BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049M05

Length=403
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAW31716.1|  plastid beta-ketoacyl ACP synthase                      132   1e-35   Betula pendula [white birch]
ref|XP_007154557.1|  hypothetical protein PHAVU_003G128700g             136   7e-35   Phaseolus vulgaris [French bean]
ref|XP_009345512.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    132   2e-34   
ref|XP_007204195.1|  hypothetical protein PRUPE_ppa003597mg             134   5e-34   Prunus persica
ref|XP_008338300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    134   6e-34   
ref|XP_009337172.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    134   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_008337819.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    133   6e-34   Malus domestica [apple tree]
ref|XP_006600238.1|  PREDICTED: beta-ketoacyl-ACP synthetase 2 is...    132   1e-33   
gb|KHN17744.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    134   1e-33   Glycine soja [wild soybean]
ref|NP_001235052.1|  beta-ketoacyl-ACP synthetase 2 precursor           132   2e-33   
ref|XP_004488123.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    132   2e-33   Cicer arietinum [garbanzo]
ref|XP_010104609.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       132   2e-33   
ref|XP_011039936.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    132   2e-33   Populus euphratica
gb|ACJ07142.1|  beta-ketoacyl-ACP synthase II-1                         132   2e-33   Arachis hypogaea [goober]
gb|KEH37628.1|  3-oxoacyl-(acyl carrier) synthase II                    132   2e-33   Medicago truncatula
ref|XP_011006167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    132   3e-33   Populus euphratica
ref|XP_010498338.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    131   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006381576.1|  FATTY ACID BIOSYNTHESIS 1 family protein           131   3e-33   
emb|CBI35831.3|  unnamed protein product                                131   4e-33   Vitis vinifera
ref|NP_001236069.1|  plastid 3-keto-acyl-ACP synthase II-B precursor    131   4e-33   Glycine max [soybeans]
gb|AGH32917.1|  ketoacyl-ACP synthase II                                131   4e-33   Camellia chekiangoleosa
gb|EPS66235.1|  hypothetical protein M569_08544                         126   4e-33   Genlisea aurea
ref|XP_010654405.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    131   4e-33   Vitis vinifera
ref|XP_010477131.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    131   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010318480.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    131   6e-33   Solanum lycopersicum
ref|XP_006342938.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    131   6e-33   
ref|XP_010459587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    130   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009359705.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    130   7e-33   Pyrus x bretschneideri [bai li]
gb|AAC68860.1|  3-ketoacyl-ACP synthase                                 130   7e-33   Cuphea avigera var. pulcherrima
ref|XP_004508026.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    130   7e-33   Cicer arietinum [garbanzo]
ref|XP_010047453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    130   9e-33   Eucalyptus grandis [rose gum]
gb|KHN07879.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    130   9e-33   Glycine soja [wild soybean]
ref|XP_006307215.1|  hypothetical protein CARUB_v10008814mg             129   1e-32   Capsella rubella
ref|XP_010533238.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    129   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_008242279.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    129   3e-32   Prunus mume [ume]
ref|XP_002516228.1|  46 kDa ketoavyl-ACP synthase                       129   3e-32   Ricinus communis
gb|AAA33872.1|  chloroplast beta-ketoacyl-ACP synthase precursor        128   3e-32   Ricinus communis
ref|XP_006597888.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    127   4e-32   
ref|XP_002893037.1|  predicted protein                                  128   4e-32   
ref|XP_006416523.1|  hypothetical protein EUTSA_v10007353mg             128   4e-32   
ref|XP_011460975.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    128   5e-32   Fragaria vesca subsp. vesca
ref|XP_006597887.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    127   6e-32   Glycine max [soybeans]
gb|EYU28306.1|  hypothetical protein MIMGU_mgv1a004039mg                128   7e-32   Erythranthe guttata [common monkey flower]
ref|XP_010313772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    127   8e-32   Solanum lycopersicum
ref|XP_006353782.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    127   8e-32   Solanum tuberosum [potatoes]
gb|KEH32421.1|  3-oxoacyl-(acyl carrier) synthase II                    125   9e-32   Medicago truncatula
ref|XP_002324139.2|  hypothetical protein POPTR_0018s07450g             127   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004251704.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    127   1e-31   Solanum lycopersicum
ref|XP_002276214.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    127   2e-31   Vitis vinifera
emb|CBI27767.3|  unnamed protein product                                126   2e-31   Vitis vinifera
gb|ABI18155.1|  plastid 3-keto-acyl-ACP synthase II                     126   2e-31   Helianthus annuus
ref|XP_009587352.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    126   2e-31   Nicotiana tomentosiformis
ref|XP_009771698.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    126   3e-31   Nicotiana sylvestris
gb|ACJ85772.1|  unknown                                                 125   3e-31   Medicago truncatula
ref|XP_003609968.1|  3-oxoacyl-ACP synthase                             125   3e-31   Medicago truncatula
ref|XP_007012570.1|  Fatty acid biosynthesis 1 isoform 5                125   3e-31   
ref|XP_006345248.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   4e-31   Solanum tuberosum [potatoes]
ref|XP_003547514.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   4e-31   
gb|KDO73814.1|  hypothetical protein CISIN_1g008146mg                   125   4e-31   Citrus sinensis [apfelsine]
gb|AAC68861.1|  3-ketoacyl-ACP synthase                                 125   4e-31   Cuphea hookeriana
ref|XP_009767768.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   5e-31   Nicotiana sylvestris
ref|XP_006426745.1|  hypothetical protein CICLE_v10027465mg             124   7e-31   
ref|XP_010261746.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    125   9e-31   Nelumbo nucifera [Indian lotus]
gb|EYU25822.1|  hypothetical protein MIMGU_mgv1a004003mg                124   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_010687531.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   1e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF91318.1|AF242848_1  beta-ketoacyl-acyl carrier protein synt...    124   1e-30   Brassica napus [oilseed rape]
ref|XP_009336709.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   1e-30   
ref|XP_009149615.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   1e-30   
gb|KDP33964.1|  hypothetical protein JCGZ_07535                         124   1e-30   Jatropha curcas
ref|XP_010939870.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   1e-30   Elaeis guineensis
ref|XP_004243689.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   1e-30   Solanum lycopersicum
ref|XP_010939869.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   1e-30   Elaeis guineensis
gb|ABJ90469.2|  beta-ketoacyl-ACP synthase II                           124   1e-30   Jatropha curcas
emb|CDY26686.1|  BnaA06g13360D                                          124   1e-30   Brassica napus [oilseed rape]
ref|XP_006474686.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   2e-30   Citrus sinensis [apfelsine]
emb|CDY41034.1|  BnaC05g14920D                                          124   2e-30   Brassica napus [oilseed rape]
ref|XP_010937285.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   2e-30   
gb|AAC04692.1|  beta-ketoacyl-ACP synthase II                           123   2e-30   Perilla frutescens [beefsteak-mint]
ref|XP_010937286.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   2e-30   Elaeis guineensis
ref|XP_010937284.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    124   2e-30   Elaeis guineensis
ref|XP_011093876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    123   3e-30   Sesamum indicum [beniseed]
gb|AGC65509.1|  keto acyl-acyl carrier protein synthase II              123   3e-30   Carthamus tinctorius
ref|XP_010932373.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    123   4e-30   Elaeis guineensis
ref|XP_010932372.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    123   4e-30   Elaeis guineensis
ref|XP_009625177.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    122   4e-30   Nicotiana tomentosiformis
emb|CDY37268.1|  BnaCnng08220D                                          122   4e-30   Brassica napus [oilseed rape]
ref|XP_007012566.1|  Fatty acid biosynthesis 1 isoform 1                123   4e-30   
gb|AAF26738.2|AF220453_1  beta-ketoacyl-ACP synthase II                 122   6e-30   Elaeis guineensis
ref|XP_010539937.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    123   6e-30   
ref|XP_009390876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    122   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB37271.1|  beta-ketoacyl-ACP synthase II                           122   6e-30   Cuphea wrightii
ref|XP_008784350.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    122   8e-30   Phoenix dactylifera
gb|ADE77460.1|  unknown                                                 119   8e-30   Picea sitchensis
gb|ACQ41833.1|  beta-ketoacyl-ACP synthase II                           122   8e-30   Elaeis oleifera
ref|XP_006452865.1|  hypothetical protein CICLE_v10007846mg             122   1e-29   Citrus clementina [clementine]
gb|KDO73811.1|  hypothetical protein CISIN_1g008146mg                   122   1e-29   Citrus sinensis [apfelsine]
ref|XP_006466136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    121   1e-29   Citrus sinensis [apfelsine]
emb|CDO97819.1|  unnamed protein product                                122   1e-29   Coffea canephora [robusta coffee]
gb|AAL91174.1|  putative 3-ketoacyl-ACP synthase                        121   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273891.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    122   1e-29   Nelumbo nucifera [Indian lotus]
gb|KDO45708.1|  hypothetical protein CISIN_1g0114931mg                  120   1e-29   Citrus sinensis [apfelsine]
emb|CDP03046.1|  unnamed protein product                                121   2e-29   Coffea canephora [robusta coffee]
ref|XP_010089666.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       121   2e-29   Morus notabilis
gb|AAM09292.1|  beta-ketoacyl-ACP synthase II                           117   2e-29   Elaeis oleifera
gb|ACN85392.1|  phosphoenolpyruvate carboxylase                         118   2e-29   Kosteletzkya pentacarpos [seashore mallow]
ref|XP_010273890.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    121   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006390366.1|  hypothetical protein EUTSA_v10018368mg             120   2e-29   Eutrema salsugineum [saltwater cress]
emb|CAC59946.1|  beta-ketoacyl-ACP synthase IV                          120   2e-29   Cuphea lanceolata
ref|XP_006466135.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    117   3e-29   
ref|XP_009104733.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    120   3e-29   Brassica rapa
emb|CDX68154.1|  BnaA07g21940D                                          120   3e-29   
ref|XP_011078136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    120   4e-29   Sesamum indicum [beniseed]
gb|AAB37270.1|  beta-ketoacyl-ACP synthase II                           119   5e-29   Cuphea wrightii
gb|KJB27216.1|  hypothetical protein B456_004G285300                    119   6e-29   Gossypium raimondii
ref|XP_008228351.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    120   6e-29   Prunus mume [ume]
ref|XP_009106152.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    119   8e-29   Brassica rapa
ref|XP_002889002.1|  hypothetical protein ARALYDRAFT_476635             119   9e-29   
gb|KHG11340.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    118   9e-29   Gossypium arboreum [tree cotton]
ref|XP_009128067.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    119   9e-29   Brassica rapa
ref|XP_010932371.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    119   1e-28   Elaeis guineensis
ref|XP_010932370.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    119   1e-28   Elaeis guineensis
gb|KDO45710.1|  hypothetical protein CISIN_1g0448241mg                  117   1e-28   Citrus sinensis [apfelsine]
ref|XP_006426725.1|  hypothetical protein CICLE_v10027447mg             118   1e-28   Citrus clementina [clementine]
gb|AAF61739.1|AF244520_1  beta-ketoacyl-ACP synthetase 2                118   1e-28   Brassica napus [oilseed rape]
emb|CDY45409.1|  BnaA07g31890D                                          119   1e-28   Brassica napus [oilseed rape]
emb|CDX73128.1|  BnaC06g35760D                                          118   2e-28   
ref|NP_565097.1|  3-oxoacyl-[acyl-carrier-protein] synthase II          118   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAD55280.1|AC008263_11  Similar to gb|AF060519 3-ketoacyl-ACP ...    118   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KJB82970.1|  hypothetical protein B456_013G222600                    117   3e-28   Gossypium raimondii
ref|XP_006466138.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    117   3e-28   
ref|XP_010428495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    118   3e-28   Camelina sativa [gold-of-pleasure]
emb|CDY46021.1|  BnaA02g17050D                                          117   3e-28   Brassica napus [oilseed rape]
ref|XP_008782980.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    117   4e-28   Phoenix dactylifera
ref|XP_006300437.1|  hypothetical protein CARUB_v10020101mg             117   4e-28   Capsella rubella
ref|XP_008782961.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    117   4e-28   Phoenix dactylifera
gb|KJB65355.1|  hypothetical protein B456_010G091400                    116   4e-28   Gossypium raimondii
ref|XP_008782971.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    117   4e-28   Phoenix dactylifera
ref|NP_001290396.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    117   5e-28   Camelina sativa [gold-of-pleasure]
emb|CDX85866.1|  BnaC06g22680D                                          117   5e-28   
ref|NP_001289900.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    117   5e-28   Camelina sativa [gold-of-pleasure]
gb|KHG18322.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    117   7e-28   Gossypium arboreum [tree cotton]
gb|AIL53811.1|  beta-ketoacyl-[acyl carrier protein] synthase II        117   8e-28   Gossypium hirsutum [American cotton]
gb|KJB82969.1|  hypothetical protein B456_013G222600                    117   8e-28   Gossypium raimondii
ref|XP_006843870.1|  hypothetical protein AMTR_s00007p00265100          117   9e-28   
gb|KHG11339.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    116   1e-27   Gossypium arboreum [tree cotton]
gb|ADK23940.1|  KASII                                                   115   2e-27   Gossypium hirsutum [American cotton]
gb|KHG27960.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    115   2e-27   Gossypium arboreum [tree cotton]
ref|XP_003557750.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    114   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_004169836.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    115   3e-27   
