KLA K+  E+KEK+E   KEALEWL++N NAEK DYDEKLKEVE VC+
Sbjct  568  VYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDYDEKLKEVELVCD  627

Query  231  PIITAVYQR  205
            P+I +VY++
Sbjct  628  PVIKSVYEK  636



>ref|XP_006480058.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 163/186 (88%), Gaps = 2/186 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD   LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  456  YQDQQSTVTIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  515

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AEEDK  +ERID+RN LE+Y+YNM+
Sbjct  516  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEEDKNARERIDSRNKLESYIYNMR  575

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IN+KD  KLADK++S++KEKIE+  KEALEWLDDNQNAEK D+DEKLKEVEAVCNP+I
Sbjct  576  STINEKDNNKLADKIDSDDKEKIESTLKEALEWLDDNQNAEKDDFDEKLKEVEAVCNPVI  635

Query  222  TAVYQR  205
              VY++
Sbjct  636  KEVYEK  641



>ref|XP_011092383.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=658

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+VTI+V+EGER LTKD R LG+F+L+GI PAPRG PQIEVTFEVD NGIL+V A
Sbjct  458  YQDQQTSVTIKVYEGERALTKDCRELGRFELSGIPPAPRGVPQIEVTFEVDVNGILHVTA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLS+EEI+  VREAEEFAEED++V+ERI+ARN LETY++NMK
Sbjct  518  EDKAAKKSKSITITNDKGRLSEEEIQEKVREAEEFAEEDRRVRERIEARNKLETYIFNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDK ADK+E+++KEKIETA  +A+EWLDDNQNA++ +  EK+KE+E VCNP++  
Sbjct  578  STINDKDKFADKIEADDKEKIETALTDAMEWLDDNQNADRDELVEKMKELEDVCNPVVKK  637

Query  216  VYQR  205
            VY++
Sbjct  638  VYEQ  641



>ref|XP_002892480.1| hypothetical protein ARALYDRAFT_311954 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68739.1| hypothetical protein ARALYDRAFT_311954 [Arabidopsis lyrata subsp. 
lyrata]
Length=646

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 158/184 (86%), Gaps = 4/184 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I V+EGER +TKDNR LGKFDLTGI PAPRG PQIEVTFEVDANGIL VKA
Sbjct  451  YQDQQTTVSINVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKA  510

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK    S+ ITITNDKGRL++EEIE M+REAEEFAEED+ +KE+IDARN LETYVYNMK
Sbjct  511  EDKVVKTSQSITITNDKGRLTEEEIEEMIREAEEFAEEDRIMKEKIDARNKLETYVYNMK  570

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + DK+K++D    E+KEK+E   KEALEWL++N NAEK DYD+K+KEVE+VCNP+I +
Sbjct  571  STMADKEKISD----EDKEKMEEVLKEALEWLEENVNAEKEDYDDKMKEVESVCNPVIKS  626

Query  216  VYQR  205
            VY++
Sbjct  627  VYEK  630



>ref|XP_006286312.1| hypothetical protein CARUB_v100065120mg, partial [Capsella rubella]
 gb|EOA19210.1| hypothetical protein CARUB_v100065120mg, partial [Capsella rubella]
Length=168

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -2

Query  639  GTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEED  460
            GTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEED
Sbjct  1    GTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEED  60

Query  459  KKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNAE  280
            KKVKERIDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+E
Sbjct  61   KKVKERIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSE  120

Query  279  K*DYDEKLKEVEAVCNPIITAVYQR  205
            K +YDEKLKEVEAVCNPIITAVYQR
Sbjct  121  KEEYDEKLKEVEAVCNPIITAVYQR  145



>ref|XP_006480059.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=501

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 161/186 (87%), Gaps = 2/186 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD   LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  296  YQDQQSTVTIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  355

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+DK  +ERID+RN LE+Y+YNM+
Sbjct  356  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEKDKNARERIDSRNKLESYIYNMR  415

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IND D  KLADK++S++KEKIE+  KEALEWLDDNQNA K D+DEKLKEVEAVCNP+I
Sbjct  416  STINDNDNNKLADKIDSDDKEKIESTLKEALEWLDDNQNAGKDDFDEKLKEVEAVCNPVI  475

Query  222  TAVYQR  205
              VY++
Sbjct  476  KEVYEK  481



>ref|XP_006344666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Solanum tuberosum]
Length=669

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 162/184 (88%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+VTI+V+EGER LTKD R LG FDL+GI PAPRG PQIEVTF+VD NGIL+V A
Sbjct  469  YQDQQTSVTIKVYEGERSLTKDCRELGSFDLSGIPPAPRGVPQIEVTFQVDENGILHVTA  528

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            +DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEED+KVKE++DA+N LETY+YNMK
Sbjct  529  QDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEEDRKVKEKVDAQNKLETYIYNMK  588

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N IN  DKLA+K++S++K+KIE A KEA EWLDDNQNAEK DYDEK+K++E VCNP+I  
Sbjct  589  NTIN--DKLAEKIDSDDKKKIENALKEATEWLDDNQNAEKEDYDEKMKDLEDVCNPVIKK  646

Query  216  VYQR  205
            VY++
Sbjct  647  VYEK  650



>gb|EMT08654.1| Luminal-binding protein 5 [Aegilops tauschii]
Length=490

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 13/184 (7%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I+V+EGER +TKDNRLLGKFDL+GI PAPRG PQIEVTFEVD NGIL+VKA
Sbjct  302  YQDKQTTVSIKVYEGERSMTKDNRLLGKFDLSGIPPAPRGAPQIEVTFEVDVNGILHVKA  361

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +G+SEKITITN+ GR SQEEI+RMVREAEEF EED+KVKER+DARN LE YVY++K
Sbjct  362  ADKGTGKSEKITITNEGGRHSQEEIDRMVREAEEFMEEDRKVKERVDARNKLEAYVYDIK  421

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N ++   K+AD +E ++KEK           LDDN  AEK DYDEKL+E+E VCNP+I+A
Sbjct  422  NTLD--GKMADAMEGDDKEK-----------LDDNPEAEKEDYDEKLRELEDVCNPVISA  468

Query  216  VYQR  205
            +YQR
Sbjct  469  LYQR  472



>ref|XP_009118328.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b [Brassica rapa]
Length=653