ref|XP_004144052.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    115   3e-27   Cucumis sativus [cucumbers]
gb|AIL53812.1|  beta-ketoacyl-[acyl carrier protein] synthase II        115   3e-27   Gossypium hirsutum [American cotton]
ref|XP_011072618.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    115   3e-27   
ref|XP_008450963.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    115   3e-27   Cucumis melo [Oriental melon]
ref|XP_011072620.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    115   4e-27   Sesamum indicum [beniseed]
ref|XP_006426741.1|  hypothetical protein CICLE_v10027240mg             114   4e-27   
tpg|DAA41443.1|  TPA: hypothetical protein ZEAMMB73_227409              111   4e-27   
gb|KJB65356.1|  hypothetical protein B456_010G091400                    115   5e-27   Gossypium raimondii
ref|XP_004305765.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    114   7e-27   Fragaria vesca subsp. vesca
ref|XP_007024704.1|  Fatty acid biosynthesis 1                          113   8e-27   
ref|XP_011467454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    114   8e-27   Fragaria vesca subsp. vesca
ref|XP_011467455.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    114   9e-27   Fragaria vesca subsp. vesca
tpg|DAA41444.1|  TPA: hypothetical protein ZEAMMB73_227409              111   9e-27   
ref|NP_001169617.1|  uncharacterized protein LOC100383498 precursor     113   1e-26   Zea mays [maize]
gb|KCW81914.1|  hypothetical protein EUGRSUZ_C03291                     113   1e-26   Eucalyptus grandis [rose gum]
ref|XP_010049368.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    113   1e-26   Eucalyptus grandis [rose gum]
ref|XP_004984084.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    112   1e-26   Setaria italica
gb|EMS61602.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    112   2e-26   Triticum urartu
ref|XP_002973275.1|  hypothetical protein SELMODRAFT_149056             112   2e-26   
ref|XP_002986735.1|  hypothetical protein SELMODRAFT_158169             112   2e-26   
gb|EMT21411.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    112   2e-26   
ref|XP_007024707.1|  Fatty acid biosynthesis 1                          112   2e-26   
dbj|BAJ91001.1|  predicted protein                                      112   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA84022.1|  beta-ketoacyl-ACP synthase                             112   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651481.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    111   3e-26   Oryza brachyantha
ref|XP_006658817.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    110   9e-26   
gb|EAZ42784.1|  hypothetical protein OsJ_27364                          110   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001768920.1|  predicted protein                                  109   1e-25   
gb|KDO45712.1|  hypothetical protein CISIN_1g037985mg                   110   1e-25   Citrus sinensis [apfelsine]
ref|NP_001060274.1|  Os07g0616200                                       110   2e-25   
gb|EAZ04708.1|  hypothetical protein OsI_26869                          110   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006426746.1|  hypothetical protein CICLE_v10025485mg             109   2e-25   
ref|XP_001773138.1|  predicted protein                                  109   4e-25   
gb|KJB34912.1|  hypothetical protein B456_006G090100                    108   5e-25   Gossypium raimondii
ref|XP_002463181.1|  hypothetical protein SORBIDRAFT_02g039230          108   6e-25   Sorghum bicolor [broomcorn]
gb|ACG25173.1|  3-oxoacyl-synthase I                                    108   6e-25   Zea mays [maize]
emb|CAA84023.1|  beta-ketoacyl-ACP synthase                             108   6e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132041.1|  uncharacterized protein LOC100193451 precursor     108   7e-25   Zea mays [maize]
ref|XP_009380020.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    108   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001768994.1|  predicted protein                                  108   9e-25   
ref|XP_008651372.1|  PREDICTED: uncharacterized protein LOC100280...    107   1e-24   
ref|XP_007514613.1|  predicted protein                                  108   1e-24   Bathycoccus prasinos
ref|XP_003562655.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    107   1e-24   
ref|XP_001763306.1|  predicted protein                                  106   3e-24   
ref|XP_002989269.1|  hypothetical protein SELMODRAFT_129433             104   7e-24   
ref|XP_002965643.1|  hypothetical protein SELMODRAFT_230708             104   8e-24   
ref|XP_006426733.1|  hypothetical protein CICLE_v10025676mg             102   7e-23   
ref|XP_010554926.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    100   5e-22   
gb|KEH37629.1|  3-oxoacyl-(acyl carrier) synthase II                  99.8    6e-22   Medicago truncatula
emb|CAN69528.1|  hypothetical protein VITISV_027246                   99.8    2e-21   Vitis vinifera
ref|XP_001421280.1|  predicted protein                                95.9    1e-20   Ostreococcus lucimarinus CCE9901
ref|XP_001421246.1|  predicted protein                                95.5    2e-20   Ostreococcus lucimarinus CCE9901
ref|XP_006597884.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  95.9    2e-20   Glycine max [soybeans]
ref|XP_003083296.1|  Animal-type fatty acid synthase and related ...  93.2    3e-19   Ostreococcus tauri
gb|KDO73815.1|  hypothetical protein CISIN_1g008146mg                 93.2    3e-19   Citrus sinensis [apfelsine]
ref|XP_002505037.1|  predicted protein                                92.0    3e-19   Micromonas commoda
ref|XP_002950994.1|  hypothetical protein VOLCADRAFT_104947           91.3    9e-19   Volvox carteri f. nagariensis
ref|XP_003060578.1|  predicted protein                                91.3    2e-18   Micromonas pusilla CCMP1545
ref|XP_009404185.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...  87.8    1e-17   
ref|XP_001700152.1|  3-ketoacyl-ACP-synthase                          87.4    2e-17   Chlamydomonas reinhardtii
ref|XP_011072621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  87.8    3e-17   
tpg|DAA41442.1|  TPA: hypothetical protein ZEAMMB73_227409            84.7    4e-17   
ref|XP_002961627.1|  hypothetical protein SELMODRAFT_230041           85.9    4e-17   
ref|XP_011398918.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...  85.9    7e-17   Auxenochlorella protothecoides
ref|XP_010917434.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  85.5    1e-16   Elaeis guineensis
ref|XP_011011532.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  85.1    1e-16   Populus euphratica
ref|XP_011096538.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  85.1    2e-16   Sesamum indicum [beniseed]
gb|KJB66778.1|  hypothetical protein B456_010G165600                  83.6    2e-16   Gossypium raimondii
ref|XP_010319078.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  81.6    2e-16   
gb|KJB66775.1|  hypothetical protein B456_010G165600                  83.6    2e-16   Gossypium raimondii
ref|XP_004984083.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  85.1    2e-16   
gb|KHG12491.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  84.7    2e-16   Gossypium arboreum [tree cotton]
gb|KJB57278.1|  hypothetical protein B456_009G156400                  84.7    2e-16   Gossypium raimondii
gb|KHN28969.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  82.8    2e-16   Glycine soja [wild soybean]
ref|XP_002305334.1|  3-oxoacyl-[acyl-carrier-protein] synthase I      84.7    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002960175.1|  hypothetical protein SELMODRAFT_229853           84.3    2e-16   
ref|XP_002519707.1|  50 kDa ketoavyl-ACP synthase                     84.3    3e-16   
ref|XP_002964698.1|  hypothetical protein SELMODRAFT_230451           83.6    4e-16   
ref|XP_011012842.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  84.0    4e-16   Populus euphratica
ref|NP_001152921.1|  uncharacterized protein LOC100279917             82.4    4e-16   
ref|WP_006340838.1|  3-oxoacyl-ACP synthase                           83.6    4e-16   Parachlamydia acanthamoebae
gb|KHG12107.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  84.0    5e-16   Gossypium arboreum [tree cotton]
ref|XP_002316735.1|  3-oxoacyl-[acyl-carrier-protein] synthase I      83.6    5e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010932374.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  84.0    5e-16   Elaeis guineensis
gb|KJB66777.1|  hypothetical protein B456_010G165600                  83.6    6e-16   Gossypium raimondii
gb|AFW88073.1|  hypothetical protein ZEAMMB73_812704                  83.6    7e-16   
gb|AAC04691.1|  beta-ketoacyl-ACP synthase I                          83.2    8e-16   Perilla frutescens [beefsteak-mint]
ref|XP_005642959.1|  3-ketoacyl-ACP-synthase                          82.8    9e-16   Coccomyxa subellipsoidea C-169
ref|XP_006467495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.8    1e-15   Citrus sinensis [apfelsine]
gb|AFW88075.1|  hypothetical protein ZEAMMB73_812704                  82.8    1e-15   
gb|AGH32916.1|  ketoacyl-ACP synthase I                               82.4    1e-15   Camellia chekiangoleosa
ref|XP_004293525.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.4    1e-15   Fragaria vesca subsp. vesca
ref|XP_010917436.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.4    2e-15   Elaeis guineensis
ref|XP_010241300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.4    2e-15   Nelumbo nucifera [Indian lotus]
gb|KIZ02816.1|  hypothetical protein MNEG_5138                        80.1    2e-15   Monoraphidium neglectum
ref|WP_032125192.1|  3-oxoacyl-ACP synthase                           81.6    2e-15   Candidatus Protochlamydia massiliensis
ref|XP_011085258.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  82.0    2e-15   Sesamum indicum [beniseed]
ref|XP_010052073.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  81.6    3e-15   Eucalyptus grandis [rose gum]
ref|XP_001762048.1|  predicted protein                                81.3    3e-15   
ref|XP_009627828.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  81.3    4e-15   Nicotiana tomentosiformis
ref|XP_009763087.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  81.3    4e-15   Nicotiana sylvestris
ref|WP_042103505.1|  3-oxoacyl-ACP synthase                           80.9    4e-15   Parachlamydiaceae bacterium HS-T3
gb|KHN25892.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  81.6    4e-15   Glycine soja [wild soybean]
dbj|BAK03950.1|  predicted protein                                    80.9    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA07910.1|  plastid 3-ketoacyl-ACP synthase I                     80.9    4e-15   Cuphea avigera var. pulcherrima
ref|XP_004975743.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.9    4e-15   
ref|XP_004975742.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.9    4e-15   Setaria italica
ref|XP_006845316.1|  hypothetical protein AMTR_s00141p00029880        80.9    4e-15   Amborella trichopoda
ref|XP_004147414.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.9    5e-15   Cucumis sativus [cucumbers]
ref|XP_002969875.1|  hypothetical protein SELMODRAFT_171238           80.5    5e-15   
gb|ABJ90468.1|  beta-ketoacyl-ACP synthase I                          80.9    5e-15   Jatropha curcas
emb|CAN81160.1|  hypothetical protein VITISV_012302                   80.9    5e-15   Vitis vinifera
gb|KDP37953.1|  hypothetical protein JCGZ_04596                       80.9    6e-15   Jatropha curcas
ref|XP_001776124.1|  predicted protein                                80.5    6e-15   
ref|XP_010481467.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.5    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004233105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.1    8e-15   Solanum lycopersicum
ref|XP_008225453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.1    8e-15   Prunus mume [ume]
ref|XP_007211401.1|  hypothetical protein PRUPE_ppa005228mg           80.1    9e-15   Prunus persica
ref|WP_039384131.1|  3-oxoacyl-ACP synthase                           79.7    9e-15   Neochlamydia sp. TUME1
ref|XP_008349175.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.1    1e-14   
ref|XP_008383499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  80.1    1e-14   
ref|XP_008784346.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  79.7    1e-14   Phoenix dactylifera
ref|XP_002863412.1|  kas I                                            79.7    1e-14   Arabidopsis lyrata subsp. lyrata
ref|NP_001032018.1|  beta-ketoacyl-[acyl carrier protein] synthase I  79.3    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ00014.1|  hypothetical protein OsI_22012                        78.2    1e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_010529153.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  79.7    1e-14   Tarenaya hassleriana [spider flower]
emb|CBI30851.3|  unnamed protein product                              79.3    1e-14   Vitis vinifera
ref|XP_010932377.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  79.7    1e-14   Elaeis guineensis
gb|AAC49118.1|  3-ketoacyl-acyl carrier protein synthase I            79.7    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199441.1|  beta-ketoacyl-[acyl carrier protein] synthase I     79.7    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAF23962.1|  probable beta-ketoacyl-ACP synthetase                79.3    1e-14   
ref|XP_006280411.1|  hypothetical protein CARUB_v10026344mg           79.7    1e-14   
ref|XP_010441599.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  79.7    1e-14   
ref|WP_042282680.1|  3-oxoacyl-ACP synthase                           79.3    1e-14   
ref|XP_006449664.1|  hypothetical protein CICLE_v10015139mg           79.7    1e-14   
ref|WP_039359465.1|  3-oxoacyl-ACP synthase                           79.3    1e-14   
gb|KHG22354.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  79.3    2e-14   
ref|XP_005847731.1|  hypothetical protein CHLNCDRAFT_31085            79.0    2e-14   
emb|CAN70157.1|  hypothetical protein VITISV_030014                   79.3    2e-14   
gb|EMS48560.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  78.2    2e-14   
ref|WP_036784408.1|  3-oxoacyl-ACP synthase                           79.0    2e-14   
ref|XP_006398324.1|  hypothetical protein EUTSA_v10000874mg           79.3    2e-14   
ref|XP_002272874.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  79.0    2e-14   
gb|EYU43272.1|  hypothetical protein MIMGU_mgv1a005817mg              79.0    2e-14   
ref|XP_010495756.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  79.3    2e-14   
ref|XP_009391220.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  78.6    3e-14   
gb|KFK31480.1|  hypothetical protein AALP_AA6G117600                  78.6    3e-14   
ref|NP_001149639.1|  3-oxoacyl-synthase I                             78.6    3e-14   
ref|XP_009101526.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  78.6    3e-14   
emb|CDY33467.1|  BnaA06g36060D                                        78.6    3e-14   
ref|WP_028522123.1|  3-oxoacyl-ACP synthase                           78.2    3e-14   
ref|NP_001238610.1|  beta-ketoacyl-ACP synthetase I                   78.6    4e-14   
ref|NP_001237654.1|  beta-ketoacyl-ACP synthetase I-2                 78.6    4e-14   
ref|XP_001696161.1|  hypothetical protein CHLREDRAFT_181037           75.1    4e-14   
gb|EAY94286.1|  hypothetical protein OsI_16057                        78.2    4e-14   
ref|NP_001052904.1|  Os04g0445700                                     78.2    4e-14   
emb|CAH67240.1|  OSIGBa0140O07.8                                      78.2    4e-14   
ref|XP_009128853.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  78.2    4e-14   
dbj|BAH00228.1|  unnamed protein product                              78.2    4e-14   
ref|XP_010666593.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  78.2    5e-14   
gb|EAZ30871.1|  hypothetical protein OsJ_14945                        77.8    5e-14   
emb|CAD40964.2|  OSJNBa0027P08.14                                     77.8    5e-14   
gb|KJB27220.1|  hypothetical protein B456_004G285300                  78.2    5e-14   
emb|CDX77646.1|  BnaC07g19000D                                        78.2    5e-14   
ref|XP_010538529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  78.2    5e-14   
gb|KEH43811.1|  3-oxoacyl-(acyl carrier) synthase II                  78.2    5e-14   
gb|ADE76842.1|  unknown                                               78.2    5e-14   
ref|XP_005715183.1|  Beta-ketoacyl synthase                           75.9    5e-14   
ref|XP_008783167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  78.2    5e-14   
ref|XP_009360871.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  77.8    5e-14   
ref|WP_044209545.1|  3-oxoacyl-ACP synthase                           77.4    6e-14   
ref|XP_010275024.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  77.8    6e-14   
ref|NP_001146139.1|  uncharacterized protein LOC100279707             77.4    7e-14   
ref|XP_006365563.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  77.4    7e-14   
gb|AFK43304.1|  unknown                                               77.4    7e-14   
ref|XP_004161144.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...  77.4    7e-14   
gb|AFW85455.1|  hypothetical protein ZEAMMB73_016804                  77.4    7e-14   
ref|XP_010915981.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  77.8    7e-14   
ref|XP_007158937.1|  hypothetical protein PHAVU_002G194300g           77.4    7e-14   
emb|CDY43962.1|  BnaA02g24400D                                        77.4    8e-14   
ref|XP_004504688.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  77.4    8e-14   
emb|CDY03228.1|  BnaC09g19280D                                        77.4    8e-14   
emb|CDY35156.1|  BnaA09g17930D                                        77.4    8e-14   
ref|WP_042239744.1|  3-oxoacyl-ACP synthase                           77.0    8e-14   
gb|KIC73224.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  77.0    9e-14   
ref|XP_011078137.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  77.4    9e-14   
ref|XP_002438009.1|  hypothetical protein SORBIDRAFT_10g006430        77.0    1e-13   
gb|KCW75931.1|  hypothetical protein EUGRSUZ_D00305                   77.0    1e-13   
gb|KEH21263.1|  3-oxoacyl-[acyl-carrier] synthase I                   76.6    1e-13   
ref|XP_008444105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  76.6    1e-13   
ref|XP_004987019.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  76.6    1e-13   
gb|ACC64615.1|  beta ketoacyl-ACP synthase I                          74.3    2e-13   
ref|XP_006653452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  76.6    2e-13   
ref|XP_007025113.1|  3-ketoacyl-acyl carrier protein synthase I i...  76.6    2e-13   
ref|XP_004244796.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  76.3    2e-13   
ref|XP_007509323.1|  predicted protein                                76.3    2e-13   
emb|CDP06309.1|  unnamed protein product                              76.3    2e-13   
ref|WP_026776275.1|  3-oxoacyl-ACP synthase                           75.9    2e-13   
gb|AGJ84410.1|  beta-ketoacyl-ACP synthase I                          76.3    2e-13   
gb|EYU26414.1|  hypothetical protein MIMGU_mgv1a024999mg              75.9    2e-13   
ref|XP_008371590.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  76.3    2e-13   
gb|ABR18442.1|  unknown                                               76.3    2e-13   
ref|XP_009114364.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.9    2e-13   
sp|P23902.1|KASC1_HORVU  RecName: Full=3-oxoacyl-[acyl-carrier-pr...  75.9    3e-13   
ref|XP_009596105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.9    3e-13   
ref|XP_004959862.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.9    3e-13   
dbj|GAL74223.1|  3-oxoacyl-[acyl-carrier-protein] synthase            73.9    3e-13   
ref|XP_009801210.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.9    3e-13   
gb|ABM53471.1|  plastid 3-keto-acyl-ACP synthase I                    75.9    3e-13   
gb|KDD75769.1|  beta-ketoacyl synthase                                75.9    3e-13   
gb|ACJ07141.1|  beta-ketoacyl-ACP synthase I-2                        75.9    3e-13   
gb|ACJ07140.1|  beta-ketoacyl-ACP synthase I-1                        75.9    3e-13   
gb|ACZ06069.1|  beta-ketoacyl-ACP synthetase I                        75.9    3e-13   
ref|WP_014465424.1|  beta-ketoacyl synthase                           75.5    3e-13   
gb|KEH21260.1|  3-oxoacyl-(acyl carrier) synthase II                  75.5    4e-13   
ref|WP_008337321.1|  beta-ketoacyl synthase                           75.1    4e-13   
ref|WP_044637747.1|  3-oxoacyl-ACP synthase                           75.1    4e-13   
ref|XP_006366097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.5    4e-13   
ref|XP_002463312.1|  hypothetical protein SORBIDRAFT_02g041620        75.5    4e-13   
ref|XP_009401483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  75.1    5e-13   
ref|WP_044221706.1|  3-oxoacyl-ACP synthase                           74.7    5e-13   
ref|WP_034042550.1|  3-oxoacyl-ACP synthase                           74.7    5e-13   
ref|WP_020530211.1|  3-oxoacyl-ACP synthase                           74.7    5e-13   
gb|EPJ32670.1|  beta-ketoacyl synthase, C-terminal domain protein     72.4    6e-13   
ref|WP_007647142.1|  3-oxoacyl-[acyl-carrier-protein] synthase, K...  74.7    6e-13   
ref|WP_017258002.1|  3-oxoacyl-ACP synthase                           74.7    6e-13   
ref|XP_004964587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  74.7    7e-13   
ref|WP_013869582.1|  3-oxoacyl-ACP synthase                           74.3    7e-13   
ref|XP_003608492.1|  Beta-ketoacyl-ACP synthase I                     74.7    8e-13   
ref|WP_028891430.1|  3-oxoacyl-ACP synthase                           74.3    9e-13   
ref|NP_001190479.1|  beta-ketoacyl-[acyl carrier protein] synthase I  74.3    9e-13   
ref|WP_041495307.1|  3-oxoacyl-ACP synthase                           73.9    9e-13   
ref|XP_003579824.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  74.3    9e-13   
gb|EPJ19371.1|  beta-ketoacyl-acyl-carrier-protein synthase II        72.0    9e-13   
ref|XP_006656734.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  74.3    1e-12   
gb|AJG14985.1|  3-oxoacyl-(acyl carrier protein) synthase II          73.9    1e-12   
gb|EAZ36138.1|  hypothetical protein OsJ_20447                        73.9    1e-12   
ref|NP_001057053.1|  Os06g0196600                                     73.9    1e-12   
ref|WP_034918019.1|  3-oxoacyl-ACP synthase                           73.6    1e-12   
ref|WP_006796644.1|  3-oxoacyl-ACP synthase                           73.6    1e-12   
gb|ADP97974.1|  3-oxoacyl-(acyl-carrier-protein) synthase II          72.0    1e-12   
ref|WP_019386858.1|  3-oxoacyl-ACP synthase                           73.6    2e-12   
gb|AGV54408.1|  beta-ketoacyl-ACP synthetase I                        73.6    2e-12   
dbj|GAK88469.1|  3-oxoacyl-[acyl-carrier-protein] synthase            72.0    2e-12   
ref|XP_002299456.1|  hypothetical protein POPTR_0001s10890g           73.6    2e-12   
ref|WP_034887056.1|  3-oxoacyl-ACP synthase                           73.2    2e-12   
ref|WP_020897534.1|  3-oxoacyl-[acyl-carrier-protein] synthase, K...  73.2    2e-12   
ref|WP_036582803.1|  3-oxoacyl-ACP synthase                           73.2    2e-12   
ref|WP_042245521.1|  3-oxoacyl-ACP synthase                           73.2    2e-12   
ref|WP_015361897.1|  3-oxoacyl-(Acyl-carrier-protein) synthase II     72.8    2e-12   
ref|XP_011026849.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  73.2    2e-12   
ref|WP_028887383.1|  3-oxoacyl-ACP synthase                           72.8    3e-12   
ref|WP_026950185.1|  3-oxoacyl-ACP synthase                           72.8    3e-12   
ref|WP_029532588.1|  3-oxoacyl-ACP synthase                           70.9    3e-12   
ref|WP_020370551.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...  72.8    3e-12   
ref|WP_025537670.1|  3-oxoacyl-ACP synthase                           72.4    3e-12   
ref|XP_004503596.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  72.8    3e-12   
ref|WP_042504040.1|  3-oxoacyl-ACP synthase                           72.4    4e-12   
ref|WP_042499496.1|  3-oxoacyl-ACP synthase                           72.4    4e-12   
ref|WP_027137964.1|  3-oxoacyl-ACP synthase                           72.4    4e-12   
ref|WP_015481382.1|  3-oxoacyl-ACP synthase                           72.4    4e-12   
ref|XP_008342506.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  68.6    4e-12   
ref|WP_027127619.1|  3-oxoacyl-ACP synthase                           72.0    5e-12   
gb|ACO77709.1|  Beta-ketoacyl-acyl carrier protein synthase           72.0    5e-12   
ref|WP_044400943.1|  3-oxoacyl-ACP synthase                           72.0    5e-12   
gb|ABQ79922.1|  3-oxoacyl-[acyl-carrier-protein] synthase II          72.0    5e-12   
ref|WP_008637813.1|  3-oxoacyl-ACP synthase                           71.6    6e-12   
ref|XP_001762687.1|  predicted protein                                72.0    6e-12   
ref|WP_014945306.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
gb|KJF43237.1|  3-oxoacyl-ACP synthase                                71.6    7e-12   
ref|XP_005843858.1|  hypothetical protein CHLNCDRAFT_27559            72.0    7e-12   
ref|WP_006343509.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
ref|WP_014859697.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
ref|WP_003247162.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
ref|WP_006344425.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
gb|KDO39747.1|  hypothetical protein CISIN_1g0457892mg                68.6    7e-12   
ref|WP_028690991.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
ref|WP_037318135.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
ref|WP_011097353.1|  3-oxoacyl-ACP synthase                           71.6    7e-12   
ref|WP_042730330.1|  3-oxoacyl-ACP synthase                           68.6    8e-12   
ref|WP_011006808.1|  3-oxoacyl-ACP synthase                           71.2    8e-12   
ref|XP_003061616.1|  predicted protein                                71.6    8e-12   
ref|WP_029033085.1|  3-oxoacyl-ACP synthase                           71.2    8e-12   
gb|AFK67803.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2           71.2    9e-12   
ref|XP_009337174.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  71.6    9e-12   
ref|WP_022246513.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2      71.2    1e-11   
ref|WP_011532888.1|  3-oxoacyl-ACP synthase                           71.2    1e-11   
ref|WP_016715142.1|  MULTISPECIES: 3-oxoacyl-ACP synthase             71.2    1e-11   
ref|WP_042276431.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
ref|WP_038826030.1|  3-oxoacyl-ACP synthase                           68.2    1e-11   
ref|WP_026808585.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
emb|CDF92623.1|  3-oxoacyl-[acyl-carrier-protein] synthase, KASII     70.9    1e-11   
emb|CDI91361.1|  3-oxoacyl-(acyl carrier protein) synthase II         68.2    1e-11   
dbj|GAF02741.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2          68.6    1e-11   
ref|WP_029038080.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
ref|WP_023379409.1|  MULTISPECIES: 3-oxoacyl-(acyl carrier protei...  70.9    1e-11   
ref|WP_033727594.1|  3-oxoacyl-ACP synthase                           70.5    1e-11   
ref|WP_028607173.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
ref|WP_024740041.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
ref|WP_013182436.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
ref|WP_036120415.1|  3-oxoacyl-ACP synthase                           70.9    1e-11   
gb|AAC78479.1|  3-oxoacyl-[acyl-carrier-protein] synthase             70.9    1e-11   
ref|WP_009389641.1|  3-oxoacyl-ACP synthase                           70.5    2e-11   
ref|WP_044631431.1|  3-oxoacyl-ACP synthase                           70.5    2e-11   
ref|WP_037011758.1|  3-oxoacyl-ACP synthase                           70.1    2e-11   
gb|KIX21173.1|  3-oxoacyl-ACP synthase                                70.1    2e-11   
ref|WP_012811662.1|  beta-ketoacyl synthase                           70.1    2e-11   
ref|WP_044625455.1|  3-oxoacyl-ACP synthase                           70.1    2e-11   
ref|WP_023533084.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...  70.1    2e-11   
ref|WP_020594054.1|  hypothetical protein                             70.1    2e-11   
gb|AHF68615.1|  3-oxoacyl-(acyl carrier protein) synthase II          70.1    2e-11   
ref|XP_006852603.1|  hypothetical protein AMTR_s00021p00221400        68.9    3e-11   
ref|WP_025338216.1|  3-oxoacyl-ACP synthase                           70.1    3e-11   
ref|WP_027596081.1|  3-oxoacyl-ACP synthase                           70.1    3e-11   
ref|WP_021784984.1|  MULTISPECIES: 3-oxoacyl-ACP synthase             70.1    3e-11   
gb|EPS68881.1|  hypothetical protein M569_05881                       70.1    3e-11   
ref|WP_026961188.1|  beta-ketoacyl synthase                           69.7    3e-11   
ref|WP_040252663.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_014591924.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_023578036.1|  beta-ketoacyl synthase                           69.7    3e-11   
ref|WP_018279822.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
gb|ERO57749.1|  3-oxoacyl-[acyl-carrier-protein] synthase             68.2    3e-11   
ref|WP_015269411.1|  MULTISPECIES: 3-oxoacyl-(acyl carrier protei...  69.7    3e-11   
ref|WP_012271164.1|  MULTISPECIES: 3-oxoacyl-ACP synthase             69.7    3e-11   
gb|EMS61772.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  68.9    3e-11   
ref|WP_042006130.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_033700571.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_026913788.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
emb|CDX87726.1|  BnaC02g32230D                                        70.1    3e-11   
ref|WP_004569248.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_031766870.1|  3-oxoacyl-ACP synthase                           67.8    3e-11   
ref|WP_010952938.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_011457720.1|  3-oxoacyl-ACP synthase                           69.7    3e-11   
ref|WP_040279486.1|  3-oxoacyl-ACP synthase                           69.7    4e-11   
ref|WP_026993414.1|  3-oxoacyl-ACP synthase                           69.7    4e-11   
gb|EDP61828.1|  Beta-ketoacyl synthase                                69.3    4e-11   
ref|WP_026811889.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|WP_022308345.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2      69.3    4e-11   
ref|WP_034666472.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|WP_025616438.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
gb|EMS48559.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...  69.7    4e-11   
ref|XP_005643461.1|  3-oxoacyl-synth                                  69.7    4e-11   
ref|WP_041578505.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|WP_018992330.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|XP_011398280.1|  3-oxoacyl-[acyl-carrier-protein] synthase I,...  69.3    4e-11   
ref|WP_010520288.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|WP_026975410.1|  beta-ketoacyl synthase                           69.3    4e-11   
ref|WP_033959403.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|WP_028633630.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
ref|WP_027718279.1|  3-oxoacyl-ACP synthase                           69.3    4e-11   
gb|ADF50639.1|  3-oxoacyl-[acyl-carrier-protein] synthase II          69.3    4e-11   