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 158/184 (86%), Gaps = 3/184 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER +TKDNR LGKFDLTGI PAPRG  QIEVTFEVDANGIL VKA
Sbjct  457  YQDQQTTVSIKVYEGERSMTKDNRELGKFDLTGILPAPRGVAQIEVTFEVDANGILQVKA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL+QEEI+ M+REAEEFAEED+ VKE+IDA+N LETYVYNMK
Sbjct  517  EDKVAKTSQSITITNDKGRLTQEEIDEMIREAEEFAEEDRIVKEKIDAKNKLETYVYNMK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +   +KLA+K+  E+K K+E   KEALEWL++N NAEK DY+EKLKEVE+VCNP+I +
Sbjct  577  SSL---EKLAEKISYEDKAKMEVVLKEALEWLEENVNAEKDDYEEKLKEVESVCNPVIKS  633

Query  216  VYQR  205
            VY++
Sbjct  634  VYEK  637



>ref|XP_005784200.1| hypothetical protein EMIHUDRAFT_442092 [Emiliania huxleyi CCMP1516]
 gb|EOD31771.1| hypothetical protein EMIHUDRAFT_442092 [Emiliania huxleyi CCMP1516]
Length=657

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q  V IQVFEGER +TKD  LLGKF+L  I PAPRG PQIEV+FE+DANGILNV A
Sbjct  450  YQDNQPAVMIQVFEGERTMTKDCHLLGKFELGSIPPAPRGVPQIEVSFEIDANGILNVGA  509

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEEDKKV+E+I+ARN+LE YVY+MK
Sbjct  510  EDKGTGQSEKITITNDKGRLSQEEIERMVSEAEEFAEEDKKVREKIEARNALENYVYSMK  569

Query  396  NQINDKDK-LADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIIT  220
            N ++D +K +ADK+  E+KE +E A +EA EWLDDNQ+AEK D++EKLKEV+ VC+PII+
Sbjct  570  NTLSDGEKGVADKIGDEDKEAVEKAIEEANEWLDDNQDAEKEDFEEKLKEVQDVCSPIIS  629

Query  219  AVYQ  208
             VY+
Sbjct  630  KVYR  633



>ref|XP_004230233.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Solanum lycopersicum]
Length=669

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 163/184 (89%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+VTI+V+EGER LTKD R LG FDL+GI PAPRG PQIEVTF+VD NGIL+V A
Sbjct  469  YQDQQTSVTIKVYEGERSLTKDCRELGSFDLSGIPPAPRGVPQIEVTFQVDENGILHVTA  528

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            +DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEED+KV+E++DA+N LETY+YNMK
Sbjct  529  QDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEEDRKVREKVDAQNKLETYIYNMK  588

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N IN  DKLA+K++S+++EKIE+A KEA EWLDDNQNAEK DYDEK+K++E VCNP+I  
Sbjct  589  NTIN--DKLAEKIDSDDREKIESALKEATEWLDDNQNAEKQDYDEKMKDLEDVCNPVIKK  646

Query  216  VYQR  205
            VY++
Sbjct  647  VYEK  650



>gb|EEC79268.1| hypothetical protein OsI_20053 [Oryza sativa Indica Group]
Length=433

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLGKFDLTGIAPAPRG PQI VTFEVDANGIL+V A
Sbjct  230  YKDRQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGAPQIAVTFEVDANGILSVLA  289

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFA+ED++ +E++DARNSLE YVYN+K
Sbjct  290  ADKATGRSEKITISGDDRKISQEEIDRMVREAEEFADEDRRHREQVDARNSLEAYVYNVK  349

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +    K+AD +E EEKEK+E A +EA EWLD N +A K +Y+EKL+E+E VCNP+++A
Sbjct  350  STLG--GKMADAMEGEEKEKVEEAVREAHEWLDGNPDAGKEEYEEKLRELEDVCNPVMSA  407

Query  216  VYQR  205
            VYQR
Sbjct  408  VYQR  411



>ref|XP_004971892.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I+VFEGER +TKDNRLLGKFDL GI PAPRGTPQIEVTFEVDANGIL+V+A
Sbjct  466  YQDRQTTVSIKVFEGERSMTKDNRLLGKFDLAGIPPAPRGTPQIEVTFEVDANGILHVQA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +G+SEKITIT+D  RLSQEEI+RMVREAEEFAEEDKKV+ER+DARN LETY+Y +K
Sbjct  526  ADKGTGKSEKITITSDDRRLSQEEIDRMVREAEEFAEEDKKVRERVDARNKLETYIYQVK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQ-NAEK*DYDEKLKEVEAVCNPIIT  220
            + ++D  K+ DK++ E+KEK+E A +EA EWL+ N  +A+K DY+EKLKE+E VCNPII+
Sbjct  586  SAVDDT-KMTDKMDVEDKEKMEEAVREANEWLEGNSLDADKEDYEEKLKELEDVCNPIIS  644

Query  219  AVYQR  205
            AVYQ+
Sbjct  645  AVYQK  649



>emb|CDY22648.1| BnaC08g42820D [Brassica napus]
Length=605

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 160/184 (87%), Gaps = 3/184 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER +TKDNR LGKFDLTGI PAPRG  QIEVTFEVDANGIL+VKA
Sbjct  409  YQDQQTTVSIKVYEGERSMTKDNRELGKFDLTGILPAPRGVAQIEVTFEVDANGILHVKA  468

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL+QEEI+ M+REAEEFAEED+ VKE+IDA+N LETYVYNMK
Sbjct  469  EDKVAKTSQTITITNDKGRLTQEEIDEMIREAEEFAEEDRIVKEKIDAKNKLETYVYNMK  528

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +   +KLA+K+  EEKEK+E   KEALEWL++N NAEK DY+EKLKEVE+VCNP+I +
Sbjct  529  SSL---EKLAEKISEEEKEKMEEVLKEALEWLEENVNAEKDDYEEKLKEVESVCNPVIKS  585

Query  216  VYQR  205
            VY++
Sbjct  586  VYEK  589



>emb|CDY06347.1| BnaA09g48560D [Brassica napus]
Length=642

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 158/184 (86%), Gaps = 3/184 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER +TKDNR LGKFDLTGI PAPRG  QIEVTFEVDANGIL VKA
Sbjct  446  YQDQQTTVSIKVYEGERSMTKDNRELGKFDLTGILPAPRGVAQIEVTFEVDANGILQVKA  505

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +  S+ ITITNDKGRL+QEEI+ M+REAEEFAEED+ VKE+IDA+N LETYVYNMK
Sbjct  506  EDKVAKTSQSITITNDKGRLTQEEIDEMIREAEEFAEEDRIVKEKIDAKNKLETYVYNMK  565