>gb|AAW31716.1| plastid beta-ketoacyl ACP synthase [Betula pendula]
Length=177

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  42   AGVILCIEKALARSGVSKEDVNYINAHATSTPAGDLKEYQALIHCFGQNPELRVNSTKSM  101

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAGAVEA AA+ AI  GW  PN     PDEG+     LVG KKERLDIK AL N
Sbjct  102  TGHLLGAAGAVEAVAAVQAIRTGWVHPNINLENPDEGV-DTNVLVGSKKERLDIKVALSN  160

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  161  SFGFGGHNSSIIFA  174



>ref|XP_007154557.1| hypothetical protein PHAVU_003G128700g [Phaseolus vulgaris]
 gb|ESW26551.1| hypothetical protein PHAVU_003G128700g [Phaseolus vulgaris]
Length=489

 Score =   136 bits (342),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNYINA A  TP GDLKEY A+I CFG N  LK+N  KS 
Sbjct  354  AGVILCIEKALAQSGISKEDVNYINAHATSTPAGDLKEYQALIHCFGQNPELKVNSTKSM  413

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A + AI  GW  PN     PD+G+   R LVG KKERLDIK AL N
Sbjct  414  IGHLLGAAGGVEAVATVQAIKRGWVHPNINLENPDKGVD-ARVLVGSKKERLDIKAALSN  472

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  473  SFGFGGHNSSIIFA  486



>ref|XP_009345512.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=330

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL+ SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  195  AGVILCIEKALEQSGVPREDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRVNSTKSM  254

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AA+ AI  GW  PN     PDEG+   + LVG KKERLD+K AL N
Sbjct  255  IGHLLGASGAVEAVAAVQAIRTGWIHPNINLENPDEGMD-TKLLVGPKKERLDVKVALSN  313

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  314  SFGFGGHNSSVLFA  327



>ref|XP_007204195.1| hypothetical protein PRUPE_ppa003597mg [Prunus persica]
 gb|EMJ05394.1| hypothetical protein PRUPE_ppa003597mg [Prunus persica]
Length=563

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 83/134 (62%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  428  AGVILCIEKALAQSGVSREDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRVNSTKSM  487

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA AA+ AI  GW  PN     PDEG+   + LVG KKERLDIK AL N
Sbjct  488  IGHLLGAAGAVEAVAAVQAIRTGWIHPNINLENPDEGVD-TKLLVGPKKERLDIKVALSN  546

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  547  SFGFGGHNSSVLFA  560



>ref|XP_008338300.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
Length=563

 Score =   134 bits (336),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL+ SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  428  AGVILCIEKALEQSGVSREDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRVNSTKSM  487

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AA+ AI  GW  PN     PDEG+   + LVG KKERLD+K AL N
Sbjct  488  IGHLLGASGAVEAVAAVQAIRTGWIHPNINLENPDEGMD-TKLLVGPKKERLDVKVALSN  546

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  547  SFGFGGHNSSILFA  560



>ref|XP_009337172.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337173.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=562

 Score =   134 bits (336),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL+ SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  427  AGVILCIEKALEQSGVPREDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRVNSTKSM  486

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AA+ AI  GW  PN     PDEG+   + LVG KKERLD+K AL N
Sbjct  487  IGHLLGASGAVEAVAAVQAIRTGWIHPNINLENPDEGMD-TKLLVGPKKERLDVKVALSN  545

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  546  SFGFGGHNSSVLFA  559



>ref|XP_008337819.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
 ref|XP_008337821.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Malus domestica]
Length=558

 Score =   133 bits (335),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 82/134 (61%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL+ SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  423  AGVILCIEKALEQSGVSREDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRVNSTKSM  482

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA AA+ AI  GW  PN     PDEG+   + LVG KKERLD+K AL N
Sbjct  483  IGHLLGAAGAVEAVAAVQAIRTGWIHPNINLENPDEGVD-TKLLVGPKKERLDVKVALSN  541

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  542  SFGFGGHNSSVLFA  555



>ref|XP_006600238.1| PREDICTED: beta-ketoacyl-ACP synthetase 2 isoform X1 [Glycine 
max]
 gb|AAW88763.1| plastid 3-keto-acyl-ACP synthase II-A [Glycine max]
Length=488

 Score =   132 bits (332),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  354  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALMHCFGQNPELRVNSTKSM  413

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A I AI  GW  PN     PD G+   + LVG KKERLD+K AL N
Sbjct  414  IGHLLGAAGGVEAVATIQAIRTGWVHPNINLENPDNGVD-AKVLVGSKKERLDVKAALSN  472

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  473  SFGFGGHNSSIIFA  486



>gb|KHN17744.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Glycine 
soja]
Length=703

 Score =   134 bits (337),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  569  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALMHCFGQNPELRVNSTKSM  628

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A I AI  GW  PN     PD G+   + LVG KKERLD+K AL N
Sbjct  629  IGHLLGAAGGVEAVATIQAIRTGWVHPNINLENPDNGVD-AKVLVGSKKERLDVKAALSN  687

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  688  SFGFGGHNSSIIFA  701



>ref|NP_001235052.1| beta-ketoacyl-ACP synthetase 2 precursor [Glycine max]
 gb|AAF61737.1|AF244518_1 beta-ketoacyl-ACP synthetase 2 [Glycine max]
Length=488

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  354  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALMHCFGQNPELRVNLTKSM  413

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A I AI  GW  PN     PD G+   + LVG KKERLD+K AL N
Sbjct  414  IGHLLGAAGGVEAVATIQAIRTGWVHPNINLENPDNGVD-AKVLVGSKKERLDVKAALSN  472

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  473  SFGFGGHNSSIIFA  486



>ref|XP_004488123.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cicer arietinum]
Length=484

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  LK+N  KS 
Sbjct  349  AGVILCIEKALANSGVSREDVNYINAHATSTPAGDLKEYQALIHCFGQNPELKVNSTKSM  408

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A I AI  GW  PN     PDE +     LVG KKERLDIK  L N
Sbjct  409  IGHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEAVD-TNVLVGAKKERLDIKAGLSN  467

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  468  SFGFGGHNSSIIFA  481



>ref|XP_010104609.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
 gb|EXC01340.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
Length=484

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP  DLKEY AI RCFG N  L++N  KS I
Sbjct  350  GIALCIEKALALSGVAREDVNYINAHAASTPIADLKEYQAITRCFGNNPNLRVNSTKSMI  409

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PDEG+     LVG KKERLDIK AL N 
Sbjct  410  GHLLGASGAVEAVATVKAIQTGWVHPNINLENPDEGM-DMNVLVGTKKERLDIKIALSNT  468

Query  40   FGFGGXNFXXXFA  2
            F FGG N    FA
Sbjct  469  FAFGGQNSSIVFA  481



>ref|XP_011039936.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
Length=548

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG NS L++N  KS 
Sbjct  413  AGVILCVEKALAQSGVAKEDVNYINAHATSTPAGDLKEYNALMHCFGRNSGLRVNSTKSM  472

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AA+ AI  GW  PN     PD+G+     LVG KKERLDIK AL N
Sbjct  473  IGHLLGASGAVEAIAAVQAIRTGWVHPNINLENPDQGMD-TSVLVGPKKERLDIKAALSN  531

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  532  SFGFGGHNSSIIFA  545



>gb|ACJ07142.1| beta-ketoacyl-ACP synthase II-1 [Arachis hypogaea]
Length=548

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 78/134 (58%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKE+ A++ CFG N  L++N  KS 
Sbjct  413  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEFQALLHCFGQNPELRVNSTKSM  472

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A + AI  GW  PN     PD+G+   + LVG KKERLDIK AL N
Sbjct  473  IGHLLGAAGGVEAVATVQAIRTGWVHPNINLENPDQGVD-AKVLVGSKKERLDIKAALSN  531

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  532  SFGFGGHNSSIIFA  545



>gb|KEH37628.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=488

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNYINA A  TP GDLKEY A+I CFG N  LK+N  KS 
Sbjct  353  AGVILCIEKALANSGISKEDVNYINAHATSTPAGDLKEYQALIHCFGQNPELKVNSTKSM  412

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A I AI  GW  PN     PDE +     LVG KKERLDIK  L N
Sbjct  413  IGHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEAVD-TNVLVGSKKERLDIKAGLSN  471

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  472  SFGFGGHNSSIIFA  485



>ref|XP_011006167.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
 ref|XP_011006168.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
Length=549

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 80/133 (60%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SG+  EDVNYINA A  TP GDLKEY A++ CFG NS L++N  KS I
Sbjct  415  GVILCIEKALSQSGISKEDVNYINAHATSTPAGDLKEYQALMHCFGQNSGLRVNATKSMI  474

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     PD+G+     LVG KKERLDIK AL N 
Sbjct  475  GHLLGAAGAVEAIATIQAIRTGWVHPNINLENPDQGVD-TSVLVGPKKERLDIKAALSNS  533

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  534  FGFGGHNSSIIFA  546



>ref|XP_010498338.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=531

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +G+  EDVNYINA A  TP GDLKEY A+  CFG N  LKIN  KS 
Sbjct  396  AGVILCIEKALAHAGISKEDVNYINAHATSTPAGDLKEYQALAHCFGQNPELKINSTKSM  455

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A I AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  456  IGHLLGASGAVEAVATIQAIKTGWVHPNINLENPDKAV-DTKLLVGLKKERLDIKAALSN  514

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  515  SFGFGGHNSCIIFA  528



>ref|XP_006381576.1| FATTY ACID BIOSYNTHESIS 1 family protein [Populus trichocarpa]
 gb|ERP59373.1| FATTY ACID BIOSYNTHESIS 1 family protein [Populus trichocarpa]
Length=493

 Score =   131 bits (329),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 80/134 (60%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG NS L++N  KS 
Sbjct  358  AGVILCIEKALAQSGVAKEDVNYINAHATSTPAGDLKEYHALMHCFGRNSGLRVNSTKSM  417

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AA+ AI  GW  PN     P++G+     LVG KKERLDIK AL N
Sbjct  418  IGHLLGASGAVEAIAAVQAIRTGWVHPNINLENPEQGMD-TSVLVGPKKERLDIKAALSN  476

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  477  SFGFGGHNSSIIFA  490



>emb|CBI35831.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  EDVNYINA A  TP GDLKE+ A+IRCFG N  L++N  KS I
Sbjct  412  GVVLCIEKALAQAGVAREDVNYINAHATSTPSGDLKEFQALIRCFGQNPKLRVNSTKSMI  471

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PD+G+     LVG KKERLDIK AL N 
Sbjct  472  GHLLGASGAVEAVATVKAIQTGWVHPNINLENPDQGVD-TNLLVGSKKERLDIKVALSNS  530

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  531  FGFGGHNSSILFA  543



>ref|NP_001236069.1| plastid 3-keto-acyl-ACP synthase II-B precursor [Glycine max]
 ref|XP_006593310.1| PREDICTED: plastid 3-keto-acyl-ACP synthase II-B isoform X1 [Glycine 
max]
 gb|AAW88762.1| plastid 3-keto-acyl-ACP synthase II-B [Glycine max]
Length=489

 Score =   131 bits (329),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  354  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALMHCFGQNPKLRVNSTKSM  413

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN    KPD G+   + LVG KKERLD+K AL N
Sbjct  414  IGHLLGAAGAVEAVATIQAIRTGWVHPNINLEKPDNGVD-AKVLVGSKKERLDVKAALSN  472

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  473  SFGFGGHNSSIIFA  486



>gb|AGH32917.1| ketoacyl-ACP synthase II [Camellia chekiangoleosa]
Length=564

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+IRCFG NS L++N  KS I
Sbjct  430  GVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALIRCFGQNSELRVNSTKSMI  489

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG KKERLDIK AL N 
Sbjct  490  GHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDKGVD-TNVLVGPKKERLDIKVALSNS  548

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  549  FGFGGHNSSILFA  561



>gb|EPS66235.1| hypothetical protein M569_08544, partial [Genlisea aurea]
Length=215

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KA+  SGV  EDVNYINA A  TP GD+KEY AI+RCFG N  L++N  KS 
Sbjct  80   AGVILCMEKAVSQSGVSKEDVNYINAHATSTPAGDIKEYQAIVRCFGNNPELRVNSTKSM  139

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+   + LVG KKE++DI+ AL N
Sbjct  140  IGHLLGAAGAVEAVATVQAIRRGWIHPNINLEDPDRGVD-AKVLVGGKKEKVDIRVALSN  198

Query  43   XFGFGGXNFXXXFA  2
             +GFGG N    FA
Sbjct  199  SYGFGGQNSSILFA  212



>ref|XP_010654405.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Vitis vinifera]
Length=564

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  EDVNYINA A  TP GDLKE+ A+IRCFG N  L++N  KS I
Sbjct  430  GVVLCIEKALAQAGVAREDVNYINAHATSTPSGDLKEFQALIRCFGQNPKLRVNSTKSMI  489

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PD+G+     LVG KKERLDIK AL N 
Sbjct  490  GHLLGASGAVEAVATVKAIQTGWVHPNINLENPDQGVD-TNLLVGSKKERLDIKVALSNS  548

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  549  FGFGGHNSSILFA  561



>ref|XP_010477131.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=528

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +G+  ED+NYINA A  TP GDLKEY A+  CFG N  L+IN  KS 
Sbjct  393  AGVILCIEKALAHAGISKEDINYINAHATSTPAGDLKEYQALAHCFGQNPELRINSTKSM  452

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A I AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  453  IGHLLGASGAVEAVATIQAIKTGWVHPNVNLENPDKAV-DTKLLVGLKKERLDIKAALSN  511

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  512  SFGFGGHNSSIIFA  525



>ref|XP_010318480.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum lycopersicum]
Length=558

 Score =   131 bits (329),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 82/134 (61%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            +G  LC  KAL  SGVK EDVNYINA A  TP GDL EY AI+ CFG N  LKIN  KS 
Sbjct  421  SGVVLCIEKALAQSGVKREDVNYINAHAASTPAGDLNEYQAILHCFGKNPELKINSTKSM  480

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAGAVEA A + AI  GW  PN     PD GL     LVG KKERLDIK AL N
Sbjct  481  TGHLLGAAGAVEAIATVKAIHTGWIHPNINLENPDNGLD-MNVLVGSKKERLDIKVALSN  539

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  540  SFGFGGHNSSILFA  553



>ref|XP_006342938.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum tuberosum]
Length=561

 Score =   131 bits (329),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 82/134 (61%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            +G  LC  KAL  SGVK EDVNYINA A  TP GDL EY AI+ CFG N  LKIN  KS 
Sbjct  424  SGVVLCIEKALAQSGVKREDVNYINAHAASTPAGDLNEYQAILHCFGKNPELKINSTKSM  483

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAGAVEA A + AI  GW  PN     PD GL     LVG KKERLDIK AL N
Sbjct  484  TGHLLGAAGAVEAIATVKAIHTGWIHPNINLENPDNGLD-MNVLVGSKKERLDIKVALSN  542

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  543  SFGFGGHNSSILFA  556



>ref|XP_010459587.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=532

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +G+  ED+NYINA A  TP GDLKEY A+  CFG N  L+IN  KS 
Sbjct  397  AGVILCIEKALAHAGISKEDINYINAHATSTPAGDLKEYQALAHCFGQNPELRINSTKSM  456

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A I AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  457  IGHLLGASGAVEAVATIQAIKTGWVHPNINLENPDKAV-DTKLLVGLKKERLDIKAALSN  515

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  516  SFGFGGHNSSIIFA  529



>ref|XP_009359705.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=558

 Score =   130 bits (328),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 80/134 (60%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL+ SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  423  AGVILCIEKALEQSGVSREDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRVNSTKSM  482

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA AA+ AI  GW  PN     PDEG+   + LVG +KERLD+K AL N
Sbjct  483  IGHLLGAAGAVEAVAAVQAIRTGWIHPNINLENPDEGVD-TKLLVGLEKERLDVKVALSN  541

Query  43   XFGFGGXNFXXXFA  2
             FGF G N    FA
Sbjct  542  SFGFVGHNSSVLFA  555



>gb|AAC68860.1| 3-ketoacyl-ACP synthase [Cuphea avigera var. pulcherrima]
Length=546

 Score =   130 bits (328),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  LK+N  KS 
Sbjct  411  AGVILCIEKALAQSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRELKVNSTKSM  470

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA + + AI  GW  PN     PDEG+   + LVG KKERL++K  L N
Sbjct  471  IGHLLGAAGGVEAVSVVQAIRTGWIHPNINLENPDEGVD-TKLLVGPKKERLNVKVGLSN  529

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  530  SFGFGGHNSSILFA  543



>ref|XP_004508026.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cicer arietinum]
Length=507

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  LK+N  KS 
Sbjct  372  AGVKLCIEKALAQSGVSKEDVNYINAHATSTPAGDIKEYQALIHCFGQNPELKVNSTKSM  431

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+G VEA A + AI  GW  PN     PD+ +   + LVG KKERL+IK AL N
Sbjct  432  IGHLLGASGGVEAVATVQAIRTGWVHPNVNLENPDKEVD-AKVLVGAKKERLNIKAALSN  490

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  491  SFGFGGHNSSIIFA  504



>ref|XP_010047453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79359.1| hypothetical protein EUGRSUZ_C00778 [Eucalyptus grandis]
Length=558

 Score =   130 bits (327),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 80/133 (60%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  EDVNYINA A  TP GDLKEY A+  CF  NS LK+N  KS I
Sbjct  424  GVTLCIEKALAQAGVSREDVNYINAHATSTPAGDLKEYKALAHCFRENSELKVNSTKSMI  483

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+G+ P + LVG KKERLDIK AL N 
Sbjct  484  GHLLGAAGAVEAVAVVQAIRTGWVHPNVNLENPDKGVDPSK-LVGPKKERLDIKVALSNS  542

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  543  FGFGGHNSSILFA  555



>gb|KHN07879.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Glycine 
soja]
Length=469

 Score =   130 bits (326),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  334  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALMHCFGQNPKLRVNSTKSM  393

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN    KPD G+   + LVG KKERLD+K AL N
Sbjct  394  IGHLLGAAGAVEAVATIQAIRTGWVHPNINLEKPDNGVD-AKVLVGSKKERLDVKAALSN  452

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  453  SFGFGGHNSSIIFA  466



>ref|XP_006307215.1| hypothetical protein CARUB_v10008814mg [Capsella rubella]
 gb|EOA40113.1| hypothetical protein CARUB_v10008814mg [Capsella rubella]
Length=532

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            +G  LC  KAL  +G+  ED+NYINA A  TP GDLKEY A+  CFG N  L+IN  KS 
Sbjct  397  SGVILCIEKALAHAGISKEDINYINAHATSTPAGDLKEYQALAHCFGQNPELRINSTKSM  456

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A I AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  457  IGHLLGASGAVEAVATIQAIKTGWVHPNINLENPDKAV-DTKLLVGLKKERLDIKAALSN  515

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  516  SFGFGGHNSSIIFA  529



>ref|XP_010533238.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Tarenaya hassleriana]
Length=549

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +G+  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  414  AGVILCIEKALDQAGIPREDVNYINAHATSTPAGDLKEYQALVHCFGQNPELRVNSTKSM  473

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A + AI  GW  PN     PDEG+   + LVG KKERL+IK AL N
Sbjct  474  VGHLLGAAGAVEAIATVQAIRTGWVHPNINLENPDEGVD-TKLLVGSKKERLNIKAALSN  532

Query  43   XFGFGGXNFXXXF  5
             FGFGG N    F
Sbjct  533  SFGFGGHNSSIIF  545



>ref|XP_008242279.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Prunus mume]
Length=563

 Score =   129 bits (324),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  T  GDLKEY A+I CFG N  L++N  KS 
Sbjct  428  AGVILCIEKALAQSGVSREDVNYINAHATSTLAGDLKEYNALIHCFGQNPELRVNSTKSM  487