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +   +KLA+K+  E+K K+E   KEALEWL++N NAEK DY+EKLKEVE+VCNP+I +
Sbjct  566  SSL---EKLAEKISYEDKAKMEEVLKEALEWLEENVNAEKDDYEEKLKEVESVCNPVIKS  622

Query  216  VYQR  205
            VY++
Sbjct  623  VYEK  626



>ref|XP_006423186.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
 gb|ESR36426.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
Length=639

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 161/185 (87%), Gaps = 2/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTK    LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  452  YQDQQSTVTIKVYEGERSLTKGCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  511

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AEEDK  +ERID+RN LE+Y+YNM+
Sbjct  512  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEEDKNARERIDSRNKLESYIYNMR  571

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IN+KD  KLADK++S++KEKIE+  KEALEWLDDNQNAEK D+DEKLKEVEAVCNP+I
Sbjct  572  STINEKDNNKLADKIDSDDKEKIESTLKEALEWLDDNQNAEKDDFDEKLKEVEAVCNPVI  631

Query  222  TAVYQ  208
              VY+
Sbjct  632  KEVYE  636



>gb|EEC83049.1| hypothetical protein OsI_28153 [Oryza sativa Indica Group]
Length=529

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLG+FDL GIAPAPRG PQIEVTFEVDANGIL+V A
Sbjct  325  YKDKQTTVTIQVFEGERSMTRDNRLLGRFDLAGIAPAPRGAPQIEVTFEVDANGILSVLA  384

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFAEED++ +E++DARNSLE YVYN+K
Sbjct  385  ADKATGRSEKITISGDDRKISQEEIDRMVREAEEFAEEDRRHREQVDARNSLEAYVYNIK  444

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N +    K+AD +E EEK+K+E A +EA EWLD N +A K +Y+EKL+E+E VCNP+++A
Sbjct  445  NTLG--GKMADAMEGEEKDKVEEAVREAYEWLDGNPDAGKEEYEEKLRELEDVCNPVMSA  502

Query  216  VYQR  205
            VYQR
Sbjct  503  VYQR  506



>ref|XP_011023674.1| PREDICTED: luminal-binding protein 4-like [Populus euphratica]
Length=660

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+V+EGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGIL+VKA
Sbjct  461  YQDQQTTVSIKVYEGERSLTKDCRELGRFDLSGILPAPRGVPQIEVTFEVDANGILHVKA  520

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEE AEEDKKV+E+IDARN LETY+YNM+
Sbjct  521  EDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEMAEEDKKVREKIDARNKLETYIYNMR  580

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + INDKDKLADK++S +K++IETA KEALEWLD NQNAEK D++EKLKEVE VC+P+I  
Sbjct  581  STINDKDKLADKIDSGDKDRIETALKEALEWLDGNQNAEKDDFEEKLKEVEEVCDPVIKQ  640

Query  216  VYQR  205
            VY++
Sbjct  641  VYEK  644



>ref|XP_005651681.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE27137.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
Length=639

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TV+IQVFEGER +TKDN  LG+FDLTGI PAPRG PQIEVTFE+DANGILNV A
Sbjct  438  YQDQQSTVSIQVFEGERTMTKDNHKLGQFDLTGIPPAPRGVPQIEVTFEIDANGILNVGA  497

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+ EKITITNDKGRLSQE+IERMV+EAEEFAE+DK VK ++DARN+LETY YNMK
Sbjct  498  EDKGTGKREKITITNDKGRLSQEDIERMVQEAEEFAEQDKAVKAKVDARNALETYCYNMK  557

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIIT  220
              I  +DKL DKLE ++KEK++ A  EALEW+DDNQ+AE+ +Y +KLKEVE VCNP+++
Sbjct  558  QTI--EDKLGDKLEEDDKEKVKAAVDEALEWMDDNQDAEEEEYKDKLKEVEDVCNPVVS  614



>ref|XP_001416181.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94474.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
Length=662

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q TV IQVFEGER +TKDN LLGKF+LT I PAPRG PQIEVTFE+DANGILNV A
Sbjct  464  YQDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA  523

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEED+K KERID+RNSLET+ YNMK
Sbjct  524  EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDRKTKERIDSRNSLETFAYNMK  583

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I+D DKLADKL+ ++K  IE A KE L+WLD+NQ+AEK DYDE+LK++E VCNPI+  
Sbjct  584  NTISDSDKLADKLDDDDKNTIEEAVKETLDWLDENQSAEKEDYDEQLKQLEEVCNPIVAK  643

Query  216  VYQ  208
             YQ
Sbjct  644  AYQ  646



>ref|XP_004964075.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I+VFEGER +TKDNRLLGKFDLTGI PAPRGTPQIEVTFEVDANGIL+V A
Sbjct  466  YQDRQTTVSIKVFEGERSMTKDNRLLGKFDLTGIPPAPRGTPQIEVTFEVDANGILHVTA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +G+SEKITIT+D  RLSQEE++RMVREAEEFAEED+KV+ER+DARN LETYVY +K
Sbjct  526  ADKGTGKSEKITITSDDRRLSQEEVDRMVREAEEFAEEDRKVRERVDARNKLETYVYQVK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQ-NAEK*DYDEKLKEVEAVCNPIIT  220
            + ++D  K+ADK++ E+KE++E A +EA EWL+ N  +A+K DY++KLK++E VCNPII+
Sbjct  586  STMDDT-KMADKMDVEDKERMEEAVREANEWLEGNSLDADKEDYEDKLKQLEDVCNPIIS  644

Query  219  AVYQR  205
            AVYQ+
Sbjct  645  AVYQK  649



>dbj|BAJ89190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 158/185 (85%), Gaps = 3/185 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I+V+EGER +TKDNRLLGKFDL+GI PAPRGTPQIEVTFEVD NGIL+VKA
Sbjct  466  YQDKQTTVSIKVYEGERSMTKDNRLLGKFDLSGIPPAPRGTPQIEVTFEVDVNGILHVKA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +G+SEKITITN+  R SQE+I+RMVREAEEFAE D KVKER+DARN LE+YVY +K
Sbjct  526  ADKGTGKSEKITITNEGRRHSQEDIDRMVREAEEFAEADLKVKERVDARNKLESYVYGIK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDN-QNAEK*DYDEKLKEVEAVCNPIIT  220
            + ++   K+AD ++ +EK K+E A +E  EWLDDN + A+K DYDEKL+E+E VCNPIIT
Sbjct  586  DTVD--GKMADAMDKDEKNKVEDAMREVNEWLDDNAEAADKEDYDEKLRELEDVCNPIIT  643