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA AA+ AI  GW  PN     PDEG+   + LVG KKERLD+K AL N
Sbjct  488  IGHLLGAAGAVEAVAAVQAIRTGWIHPNINLENPDEGVD-TKLLVGPKKERLDVKVALSN  546

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  547  SFGFGGHNSSVLFA  560



>ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
Length=554

 Score =   129 bits (323),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E+VNYINA A  TP GDLKEY A++RCF  N  L++N  KS I
Sbjct  420  GVILCIEKALARSGVSKEEVNYINAHATSTPAGDLKEYEALMRCFSQNPDLRVNSTKSMI  479

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     P+EG+   + LVG KKERLDIK AL N 
Sbjct  480  GHLLGAAGAVEAIATIQAIRTGWVHPNINLENPEEGVD-TKVLVGPKKERLDIKVALSNS  538

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  539  FGFGGHNSSIIFA  551



>gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis]
Length=535

 Score =   128 bits (322),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E+VNYINA A  TP GDLKEY A++RCF  N  L++N  KS I
Sbjct  401  GVILCIEKALARSGVSKEEVNYINAHATSTPAGDLKEYEALMRCFSQNPDLRVNSTKSMI  460

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     P+EG+   + LVG KKERLDIK AL N 
Sbjct  461  GHLLGAAGAVEAIATIQAIRTGWVHPNINLENPEEGVD-TKVLVGPKKERLDIKVALSNS  519

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  520  FGFGGHNSSIIFA  532



>ref|XP_006597888.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X7 [Glycine max]
Length=350

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  S +  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  212  GVILCMEKALNHSRISREDVNYINAHATSTPIGDLKEYKALIHCFGQNLELRVNSTKSMI  271

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG VEA A I AI  GW  PN     PDEG+     LVG KKE LDIK A+ N 
Sbjct  272  GHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEGV-DTNVLVGSKKETLDIKAAMSNS  330

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  331  FGFGGQNSSIIFA  343



>ref|XP_002893037.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69296.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  K L  +G+  ED+NYINA A  TP GDLKEY A   CFG N  L+IN  KS 
Sbjct  347  AGVILCIEKTLAHAGISKEDINYINAHATSTPAGDLKEYQAFAHCFGQNPELRINSTKSM  406

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A I AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  407  IGHLLGASGAVEAVATIQAIKTGWVHPNINLENPDKAV-DTKLLVGLKKERLDIKAALSN  465

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  466  SFGFGGHNSSIIFA  479



>ref|XP_006416523.1| hypothetical protein EUTSA_v10007353mg [Eutrema salsugineum]
 gb|ESQ34876.1| hypothetical protein EUTSA_v10007353mg [Eutrema salsugineum]
Length=527

 Score =   128 bits (322),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +G+  ED+NYINA A  TP GDLKEY A+  CFG N  L++N  KS 
Sbjct  392  AGVILCIEKALANAGISKEDINYINAHATSTPAGDLKEYNALAHCFGQNPELRVNSTKSM  451

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  452  IGHLLGASGAVEAVATVQAIKTGWVHPNINLENPDKAVN-TKLLVGLKKERLDIKAALSN  510

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  511  SFGFGGQNSSIIFA  524



>ref|XP_011460975.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=543

 Score =   128 bits (322),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 82/134 (61%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG   C  KAL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L+IN  KS 
Sbjct  408  AGVIQCIEKALVQSGVSKEDVNYINAHATSTPAGDLKEYNALIHCFGQNPELRINSTKSM  467

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA AA+ AI  GW  PN     PD+G+   + LVG KKERLDIK AL N
Sbjct  468  IGHLLGAAGAVEAVAAVQAIRTGWVHPNVNLEDPDKGVD-MKVLVGPKKERLDIKVALSN  526

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  527  SFGFGGHNSSVLFA  540



>ref|XP_006597887.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X6 [Glycine max]
Length=382

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  S +  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  244  GVILCMEKALNHSRISREDVNYINAHATSTPIGDLKEYKALIHCFGQNLELRVNSTKSMI  303

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG VEA A I AI  GW  PN     PDEG+     LVG KKE LDIK A+ N 
Sbjct  304  GHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEGV-DTNVLVGSKKETLDIKAAMSNS  362

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  363  FGFGGQNSSIIFA  375



>gb|EYU28306.1| hypothetical protein MIMGU_mgv1a004039mg [Erythranthe guttata]
Length=548

 Score =   128 bits (321),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+I CFG NS LK+N  KS I
Sbjct  414  GVILCVEKALAQSGVSKEDVNYINAHATSTPAGDLKEYEALIHCFGQNSELKVNSTKSMI  473

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PDE +     LVG  KERLDIK AL N 
Sbjct  474  GHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDERVD-MNVLVGPTKERLDIKVALSNS  532

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  533  FGFGGHNSSILFA  545



>ref|XP_010313772.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=477

 Score =   127 bits (319),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA    TP GDLKEY AI+ CFG N  L++N  KS 
Sbjct  342  AGVILCIEKALAQSGVSKEDVNYINAHGTSTPAGDLKEYQAIVHCFGQNPELRVNSTKSM  401

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PDEG+     LVG KKERLDIK A+ N
Sbjct  402  IGHLLGAAGAVEAVAIIQAIRTGWVHPNINLDTPDEGVD-TNVLVGSKKERLDIKVAISN  460

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  461  SFGFGGHNSSILFA  474



>ref|XP_006353782.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum tuberosum]
Length=540

 Score =   127 bits (320),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS I
Sbjct  406  GVILCVEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALVHCFGQNPELRVNSTKSMI  465

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     PDEG+     LVG KKERLDIK AL N 
Sbjct  466  GHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDEGVD-TNILVGPKKERLDIKVALSNS  524

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  525  FGFGGHNSSILFA  537



>gb|KEH32421.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=345

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  210  AGVILCIERALVQSGVSKEDVNYINAHATSTPSGDLKEYQALIHCFGKNPELRVNSTKSM  269

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+G VEA A + AI  GW  PN     PD+ +   + LVG  KERL IK AL N
Sbjct  270  IGHLLGASGGVEAVATVQAIRTGWVHPNINLENPDKDV-DTKVLVGPTKERLKIKAALSN  328

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  329  SFGFGGHNSSIVFA  342



>ref|XP_002324139.2| hypothetical protein POPTR_0018s07450g [Populus trichocarpa]
 gb|EEF02704.2| hypothetical protein POPTR_0018s07450g [Populus trichocarpa]
Length=554

 Score =   127 bits (319),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SG+  EDVNYINA A  TP GDLKEY A++ CFG NS L++N  KS I
Sbjct  420  GVILCIEKALSQSGISKEDVNYINAHATSTPAGDLKEYQALMHCFGQNSGLRVNATKSMI  479

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PD+G+     LVG KKERLDIK AL N 
Sbjct  480  GHLLGAAGAVEAIAAIQAIRTGWVHPNINLENPDQGVD-TSVLVGPKKERLDIKAALSNS  538

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  539  FGFGGHNSSIIFA  551



>ref|XP_004251704.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=526

 Score =   127 bits (319),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 81/134 (60%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA    TP GDLKEY AI+ CFG N  L++N  KS 
Sbjct  391  AGVILCIEKALAQSGVSKEDVNYINAHGTSTPAGDLKEYQAIVHCFGQNPELRVNSTKSM  450

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PDEG+     LVG KKERLDIK A+ N
Sbjct  451  IGHLLGAAGAVEAVAIIQAIRTGWVHPNINLDTPDEGVD-TNVLVGSKKERLDIKVAISN  509

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  510  SFGFGGHNSSILFA  523



>ref|XP_002276214.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
 ref|XP_010656091.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
Length=555

 Score =   127 bits (318),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  SGV  EDVNYINA A  T  GD +EY A++RCFG N  LK+N  KS 
Sbjct  420  AGVILCIESALARSGVSREDVNYINAHATSTLAGDFREYQALVRCFGQNPELKVNSTKSM  479

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     P+EG+     LVG KKERLDIK AL N
Sbjct  480  IGHLLGAAGAVEAIATIQAIRTGWVHPNINLESPEEGVDTD-LLVGSKKERLDIKVALSN  538

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  539  SFGFGGHNSSIIFA  552



>emb|CBI27767.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  SGV  EDVNYINA A  T  GD +EY A++RCFG N  LK+N  KS 
Sbjct  382  AGVILCIESALARSGVSREDVNYINAHATSTLAGDFREYQALVRCFGQNPELKVNSTKSM  441

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     P+EG+     LVG KKERLDIK AL N
Sbjct  442  IGHLLGAAGAVEAIATIQAIRTGWVHPNINLESPEEGVDTD-LLVGSKKERLDIKVALSN  500

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  501  SFGFGGHNSSIIFA  514



>gb|ABI18155.1| plastid 3-keto-acyl-ACP synthase II [Helianthus annuus]
Length=491

 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +GV+ EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS 
Sbjct  356  AGVILCIEKALSQAGVRREDVNYINAHATSTPAGDLKEYHALLHCFGNNQELRVNSTKSM  415

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD+G+   + LVG KKERL++K  L N
Sbjct  416  IGHLLGAAGAVEAVATVQAIRTGWIHPNINLENPDQGVD-TKVLVGSKKERLNVKVGLSN  474

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  475  SFGFGGHNSSILFA  488



>ref|XP_009587352.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=502

 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNYINA A  TP GDL+EY A++ CFG N  L++N  KS 
Sbjct  367  AGVILCIEKALAQSGISKEDVNYINAHATSTPAGDLREYQALVHCFGQNPELRVNSTKSM  426

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     P+EG+     LVG KKERLD+K AL N
Sbjct  427  IGHLLGAAGAVEAVATVQAIRSGWVHPNINLENPEEGVD-TNLLVGPKKERLDVKVALSN  485

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  486  SFGFGGHNSSILFA  499



>ref|XP_009771698.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nicotiana sylvestris]
Length=502

 Score =   126 bits (316),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDL+EY A++ CFG N  L++N  KS I
Sbjct  368  GVILCIEKALDQSGVSKEDVNYINAHATSTPAGDLREYQALVHCFGQNPELRVNSTKSMI  427

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     P+EG+     LVG KKERLDIK AL N 
Sbjct  428  GHLLGAAGAVEAVATVQAIRSGWVHPNINLENPEEGVD-TNLLVGAKKERLDIKVALSNS  486

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  487  FGFGGHNSSILFA  499



>gb|ACJ85772.1| unknown [Medicago truncatula]
Length=491

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  356  AGVILCIERALVQSGVSKEDVNYINAHATSTPSGDLKEYQALIHCFGKNPELRVNSTKSM  415

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+G VEA A + AI  GW  PN     PD+ +   + LVG  KERL IK AL N
Sbjct  416  IGHLLGASGGVEAVATVQAIRTGWVHPNINLENPDKDVD-TKVLVGPTKERLKIKAALSN  474

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  475  SFGFGGHNSSIVFA  488



>ref|XP_003609968.1| 3-oxoacyl-ACP synthase [Medicago truncatula]
 gb|AES92165.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=491

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS 
Sbjct  356  AGVILCIERALVQSGVSKEDVNYINAHATSTPSGDLKEYQALIHCFGKNPELRVNSTKSM  415

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+G VEA A + AI  GW  PN     PD+ +   + LVG  KERL IK AL N
Sbjct  416  IGHLLGASGGVEAVATVQAIRTGWVHPNINLENPDKDVD-TKVLVGPTKERLKIKAALSN  474

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  475  SFGFGGHNSSIVFA  488



>ref|XP_007012570.1| Fatty acid biosynthesis 1 isoform 5 [Theobroma cacao]
 gb|EOY30189.1| Fatty acid biosynthesis 1 isoform 5 [Theobroma cacao]
Length=461

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  ED+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  327  GVILCMEKALAQSGVSKEDINYINAHATSTPAGDIKEYQALMHCFGKNPELRVNSTKSMI  386

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  387  GHLLGAAGAVEAVAAIQAIRTGWVHPNVNLESPDEGVD-TNVLVGPKKERLNVKAALSNS  445

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  446  FGFGGHNSSIIFA  458



>ref|XP_006345248.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum tuberosum]
Length=532

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 80/134 (60%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA    TP GDLKEY AI+ CFG N  L++N  KS 
Sbjct  397  AGVILCIEKALAQSGVSREDVNYINAHGTSTPAGDLKEYQAIVHCFGQNPELRVNSTKSM  456

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PD+G+     LVG KKERLDIK A+ N
Sbjct  457  IGHMLGAAGAVEAVATIQAIRTGWVHPNINLDNPDKGVD-TNVLVGSKKERLDIKVAISN  515

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  516  SFGFGGHNSSILFA  529



>ref|XP_003547514.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597883.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Glycine max]
Length=483

 Score =   125 bits (314),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 77/133 (58%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  S +  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  345  GVILCMEKALNHSRISREDVNYINAHATSTPIGDLKEYKALIHCFGQNLELRVNSTKSMI  404

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG VEA A I AI  GW  PN     PDEG+     LVG KKE LDIK A+ N 
Sbjct  405  GHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEGVD-TNVLVGSKKETLDIKAAMSNS  463

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  464  FGFGGQNSSIIFA  476



>gb|KDO73814.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=433

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  L++N  KS I
Sbjct  299  GVILCIEKALAHSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRGLRVNSTKSMI  358

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD  +     LVG KKERL++K AL N 
Sbjct  359  GHLLGAAGAVEAIAVVQAIRTGWIHPNINLENPD-AVVDTNVLVGPKKERLEVKAALSNS  417

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  418  FGFGGHNSSIIFS  430



>gb|AAC68861.1| 3-ketoacyl-ACP synthase [Cuphea hookeriana]
Length=534

 Score =   125 bits (314),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+  CFG NS L++N  KS 
Sbjct  399  AGVILCIEKALAQSGVSREDVNYINAHATSTPAGDIKEYQALAHCFGQNSELRVNSTKSM  458

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LG AG VEA A + AI  GW  PN     PDEG+   + LVG KKE+L +K  L N
Sbjct  459  IGHLLGGAGGVEAVAVVQAIRTGWIHPNINLEDPDEGVD-AKLLVGPKKEKLKVKVGLSN  517

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  518  SFGFGGHNSSILFA  531



>ref|XP_009767768.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nicotiana sylvestris]
Length=494

 Score =   125 bits (314),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GD+KEY A++ CFG N  L++N  KS I
Sbjct  360  GVILCIEKALAQSGVSKEDVNYINAHATSTLAGDIKEYQALLHCFGQNPELRVNSTKSMI  419

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     PDEG+   + LVG KKERLDIK AL N 
Sbjct  420  GHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDEGVDTTK-LVGPKKERLDIKVALSNS  478

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  479  FGFGGHNSSILFA  491



>ref|XP_006426745.1| hypothetical protein CICLE_v10027465mg [Citrus clementina]
 gb|ESR39985.1| hypothetical protein CICLE_v10027465mg [Citrus clementina]
Length=371

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GDL+EY A+IRCFG N  L++N  KS I
Sbjct  235  GMVSCMEKALAQSGVAKEDVNYINAHAPSTRLGDLREYQAVIRCFGKNPELRMNSTKSLI  294

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GA EA A I AI  GW  PN     PD+ +   + LVG KKERLDIK A+ N 
Sbjct  295  GHLLGASGAAEAVATIKAIQTGWIHPNLNLENPDKHV-DAKVLVGPKKERLDIKVAMSNS  353

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  354  FGFGGHNSSILFA  366



>ref|XP_010261746.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010261747.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nelumbo nucifera]
Length=565

 Score =   125 bits (313),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNY+NA A  T  GDLKEY A+IRCFG N  L++N  KS 
Sbjct  430  AGVVLCIDKALAQSGVAREDVNYVNAHATSTQAGDLKEYQALIRCFGQNPELRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG KKERLD+K AL N
Sbjct  490  IGHLLGAAGAVEAVATVQAIRTGWIHPNVNLENPDKGVD-TSVLVGPKKERLDVKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>gb|EYU25822.1| hypothetical protein MIMGU_mgv1a004003mg [Erythranthe guttata]
Length=549

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++RCFG N  L++N  KS 
Sbjct  414  AGVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALMRCFGKNPELRVNSTKSM  473

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG  KERL IK AL N
Sbjct  474  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDTGVD-TNLLVGPTKERLSIKVALSN  532

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  533  SFGFGGHNSSILFA  546



>ref|XP_010687531.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=545

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +G+  ED+NYINA A  TP GDLKEY A++RCFG N  ++IN  KS  
Sbjct  411  GVELCIEKALVKAGLAKEDINYINAHATSTPTGDLKEYQALVRCFGDNPEVRINSSKSMT  470

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGA+EA A I AI  GW  PN     PDEG+   + LVG KKER++I  AL N 
Sbjct  471  GHLLGAAGAIEAVATIQAIRTGWLHPNVNLENPDEGVD-TKLLVGSKKERMEINAALSNS  529

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  530  FGFGGQNSSIIFA  542



>gb|AAF91318.1|AF242848_1 beta-ketoacyl-acyl carrier protein synthase [Brassica napus]
Length=543

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  L   KAL  +G+  ED+NY+NA A  TP GDLKEY A+  CFG N  L++N  KS 
Sbjct  408  AGVILAIEKALAHAGISKEDINYVNAHATSTPAGDLKEYHALSHCFGQNPELRVNSTKSM  467

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  468  IGHLLGASGAVEAVATVQAIKTGWVHPNINLENPDKAVD-TKLLVGLKKERLDIKAALSN  526

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  527  SFGFGGQNSSIIFA  540



>ref|XP_009336709.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=446

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
             G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  310  TGVALCIEKALAQSGVNREDVNYINAYATSTPTGDLKEYRALIRCFGNNPELRVNSTKSM  369

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A I AI  G   PN     PD+ +     LVG KKE+LDIK AL N
Sbjct  370  IGHLLGASGAVEAVATIKAIQTGCIHPNINLENPDKSV-DMNVLVGPKKEKLDIKVALSN  428

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  429  SFGFGGHNSSILFA  442



>ref|XP_009149615.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like, 
partial [Brassica rapa]
Length=569

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  L   KAL  +G+  ED+NY+NA A  TP GDLKEY A+  CFG N  L++N  KS 
Sbjct  434  AGVILAIEKALAHAGISKEDINYVNAHATSTPAGDLKEYHALSHCFGQNPELRVNSTKSM  493

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  494  IGHLLGASGAVEAVATVQAIKTGWVHPNINLENPDKAVD-TKLLVGLKKERLDIKAALSN  552

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  553  SFGFGGQNSSIIFA  566



>gb|KDP33964.1| hypothetical protein JCGZ_07535 [Jatropha curcas]
Length=572

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KE+ A++ CFG N  L++N  KS I
Sbjct  438  GVILCVEKALAQSGVSREDVNYINAHATSTPAGDIKEFGALMHCFGQNPGLRVNSTKSMI  497

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERLD+K AL N 
Sbjct  498  GHLLGAAGAVEAIAAIQAIRTGWVHPNINLENPDEGVD-TNVLVGPKKERLDVKVALSNS  556

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  557  FGFGGHNSSIVFA  569



>ref|XP_010939870.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=557

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  423  GILLCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELRVNSTKSMI  482

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     PDE +   + LVG KKERLD+K AL N 
Sbjct  483  GHLLGAAGAVEAIAAVQAIRTGWVHPNVNLDNPDENVDVNK-LVGSKKERLDVKVALSNS  541

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  542  FGFGGHNSSILFA  554



>ref|XP_004243689.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum lycopersicum]
Length=540

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS +
Sbjct  406  GVILCVEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALVHCFGQNPELRVNSTKSMV  465

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     PDEG+     LVG  KERLDIK AL N 
Sbjct  466  GHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDEGVD-TNILVGPIKERLDIKVALSNS  524

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  525  FGFGGHNSSILFA  537



>ref|XP_010939869.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=559

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  425  GILLCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELRVNSTKSMI  484

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     PDE +   + LVG KKERLD+K AL N 
Sbjct  485  GHLLGAAGAVEAIAAVQAIRTGWVHPNVNLDNPDENVDVNK-LVGSKKERLDVKVALSNS  543

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  544  FGFGGHNSSILFA  556



>gb|ABJ90469.2| beta-ketoacyl-ACP synthase II [Jatropha curcas]
Length=573

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KE+ A++ CFG N  L++N  KS I
Sbjct  439  GVILCVEKALAQSGVSREDVNYINAHATSTPAGDIKEFGALMHCFGQNPGLRVNSTKSMI  498

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERLD+K AL N 
Sbjct  499  GHLLGAAGAVEAIAAIQAIRTGWVHPNINLENPDEGVD-TNVLVGPKKERLDVKVALSNS  557

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  558  FGFGGHNSSIVFA  570



>emb|CDY26686.1| BnaA06g13360D [Brassica napus]
Length=515

 Score =   124 bits (310),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  L   KAL  +G+  ED+NY+NA A  TP GDLKEY A+  CFG N  L++N  KS 
Sbjct  380  AGVILAIEKALAHAGISKEDINYVNAHATSTPAGDLKEYHALSHCFGQNPELRVNSTKSM  439

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  440  IGHLLGASGAVEAVATVQAIKTGWVHPNINLENPDKAVD-TKLLVGLKKERLDIKAALSN  498

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  499  SFGFGGQNSSIIFA  512



>ref|XP_006474686.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474687.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006474688.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=576

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRGLRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD G+     LVG KKERL++K AL N 
Sbjct  502  GHLLGAAGAVEAIAVVQAIRTGWIHPNINLENPD-GVVDTNVLVGPKKERLEVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  561  FGFGGHNSSIIFS  573



>emb|CDY41034.1| BnaC05g14920D [Brassica napus]
Length=520

 Score =   124 bits (310),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  L   KAL  +G+  ED+NY+NA A  TP GDLKEY A+  CFG N  L++N  KS 
Sbjct  385  AGVILAIEKALAHAGISKEDINYVNAHATSTPAGDLKEYHALSHCFGQNPELRVNSTKSM  444

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK AL N
Sbjct  445  IGHLLGASGAVEAVATVQAIKTGWVHPNINLENPDKAVD-TKLLVGLKKERLDIKAALSN  503

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  504  SFGFGGQNSSIIFA  517



>ref|XP_010937285.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=559

 Score =   124 bits (310),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  LK+N  KS I
Sbjct  425  GIILCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELKLNSTKSMI  484

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P+E +   + LVG KKERLD+K AL N 
Sbjct  485  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLDNPEENVDVNK-LVGSKKERLDVKVALSNS  543

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  544  FGFGGHNSSILFA  556



>gb|AAC04692.1| beta-ketoacyl-ACP synthase II [Perilla frutescens]
Length=530

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A++ CFG N  L++N  KS I
Sbjct  396  GVILCLEKALAQSGVSKEDVNYINAHATSTPAGDLKEYQALLHCFGKNPELRVNSTKSMI  455

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD G+     LVG  KERLDIK AL N 
Sbjct  456  GHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDGGVD-ANVLVGPTKERLDIKVALSNS  514

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  515  FGFGGHNSSILFA  527



>ref|XP_010937286.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=557

 Score =   124 bits (310),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  LK+N  KS I
Sbjct  423  GIILCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELKLNSTKSMI  482

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P+E +   + LVG KKERLD+K AL N 
Sbjct  483  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLDNPEENVDVNK-LVGSKKERLDVKVALSNS  541

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  542  FGFGGHNSSILFA  554



>ref|XP_010937284.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=559

 Score =   124 bits (310),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  LK+N  KS I
Sbjct  425  GIILCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELKLNSTKSMI  484

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P+E +   + LVG KKERLD+K AL N 
Sbjct  485  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLDNPEENVDVNK-LVGSKKERLDVKVALSNS  543

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  544  FGFGGHNSSILFA  556



>ref|XP_011093876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Sesamum indicum]
Length=547

 Score =   123 bits (309),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  413  GVILCIEKALAQSGVSKEDVNYINAHATSTPAGDLKEYKALIHCFGENPELRVNSTKSMI  472

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG  KERL IK AL N 
Sbjct  473  GHLLGAAGAVEAVATVQAIRTGWIHPNINLENPDDGVD-TNVLVGPTKERLAIKVALSNS  531

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  532  FGFGGHNSSILFA  544



>gb|AGC65509.1| keto acyl-acyl carrier protein synthase II [Carthamus tinctorius]
Length=546

 Score =   123 bits (309),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL   GV  EDVNYINA A  TP GD+KEY AI+ CFG N  +++N  KS I
Sbjct  412  GVILCIEKALSQVGVSREDVNYINAHATSTPVGDVKEYLAIVHCFGQNQEVRVNSTKSMI  471

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA G VE  A + AI  GW  PN     P+EG+     +VG KKERLD+K AL N 
Sbjct  472  GHLLGADGPVEVVATVQAIRTGWIHPNIILENPEEGVD-TELVVGPKKERLDVKVALFNS  530

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  531  FGFGGHNSSILFA  543



>ref|XP_010932373.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X4 [Elaeis guineensis]
Length=565

 Score =   123 bits (309),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  430  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AAI AI  GW  PN     P++ +     LVG +KERLD+K AL N
Sbjct  490  IGHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPEKSVD-INVLVGSRKERLDVKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>ref|XP_010932372.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=574