Query  219  AVYQR  205
            AVYQR
Sbjct  644  AVYQR  648



>ref|XP_006423179.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
 gb|ESR36419.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
Length=655

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 161/186 (87%), Gaps = 2/186 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD   LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  450  YQDQQSTVTIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  509

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+DK  +ERID+RN LE+Y+YNM+
Sbjct  510  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEKDKNARERIDSRNKLESYIYNMR  569

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IND D  KLADK++S++KEKIE+  KEALEWLDDNQNA K D+DEKLKEVEAVCNP+I
Sbjct  570  STINDNDNNKLADKIDSDDKEKIESTLKEALEWLDDNQNAGKDDFDEKLKEVEAVCNPVI  629

Query  222  TAVYQR  205
              VY++
Sbjct  630  KEVYEK  635



>ref|XP_002949576.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
 gb|EFJ49128.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
Length=653

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKDN  LG+FDL GI PAPRGTPQIEVTFEVDANGILNV A
Sbjct  454  YQDQQTTVSIQVFEGERAMTKDNHKLGQFDLNGIPPAPRGTPQIEVTFEVDANGILNVAA  513

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+ EKITIT +KGRLSQ++IERMVREAEEFAE+DK VK +IDARN LETY YNMK
Sbjct  514  EDKGTGKKEKITITAEKGRLSQDDIERMVREAEEFAEQDKAVKAKIDARNQLETYCYNMK  573

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +  +DKL DK++ ++KEK+ +A KEALEWLD+N +A+  DY EKLKEVE VCNPII  
Sbjct  574  STV--EDKLKDKIDEDDKEKVLSAVKEALEWLDENSDADPEDYKEKLKEVEDVCNPIIAQ  631

Query  216  VYQ  208
            +Y+
Sbjct  632  IYK  634



>ref|XP_009622355.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Nicotiana tomentosiformis]
Length=668

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 162/184 (88%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+V+I+V+EGER LTKD R LG FDL+GI PAPRG PQIEV+FE+D NGIL V A
Sbjct  468  YQDQQTSVSIKVYEGERSLTKDCRELGSFDLSGIPPAPRGVPQIEVSFEIDENGILQVTA  527

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            +DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEED+KV+E++D+RN LETYVYNMK
Sbjct  528  QDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEEDRKVREKVDSRNKLETYVYNMK  587

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N IN  DKLA+K++S++KEKIE+A KEA+EW+DDNQNAEK DYDEK+KE+E VCNP+I  
Sbjct  588  NTIN--DKLAEKIDSDDKEKIESALKEAMEWMDDNQNAEKEDYDEKMKELEDVCNPVIRQ  645

Query  216  VYQR  205
             Y++
Sbjct  646  AYEK  649



>ref|XP_002456746.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
 gb|EES01866.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
Length=667

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I VF+GER +TKDN LLGKFDL+GI PAP+GTPQIEVTFEVD NGIL+VKA
Sbjct  465  YQDRQTTVSIMVFQGERSMTKDNELLGKFDLSGIPPAPKGTPQIEVTFEVDVNGILHVKA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +GRSEK+TIT+D  R+SQEE++RMV EAEEFAEED+K +ER+DARN LETYVY +K
Sbjct  525  ADKGTGRSEKVTITSDARRVSQEEMDRMVHEAEEFAEEDRKARERVDARNKLETYVYQVK  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + + D   +ADK+ ++EKEK+E A +EA EW++ N +A+K DY+EKLKE+E VC+P+I+A
Sbjct  585  SAVVDDSNMADKMNADEKEKVEEAVREANEWIEVNSDADKEDYEEKLKELEDVCSPVISA  644

Query  216  VYQR  205
            VYQR
Sbjct  645  VYQR  648



>ref|XP_004971898.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I+VFEGER +TKDNRLLGKFDL GI PAPRGTPQIEVTFEVDANGIL+V+A
Sbjct  466  YQDRQTTVSIKVFEGERSMTKDNRLLGKFDLAGIPPAPRGTPQIEVTFEVDANGILHVQA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +G+SEKITIT+D  RLSQEEI+RMVREAEEFAEEDKKV+ER+DARN LETY+Y +K
Sbjct  526  ADKGTGKSEKITITSDDRRLSQEEIDRMVREAEEFAEEDKKVRERVDARNKLETYIYQVK  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQ-NAEK*DYDEKLKEVEAVCNPIIT  220
            + ++D  K+ +K++ E+KEK+E A +EA EWL+ N  +A+K DY+EKLKE+E VCNP+ +
Sbjct  586  SAVDDT-KMTEKMDVEDKEKMEEAVREANEWLEGNSLDADKEDYEEKLKELEDVCNPVFS  644

Query  219  AVYQR  205
            AVYQR
Sbjct  645  AVYQR  649



>ref|NP_001061194.1| Os08g0197700 [Oryza sativa Japonica Group]
 dbj|BAD03698.1| putative Luminal binding protein 5 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF23108.1| Os08g0197700 [Oryza sativa Japonica Group]
Length=676

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLG+FDL GIAPAPRG PQIEVTFEVDANGIL+V A
Sbjct  472  YKDKQTTVTIQVFEGERSMTRDNRLLGRFDLAGIAPAPRGAPQIEVTFEVDANGILSVLA  531

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFAEED++ +E++DARNSLE YVYN+K
Sbjct  532  ADKATGRSEKITISGDDRKISQEEIDRMVREAEEFAEEDRRHREQVDARNSLEAYVYNIK  591

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N +    K+AD +E EEK+K+E A +EA EWLD N +A K +Y+EKL+E+E VCNP+++A
Sbjct  592  NTLG--GKMADAMEGEEKDKVEEAVREAYEWLDGNPDAGKEEYEEKLRELEDVCNPVMSA  649

Query  216  VYQR  205
            VYQR
Sbjct  650  VYQR  653



>ref|XP_002507118.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
 gb|ACO68376.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
Length=660

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q TV IQVFEGER +TKDN LLGKF+LT I PAPRG PQIEVTFE+DANGILNV A
Sbjct  458  YQDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEED+K+KER+D RNSLETY YNMK
Sbjct  518  EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDRKIKERVDTRNSLETYAYNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N + D DKLA KL  ++K +IE A KE L+WLDDNQNAEK +Y+EKLK++E+VCNPI++ 
Sbjct  578  NTVTDDDKLASKLADDDKRQIEEAVKETLDWLDDNQNAEKEEYEEKLKDIESVCNPIVSR  637

Query  216  VYQR  205
            VYQ+
Sbjct  638  VYQQ  641



>ref|XP_009766974.1| PREDICTED: luminal-binding protein 5-like [Nicotiana sylvestris]
Length=667

 Score =   217 bits (552),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 162/184 (88%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQT+V+I+V+EGER LTKD R LG FDL+GI PAPRG PQIEV+FE+D NGIL V A
Sbjct  468  YQDQQTSVSIKVYEGERSLTKDCRELGSFDLSGIPPAPRGVPQIEVSFEIDENGILQVTA  527

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            +DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEED+KV+E++D+RN LETYVYNMK
Sbjct  528  QDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEEDRKVREKVDSRNKLETYVYNMK  587

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I+  DKLA+K++S++KEKIE+A KEA++W+DDNQNAEK DYDEK+KE+E VCNP+I  
Sbjct  588  NTIS--DKLAEKIDSDDKEKIESALKEAMDWMDDNQNAEKEDYDEKMKELEDVCNPVIRQ  645

Query  216  VYQR  205
             Y++
Sbjct  646  AYEK  649



>ref|XP_001701685.1| binding protein 1 [Chlamydomonas reinhardtii]
 gb|EDP06660.1| binding protein 1 [Chlamydomonas reinhardtii]
Length=656

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 156/184 (85%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQV+EGER +TKDN  LG+FDL GI PAPRGTPQIEVTFEVDANGILNV A
Sbjct  456  YQDQQTTVSIQVYEGERAMTKDNHKLGQFDLNGIPPAPRGTPQIEVTFEVDANGILNVAA  515

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+ EKITIT +KGRLSQ++IERMV+EAEEFAE+DK VK +IDARN LETY YNMK
Sbjct  516  EDKGTGKKEKITITAEKGRLSQDDIERMVKEAEEFAEQDKAVKAKIDARNQLETYCYNMK  575

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +  +DK+ DK+E E+KEKI  A KEALEWLD+N +AE  +Y +KLKEVE VCNPII  
Sbjct  576  STV--EDKMKDKIEEEDKEKITAAVKEALEWLDENPDAEPDEYKDKLKEVEDVCNPIIAE  633

Query  216  VYQR  205
            VY++
Sbjct  634  VYKK  637



>gb|KCW61819.1| hypothetical protein EUGRSUZ_H04513 [Eucalyptus grandis]
Length=618

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI+VFEGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGI+NVKA
Sbjct  416  YQDQQTTVTIKVFEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGIVNVKA  475

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EED+KVKE++DARN LE+YVY+M+
Sbjct  476  EDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREEDQKVKEKVDARNKLESYVYSMR  535

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQN-AEK*DYDEKLKEVEAVCNPIIT  220
              I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ AEK D+DEKLKEVEAVC P+I 
Sbjct  536  ATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDTAEKEDFDEKLKEVEAVCTPVIK  595

Query  219  AVYQR  205
             VY++
Sbjct  596  QVYEK  600



>gb|KCW44694.1| hypothetical protein EUGRSUZ_L01770 [Eucalyptus grandis]
Length=572

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV I+VFEGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGI+NVKA
Sbjct  370  YQDQQTTVAIKVFEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGIVNVKA  429

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EED+KVKE++DARN LE+YVY+M+
Sbjct  430  EDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREEDQKVKEKVDARNKLESYVYSMR  489

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQN-AEK*DYDEKLKEVEAVCNPIIT  220
              I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ AEK D+DEKLKEVEAVC P+I 
Sbjct  490  ATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDTAEKEDFDEKLKEVEAVCTPVIK  549

Query  219  AVYQR  205
             VY++
Sbjct  550  QVYEK  554



>ref|XP_006423178.1| hypothetical protein CICLE_v10029824mg [Citrus clementina]
 gb|ESR36418.1| hypothetical protein CICLE_v10029824mg [Citrus clementina]
Length=561

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD   LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  356  YQDQQSTVTIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  415

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+DK  +ERID+RN LE+Y+YNM+
Sbjct  416  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEKDKNARERIDSRNKLESYIYNMR  475

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IND D  KLA+K++S++KEKIE+  KEALEWLDDNQNA K D+D+KLKEVEAVCNP+I
Sbjct  476  STINDNDNNKLANKIDSDDKEKIESTLKEALEWLDDNQNAGKDDFDKKLKEVEAVCNPVI  535

Query  222  TAVYQR  205
               Y++
Sbjct  536  KEFYEK  541



>gb|EEE63801.1| hypothetical protein OsJ_18625 [Oryza sativa Japonica Group]
Length=658

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLGKFDLTGIAPAPRG PQI VTFEVDANGIL+V A
Sbjct  455  YKDRQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGAPQIAVTFEVDANGILSVLA  514

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFA+ED++ +E++DARNSLE YVYN+K
Sbjct  515  ADKATGRSEKITISGDDRKISQEEIDRMVREAEEFADEDRRHREQVDARNSLEAYVYNVK  574

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +    K+AD +E EEKEK+E A +EA EWLD N +A K +Y+EKL+E+E VCNP+++A
Sbjct  575  STLG--GKMADAMEGEEKEKVEEAVREAHEWLDGNPDAGKEEYEEKLRELEDVCNPVMSA  632

Query  216  VYQR  205
            VYQR
Sbjct  633  VYQR  636



>ref|XP_006423175.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
 gb|ESR36415.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
Length=655

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD   LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  450  YQDQQSTVTIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  509

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+DK  +ERID+RN LE+Y+YNM+
Sbjct  510  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEKDKNARERIDSRNKLESYIYNMR  569

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IND D  KLA+K++S++KEKIE+  KEALEWLDDNQNA K D+DEKLKEVEAVCNP+I
Sbjct  570  STINDNDNNKLANKIDSDDKEKIESTLKEALEWLDDNQNAGKDDFDEKLKEVEAVCNPVI  629

Query  222  TAVYQR  205
               Y++
Sbjct  630  KEFYEK  635



>ref|XP_006479343.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQ+TVTI+V+EGER LTKD   LG+FDL+GI PAPRG PQI+VTF+VDANGIL+V A
Sbjct  456  YQDQQSTVTIKVYEGERSLTKDCHELGRFDLSGIPPAPRGVPQIQVTFDVDANGILHVTA  515

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+DK  +ERID+RN LE+Y+YNM+
Sbjct  516  EDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEKDKNARERIDSRNKLESYIYNMR  575

Query  396  NQINDKD--KLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPII  223
            + IND D  KLA+K++S++KEKIE+  KEALEWLDDNQNA K D+DEKLKEVEAVCNP+I
Sbjct  576  STINDNDNNKLANKIDSDDKEKIESTLKEALEWLDDNQNAGKDDFDEKLKEVEAVCNPVI  635

Query  222  TAVYQR  205
               Y++
Sbjct  636  KEFYEK  641



>gb|EAY91599.1| hypothetical protein OsI_13234 [Oryza sativa Indica Group]
Length=426

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D QTTV+I+VFEGER LTKD R LG+FDL+GIAPAPRG PQIEVTFEVD NGIL+V A
Sbjct  223  YEDHQTTVSIKVFEGERSLTKDCRELGRFDLSGIAPAPRGVPQIEVTFEVDENGILHVTA  282

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEED++V+ER+DARN LE YVY M+
Sbjct  283  SDKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEEDRRVRERVDARNRLENYVYRMR  342

Query  396  NQINDKDKLADkleseekekietatkealEWLDDN----QNAEK*DYDEKLKEVEAVCNP  229
            + + D   +A K+  +++E++E+A  EALEWL+DN    + AEK DY+EKLKEVE VC P
Sbjct  343  SAVRD-GGMAGKIGDDDRERMESALTEALEWLEDNDGGARTAEKEDYEEKLKEVEQVCGP  401

Query  228  IITAVYQR  205
            II  VY++
Sbjct  402  IIKQVYKK  409



>ref|XP_010027237.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=667

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 165/185 (89%), Gaps = 1/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTI+VFEGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGI+NVKA
Sbjct  465  YQDQQTTVTIKVFEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGIVNVKA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EED+KVKE++DARN LE+YVY+M+
Sbjct  525  EDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREEDQKVKEKVDARNKLESYVYSMR  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQN-AEK*DYDEKLKEVEAVCNPIIT  220
              I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ AEK D+DEKLKEVEAVC P+I 
Sbjct  585  ATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDTAEKEDFDEKLKEVEAVCTPVIK  644

Query  219  AVYQR  205
             VY++
Sbjct  645  QVYEK  649



>ref|NP_001055613.1| Os05g0428600 [Oryza sativa Japonica Group]
 gb|AAS90667.1| putative Luminal binding protein [Oryza sativa Japonica Group]
 gb|AAV59416.1| putative luminal binding protein 5 [Oryza sativa Japonica Group]
 dbj|BAF17527.1| Os05g0428600 [Oryza sativa Japonica Group]
Length=687

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLGKFDLTGIAPAPRG PQI VTFEVDANGIL+V A
Sbjct  484  YKDRQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGAPQIAVTFEVDANGILSVLA  543

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFA+ED++ +E++DARNSLE YVYN+K
Sbjct  544  ADKATGRSEKITISGDDRKISQEEIDRMVREAEEFADEDRRHREQVDARNSLEAYVYNVK  603

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +    K+AD +E EEKEK+E A +EA EWLD N +A K +Y+EKL+E+E VCNP+++A
Sbjct  604  STLG--GKMADAMEGEEKEKVEEAVREAHEWLDGNPDAGKEEYEEKLRELEDVCNPVMSA  661

Query  216  VYQR  205
            VYQR
Sbjct  662  VYQR  665



>ref|XP_003055985.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH59361.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=659

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q TV IQVFEGER +TKDN LLGKF+LT I PAPRG PQIEVTFE+DANGILNV A
Sbjct  456  YQDNQQTVMIQVFEGERAMTKDNHLLGKFELTSIPPAPRGVPQIEVTFEIDANGILNVGA  515

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEED+K+KER+DARNSLETY YNMK
Sbjct  516  EDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEEDRKIKERVDARNSLETYAYNMK  575

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I D DKLADKL+ ++K  IE A +E L+WLDDNQN EK +Y+EKLKE+E +CNPI++ 
Sbjct  576  NTIADTDKLADKLDQDDKVTIEEAVRETLDWLDDNQNGEKEEYEEKLKEIEGICNPIVSK  635

Query  216  VYQR  205
            VYQ+
Sbjct  636  VYQQ  639



>gb|EMT02696.1| Luminal-binding protein [Aegilops tauschii]
Length=643

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD+QTTV+I+V+EGER +TKDNRLLGKFDL+GI P+PRGTPQ+EVTF+VD NGIL+VKA
Sbjct  457  YQDKQTTVSIKVYEGERSMTKDNRLLGKFDLSGIPPSPRGTPQLEVTFDVDVNGILHVKA  516

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DK +G+SEKITITN+  R SQE+I+RMVREAEEFAE D K+KER+DARN LETYVY++K
Sbjct  517  ADKGTGKSEKITITNEDRRHSQEDIDRMVREAEEFAEADHKLKERVDARNKLETYVYSIK  576

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N ++   K+AD +E +EKEK++ A +E  EWLDDN  AEK DYDEKL+E+E VCNPIIT+
Sbjct  577  NTVD--TKMADAMERDEKEKVQDALREVNEWLDDNTEAEKEDYDEKLREMEDVCNPIITS  634



>gb|EJY69686.1| hypothetical protein OXYTRI_09575 [Oxytricha trifallax]
Length=657

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTVTIQVFEGER +TKDN LLGKFDLTGI PAPRG PQIEVTFE+D N IL+V A
Sbjct  458  YQDQQTTVTIQVFEGERTMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDENSILSVTA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             +K +G+ E ITITNDKGRLS+EEI+ M+R+AE+FA++DK++KE+IDA+NSLE Y+Y M+
Sbjct  518  HEKGTGKVESITITNDKGRLSKEEIDAMIRDAEKFADQDKELKEKIDAKNSLENYIYTMR  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N I DK+KLA+K+ES++K KI+ A +EA +WL  +  AEK DYD +LK+++++C+PII+ 
Sbjct  578  NTIEDKEKLAEKIESDDKSKIKDALQEAQDWLSSHDEAEKDDYDSQLKDLQSICDPIISK  637

Query  216  VYQR  205
            VY++
Sbjct  638  VYKQ  641



>ref|XP_005829514.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
 gb|EKX42534.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
Length=662

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  753  QDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKAE  574
            QD Q TV IQVFEGER +TKD  LLGKF+L+ + PAPRG PQIEVTFE+DANGIL V AE
Sbjct  457  QDNQPTVLIQVFEGERSMTKDCHLLGKFELSNLPPAPRGVPQIEVTFEIDANGILQVSAE  516

Query  573  DKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMKN  394
            DK +G+SEKITITNDKGRLSQEEI+RMV+EA+E+ EEDKKVKERIDA+NS+E+Y+YN+KN
Sbjct  517  DKGTGKSEKITITNDKGRLSQEEIDRMVQEAKEYEEEDKKVKERIDAKNSIESYIYNIKN  576

Query  393  QINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITAV  214
             IND+DK+  KL  E+KE +E   K   EW+D+N +AEK D+DEK KEVE V NPI++ +
Sbjct  577  TINDEDKIKGKLSDEDKETLEEIVKTTTEWIDENSSAEKEDFDEKQKEVEKVVNPIMSKL  636

Query  213  Y  211
            Y
Sbjct  637  Y  637



>ref|XP_010041040.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=665

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV I+VFEGER LTKD R LG+FDL+GI PAPRG PQIEVTFEVDANGI+NVKA
Sbjct  463  YQDQQTTVAIKVFEGERSLTKDCRELGRFDLSGIPPAPRGVPQIEVTFEVDANGIVNVKA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EED+KVKE++DARN LE+YVY+M+
Sbjct  523  EDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREEDQKVKEKVDARNKLESYVYSMR  582

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQN-AEK*DYDEKLKEVEAVCNPIIT  220
              I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ AEK D+DEKLKEVEAVC P+I 
Sbjct  583  ATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDTAEKEDFDEKLKEVEAVCTPVIK  642

Query  219  AVYQR  205
             VY++
Sbjct  643  QVYEK  647



>ref|XP_006655245.1| PREDICTED: luminal-binding protein 4-like [Oryza brachyantha]
Length=668

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 160/184 (87%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQV+EGER +T+DNRLLGKFDLTGIAPAPRG PQIEVTFEVD NGIL+V+A
Sbjct  469  YKDRQTTVTIQVYEGERSMTQDNRLLGKFDLTGIAPAPRGAPQIEVTFEVDTNGILSVRA  528

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             D+A+G+SE+ITI+ D+ ++S++EIERM+REA+EFA++D++VKER+DA NSLE+YVY++K
Sbjct  529  ADRATGKSERITISGDERKISKDEIERMIREADEFADDDRRVKERVDAHNSLESYVYSIK  588

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            N ++   K+ D +E  EKEK+E A +EA +WLD N +A K DY+EKL+E+E VCNP++ A
Sbjct  589  NTVD--GKMGDAMEGGEKEKVEEAVREAYDWLDGNHDAGKEDYEEKLRELEDVCNPVMAA  646

Query  216  VYQR  205
            VYQR
Sbjct  647  VYQR  650



>gb|AAA80655.1| BiP [Phaeodactylum tricornutum]
Length=659

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            +QD Q  V IQV+EGER +TKDN  LGKF+LTGI PAPRG PQIEVTFEVDANGIL V A
Sbjct  458  HQDNQNVVLIQVYEGERSMTKDNHNLGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G++EKITIT +KGRLS+EEIERMVREAEEFAEEDKKVKERIDARN LE+Y+YN+K
Sbjct  518  EDKGTGKAEKITITAEKGRLSEEEIERMVREAEEFAEEDKKVKERIDARNGLESYLYNLK  577

Query  396  NQINDKDK-LADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIIT  220
            N ++D +K LAD L +E+K++++    E L+W+D N  A+K DYDEKLKEVE V NPI+ 
Sbjct  578  NTLDDDEKGLADNLSAEDKKELQDMIDETLDWMDGNPEADKEDYDEKLKEVEQVANPIMR  637

Query  219  AVY  211
             VY
Sbjct  638  NVY  640



>ref|XP_002178567.1| ER luminal binding protein precursor [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC50232.1| ER luminal binding protein precursor [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=659

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            +QD Q  V IQV+EGER +TKDN  LGKF+LTGI PAPRG PQIEVTFEVDANGIL V A
Sbjct  458  HQDNQNVVLIQVYEGERSMTKDNHNLGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G++EKITIT +KGRLS+EEIERMVREAEEFAEEDKKVKERIDARN LE+Y+YN+K
Sbjct  518  EDKGTGKAEKITITAEKGRLSEEEIERMVREAEEFAEEDKKVKERIDARNGLESYLYNLK  577

Query  396  NQINDKDK-LADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIIT  220
            N ++D +K LAD L +E+K++++    E L+W+D N  A+K DYDEKLKEVE V NPI+ 
Sbjct  578  NTLDDDEKGLADNLSAEDKKELQDMIDETLDWMDGNPEADKEDYDEKLKEVEQVANPIMR  637

Query  219  AVY  211
             VY
Sbjct  638  NVY  640



>gb|AGC96524.1| 70kD heat shock protein, partial [Scylla paramamosain]
Length=209

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  750  DQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKAED  571
            D Q TVTIQVFEGER +TKDNR+LGKFDLTGI PAPRG PQIEVTFE+DANGIL V AED
Sbjct  11   DNQHTVTIQVFEGERPMTKDNRILGKFDLTGIPPAPRGVPQIEVTFEIDANGILQVSAED  70

Query  570  KASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMKNQ  391
            K +G  EKI ITND+ RL+ E+IERM+++AE FA+EDKK+KER+++RN LE+Y Y++KNQ
Sbjct  71   KGTGNKEKIVITNDQNRLTPEDIERMIKDAEVFADEDKKLKERVESRNELESYAYSLKNQ  130

Query  390  INDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITAVY  211
            +NDK+KL  KL  E+KEKIE A  E ++WL+DN ++E  DY  + KE+E +  PII  +Y
Sbjct  131  VNDKEKLGAKLTDEDKEKIEGAIDEKIKWLEDNPDSEAEDYKAQKKELEDIVQPIIAKLY  190

Query  210  Q  208
            Q
Sbjct  191  Q  191



>ref|XP_006644572.1| PREDICTED: luminal-binding protein 5-like [Oryza brachyantha]
Length=679

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D+QTTVTIQVFEGER +T+DNRLLGKFDLTGIAPAPRGTPQIEVTFEVD NGIL+V+A
Sbjct  479  YKDKQTTVTIQVFEGERSMTRDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDPNGILSVQA  538

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             D A+G+SEKITI+ D  +LSQE+I+RMVREAEEFAEED++ +E++DARNSLE YVYN+K
Sbjct  539  ADMATGKSEKITISGDDRKLSQEDIDRMVREAEEFAEEDRRHREQVDARNSLEAYVYNVK  598

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + +  + K+AD ++  EKEK+E A +EA EWLD N +A K +Y++K +E+E VCNPI++A
Sbjct  599  DSV--EGKMADAMKGHEKEKVEEAVREAYEWLDGNPDAGKEEYEDKQRELEDVCNPIMSA  656

Query  216  VYQR  205
            VY+R
Sbjct  657  VYRR  660



>ref|XP_011088129.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=656

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 160/184 (87%), Gaps = 3/184 (2%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+I+++EGER LTKD R LG F+L+GI+PAPRG PQIEV FEVD NGIL+V+A
Sbjct  458  YQDQQTTVSIKIYEGERALTKDCRELGSFELSGISPAPRGVPQIEVAFEVDVNGILHVQA  517

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDKA+ +SE ITITN+KGRLS+EEIE  VREAEEFAEED+  +ERI+ARN LETY++NMK
Sbjct  518  EDKAAKKSESITITNEKGRLSEEEIEEKVREAEEFAEEDRMTRERIEARNRLETYIFNMK  577

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIITA  217
            + IN   KLA+++ SE+KE+IE+A K+A+EWLD+NQ+A+K + DE+ +E+EA+CNPIIT 
Sbjct  578  STIN---KLAEQISSEDKEEIESALKDAMEWLDENQHADKDELDERTRELEALCNPIITK  634

Query  216  VYQR  205
            VY++
Sbjct  635  VYEK  638



>gb|EWM22457.1| luminal binding protein [Nannochloropsis gaditana]
Length=664

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQD Q  V IQVFEGER +TKDN LLGKF+LTGI PAPRG PQIEVTFE+DANGIL V A
Sbjct  463  YQDNQPAVLIQVFEGERSMTKDNHLLGKFELTGIPPAPRGVPQIEVTFEIDANGILQVSA  522

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            ED+ +G+SEKITIT +KGRLSQ+EIERMVREAEEFA+EDKKVKE+IDARN LE+Y+YN+K
Sbjct  523  EDRGTGKSEKITITAEKGRLSQDEIERMVREAEEFADEDKKVKEKIDARNGLESYLYNLK  582

Query  396  NQINDKDK-LADkleseekekietatkealEWLDDNQNAEK*DYDEKLKEVEAVCNPIIT  220
            N + D++K LADKL + +K+++E    EA+EWL+DN +A+  +Y +K KEVE + NPI+ 
Sbjct  583  NTLEDEEKGLADKLSASDKKEVEATINEAMEWLEDNADADTEEYTKKQKEVETIVNPILK  642

Query  219  AVYQ  208
             VYQ
Sbjct  643  EVYQ  646



>gb|AAA62325.1| HSP70 [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            YQDQQTTV+IQVFEGER +TKD RLLGKFDL+GI  APRGTPQIEVTFEVDANGILNVKA
Sbjct  460  YQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKA  519

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
            EDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN LETYVYNMK
Sbjct  520  EDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARNQLETYVYNMK  579

Query  396  NQINDKDKLAD  364
            N + DKDKLAD
Sbjct  580  NTVGDKDKLAD  590



>ref|NP_001051048.1| Os03g0710500 [Oryza sativa Japonica Group]
 gb|AAX95660.1| dnaK protein [Oryza sativa Japonica Group]
 gb|ABF98501.1| Luminal binding protein 5 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12962.1| Os03g0710500 [Oryza sativa Japonica Group]
Length=669

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D QTTV+I+VFEGER LTKD R LG+FDL+GIAPAPRG PQIEVTFEVD NGIL+V A
Sbjct  466  YEDHQTTVSIKVFEGERSLTKDCRELGRFDLSGIAPAPRGVPQIEVTFEVDENGILHVTA  525

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEED++V+ER+DARN LE YVY M+
Sbjct  526  SDKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEEDRRVRERVDARNRLENYVYRMR  585

Query  396  NQINDKDKLADkleseekekietatkealEWLDDN----QNAEK*DYDEKLKEVEAVCNP  229
            + + D   +A K+  +++E++E+A  EALEWL+DN    + AEK DY+EKLKEVE VC P
Sbjct  586  SAVRD-GGMAGKIGDDDRERMESALTEALEWLEDNDGGARTAEKEDYEEKLKEVEQVCGP  644

Query  228  IITAVYQR  205
            II  VY++
Sbjct  645  IIKQVYKK  652



>ref|XP_006650483.1| PREDICTED: luminal-binding protein 4-like [Oryza brachyantha]
Length=665

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 154/189 (81%), Gaps = 7/189 (4%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D QTTV+I+VFEGER LTKD R LG+FDL+GIAPAPRG PQIEVTFEVD NGIL+V A
Sbjct  465  YEDHQTTVSIKVFEGERSLTKDCRELGRFDLSGIAPAPRGVPQIEVTFEVDENGILHVTA  524

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEED++V+ER+DARN LE YVY M+
Sbjct  525  ADKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEEDRRVRERVDARNRLENYVYRMR  584

Query  396  NQINDKDKLADkleseekekietatkealEWLDDNQN-----AEK*DYDEKLKEVEAVCN  232
            +    +D +A K+  ++KE++E A  EALEWL+DN       AEK DY+EKLKEVE VC 
Sbjct  585  SAA--RDGMAGKISDDDKERMEAALTEALEWLEDNDGGARTAAEKDDYEEKLKEVEQVCG  642

Query  231  PIITAVYQR  205
            PII  VY+R
Sbjct  643  PIIKQVYER  651



>gb|EEE59790.1| hypothetical protein OsJ_12307 [Oryza sativa Japonica Group]
Length=726

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -2

Query  756  YQDQQTTVTIQVFEGERGLTKDNRLLGKFDLTGIAPAPRGTPQIEVTFEVDANGILNVKA  577
            Y+D QTTV+I+VFEGER LTKD R LG+FDL+GIAPAPRG PQIEVTFEVD NGIL+V A
Sbjct  523  YEDHQTTVSIKVFEGERSLTKDCRELGRFDLSGIAPAPRGVPQIEVTFEVDENGILHVTA  582

Query  576  EDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARNSLETYVYNMK  397
             DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEED++V+ER+DARN LE YVY M+
Sbjct  583  SDKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEEDRRVRERVDARNRLENYVYRMR  642

Query  396  NQINDKDKLADkleseekekietatkealEWLDDN----QNAEK*DYDEKLKEVEAVCNP  229
            + + D   +A K+  +++E++E+A  EALEWL+DN    + AEK DY+EKLKEVE VC P
Sbjct  643  SAVRD-GGMAGKIGDDDRERMESALTEALEWLEDNDGGARTAEKEDYEEKLKEVEQVCGP  701

Query  228  IITAVYQR  205
            II  VY++
Sbjct  702  IIKQVYKK  709



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260