 Score =   123 bits (309),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  439  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  498

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AAI AI  GW  PN     P++ +     LVG +KERLD+K AL N
Sbjct  499  IGHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPEKSVD-INVLVGSRKERLDVKVALSN  557

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  558  SFGFGGHNSSILFA  571



>ref|XP_009625177.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=493

 Score =   122 bits (307),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GD+KE+ A++ CFG N  L++N  KS I
Sbjct  359  GVILCIEKALAQSGVSKEDVNYINAHATSTLAGDIKEHQALLHCFGQNPELRVNSTKSMI  418

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN     PDEG+   + LVG KKERLDIK AL N 
Sbjct  419  GHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDEGVDTNK-LVGPKKERLDIKVALSNS  477

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  478  FGFGGHNSSILFA  490



>emb|CDY37268.1| BnaCnng08220D [Brassica napus]
Length=431

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  +C  +AL  +G+  E +NY+NA A  TP GDLKEY A++ CFG N  LK+N  KS 
Sbjct  296  AGVIICIERALAHAGITKEQINYVNAHATSTPAGDLKEYKALVHCFGQNPELKVNSTKSM  355

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     P+ G+   + LVG KKERLDIK AL N
Sbjct  356  IGHLLGAAGAVEAVATVQAIKTGWVHPNINLDNPENGV-DTKLLVGSKKERLDIKAALSN  414

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  415  SFGFGGHNSSIIFA  428



>ref|XP_007012566.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012567.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012568.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012569.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007012571.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30185.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30186.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30187.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30188.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOY30190.1| Fatty acid biosynthesis 1 isoform 1 [Theobroma cacao]
Length=575

 Score =   123 bits (309),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  ED+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  441  GVILCMEKALAQSGVSKEDINYINAHATSTPAGDIKEYQALMHCFGKNPELRVNSTKSMI  500

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  501  GHLLGAAGAVEAVAAIQAIRTGWVHPNVNLESPDEGVD-TNVLVGPKKERLNVKAALSNS  559

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  560  FGFGGHNSSIIFA  572



>gb|AAF26738.2|AF220453_1 beta-ketoacyl-ACP synthase II [Elaeis guineensis]
Length=573

 Score =   122 bits (307),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  430  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AAI AI  GW  PN     P++ +     LVG +KERLD+K AL N
Sbjct  490  IGHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPEKSVD-INVLVGSRKERLDVKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>ref|XP_010539937.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Tarenaya hassleriana]
Length=627

 Score =   123 bits (309),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +G+  ED+NYINA A  TP GD+KEY A++ CFG N  L++N  KS 
Sbjct  492  AGVILCIENALNQAGISREDINYINAHATSTPAGDIKEYKALVHCFGQNPELRVNSTKSM  551

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A + AI  GW  PN     PDEG+     LVG KKERL+IK AL N
Sbjct  552  VGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDEGVD-TELLVGPKKERLNIKAALSN  610

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  611  SFGFGGHNSSIIFA  624



>ref|XP_009390876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=528

 Score =   122 bits (306),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKE+ A+IR FG N  L++N  KS  
Sbjct  393  GVVLCIDKALSDSGVSREDVNYVNAHATSTPSGDLKEFQALIRSFGNNPELRVNSTKSMT  452

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG VEA A + AI  GW  PN     P+E +     LVG KKERLD+K AL N 
Sbjct  453  GHLLGAAGTVEAVAVVQAIRTGWVHPNINLDNPEESVD-ASVLVGAKKERLDVKVALSNS  511

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  512  FGFGGHNSSILFA  524



>gb|AAB37271.1| beta-ketoacyl-ACP synthase II [Cuphea wrightii]
Length=540

 Score =   122 bits (306),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +GV  EDVNYINA A  T  GD+KEY A+ RCFG NS L++N  KS 
Sbjct  404  AGVILCIEKALAQAGVSKEDVNYINAHATSTSAGDIKEYQALARCFGQNSELRVNSTKSM  463

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA   + AI  GW  PN     PD+ +   + LVG KKERL++K  L N
Sbjct  464  IGHLLGAAGGVEAVTVVQAIRTGWIHPNLNLEDPDKAVD-AKLLVGPKKERLNVKVGLSN  522

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  523  SFGFGGHNSSILFA  536



>ref|XP_008784350.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Phoenix dactylifera]
Length=563

 Score =   122 bits (306),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY AI+RCFG N  L++N  KS 
Sbjct  428  AGIALCIENALVQAGVAKEDVNYVNAHATSTPVGDLKEYQAIVRCFGQNPELRVNSTKSM  487

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AAI AI  GW  PN     P++ +     LVG ++ERLD+K AL N
Sbjct  488  IGHLLGASGAVEAVAAIQAIRTGWVHPNINLENPEKSVD-MNVLVGSRRERLDVKVALSN  546

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  547  SFGFGGHNSSILFA  560



>gb|ADE77460.1| unknown [Picea sitchensis]
Length=289

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL+ +GV+ E+VNY+NA A  T  GDLKEY A+IRCFG N  LK+N  KS I
Sbjct  150  GVLLCIENALRQAGVRRENVNYVNAHATSTRAGDLKEYQALIRCFGQNPELKLNSTKSMI  209

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A I AI  GW  P      P++ +     +VG KKERLDIK AL N 
Sbjct  210  GHLLGASGAVEAVATIQAIRTGWVHPTINLENPEKDVD-MNFIVGPKKERLDIKVALSNS  268

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  269  FGFGGHNSSLVFA  281



>gb|ACQ41833.1| beta-ketoacyl-ACP synthase II [Elaeis oleifera]
Length=562

 Score =   122 bits (306),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 75/133 (56%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS I
Sbjct  428  GIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSMI  487

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA AAI AI  GW  PN     P++ +     LVG +KERLD+K AL N 
Sbjct  488  GHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPEKSVD-INVLVGSRKERLDVKVALSNS  546

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  547  FGFGGHNSSILFA  559



>ref|XP_006452865.1| hypothetical protein CICLE_v10007846mg [Citrus clementina]
 gb|ESR66105.1| hypothetical protein CICLE_v10007846mg [Citrus clementina]
Length=576

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 75/133 (56%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRGLRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD  +     LVG KKERL++K AL N 
Sbjct  502  GHLLGAAGAVEAIAVVQAIRTGWIHPNINLENPD-AVVDTNVLVGPKKERLEVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  561  FGFGGHNSSIIFS  573



>gb|KDO73811.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
 gb|KDO73812.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
 gb|KDO73813.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=576

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 75/133 (56%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRGLRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD  +     LVG KKERL++K AL N 
Sbjct  502  GHLLGAAGAVEAIAVVQAIRTGWIHPNINLENPD-AVVDTNVLVGPKKERLEVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  561  FGFGGHNSSIIFS  573



>ref|XP_006466136.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Citrus sinensis]
Length=456

 Score =   121 bits (303),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 73/133 (55%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GDL+EY A+IRCFG N  L++N  KS I
Sbjct  320  GMVSCMEKALAQSGVAKEDVNYINAHAPSTRLGDLREYQAVIRCFGKNPELRMNSTKSLI  379

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G  EA A I AI  GW  PN     PD+ +   + LVG KKERLDIK A+ N 
Sbjct  380  GHLLGASGTAEAVATIKAIQTGWIHPNLNLENPDKDVD-AKVLVGPKKERLDIKVAMSNS  438

Query  40   FGFGGXNFXXXFA  2
            +GFGG N    FA
Sbjct  439  YGFGGHNSSILFA  451



>emb|CDO97819.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   122 bits (305),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  ED+NYINA A  TP GDLKE+ AI+RC G N  LK+N  KS 
Sbjct  430  AGIVLCIEKALAQSGVAREDINYINAHATSTPAGDLKEFEAIMRCIGQNPELKMNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG KKE+L+IK AL N
Sbjct  490  VGHLLGAAGAVEAVATVKAIQTGWIHPNINLENPDKGVD-TSVLVGPKKEQLEIKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>gb|AAL91174.1| putative 3-ketoacyl-ACP synthase [Arabidopsis thaliana]
Length=541

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  T  GD+KEY A+  CFG N  LK+N  KS 
Sbjct  406  AGVILCIERALASAGISKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSM  465

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LG AGAVEA A + AI  GW  PN     PD G+   + LVG KKERLDIK AL N
Sbjct  466  IGHLLGVAGAVEAVATVQAIRTGWVHPNINLENPDSGVD-TKLLVGPKKERLDIKAALSN  524

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  525  SFGFGGHNSSIIFA  538



>ref|XP_010273891.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=565

 Score =   122 bits (305),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  ED+NY+NA A  T  GDLKEY A+I CFG N  L++N  KS 
Sbjct  430  AGVVLCIEKALAQSGVAREDINYVNAHATSTQSGDLKEYQALIHCFGQNPELRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG KKERLDIK AL N
Sbjct  490  TGHLLGAAGAVEAVATVQAIRTGWIHPNINLENPDKGID-TNVLVGPKKERLDIKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>gb|KDO45708.1| hypothetical protein CISIN_1g0114931mg, partial [Citrus sinensis]
Length=439

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 73/133 (55%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GDL+EY A+IRCFG N  L++N  KS I
Sbjct  303  GMVSCMEKALAQSGVAKEDVNYINAHAPSTRLGDLREYQAVIRCFGKNPELRMNSTKSLI  362

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G  EA A I AI  GW  PN     PD+ +   + LVG KKERLDIK A+ N 
Sbjct  363  GHLLGASGTAEAVATIKAIQTGWIHPNLNLENPDKDVD-AKVLVGPKKERLDIKVAMSNS  421

Query  40   FGFGGXNFXXXFA  2
            +GFGG N    FA
Sbjct  422  YGFGGHNSSILFA  434



>emb|CDP03046.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 75/133 (56%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV   DVNYINA A  TP GDLKEY A++ CFG N  L +N  KS I
Sbjct  415  GVILCIEKALSQSGVSRGDVNYINAHATSTPAGDLKEYQALVHCFGENQELLVNSTKSMI  474

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG VEA A + AI  GW  PN     PD+ +   + LVG +KERLDIK AL N 
Sbjct  475  GHLLGAAGGVEAVATVQAIRTGWVHPNINLENPDDDVD-TKLLVGPEKERLDIKIALSNS  533

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  534  FGFGGHNSSILFA  546



>ref|XP_010089666.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
 gb|EXB38185.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Morus notabilis]
Length=557

 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +GV  EDVNYINA A  TP GD+KEY A++ CFG N  L++N  KS 
Sbjct  422  AGVKLCIEKALAQAGVSKEDVNYINAHATSTPAGDIKEYNALVHCFGQNPQLRLNSTKSM  481

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG KKERL +K AL N
Sbjct  482  IGHLLGAAGAVEAVATVQAIRTGWVHPNVNLENPDDGVD-KSLLVGPKKERLKVKVALSN  540

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    F+
Sbjct  541  SFGFGGHNSSILFS  554



>gb|AAM09292.1| beta-ketoacyl-ACP synthase II [Elaeis oleifera]
Length=239

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 79/124 (64%), Gaps = 0/124 (0%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  111  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  170

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA AAI AI  GW  PN     P +       LVG +KERLD+K AL N
Sbjct  171  IGHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPMKKGVDINVLVGSRKERLDVKVALSN  230

Query  43   XFGF  32
             FG 
Sbjct  231  SFGL  234



>gb|ACN85392.1| phosphoenolpyruvate carboxylase [Kosteletzkya virginica]
Length=261

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  L   KAL  SGV  EDVNYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  138  GAILSIEKALAQSGVPREDVNYINAHATSTPSGDIKEYQALVHCFGKNPELRVNSTKSMI  197

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  198  GHLLGAAGAVEAVAAVQAIKTGWVHPNINLEIPDEGVD-TSVLVGPKKERLNVKAALSNS  256

Query  40   FGFGG  26
            FGFGG
Sbjct  257  FGFGG  261



>ref|XP_010273890.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=612

 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV  ED+NY+NA A  T  GDLKEY A+I CFG N  L++N  KS 
Sbjct  430  AGVVLCIEKALAQSGVAREDINYVNAHATSTQSGDLKEYQALIHCFGQNPELRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG KKERLDIK AL N
Sbjct  490  TGHLLGAAGAVEAVATVQAIRTGWIHPNINLENPDKGID-TNVLVGPKKERLDIKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>ref|XP_006390366.1| hypothetical protein EUTSA_v10018368mg [Eutrema salsugineum]
 gb|ESQ27652.1| hypothetical protein EUTSA_v10018368mg [Eutrema salsugineum]
Length=545

 Score =   120 bits (302),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  LK+N  KS 
Sbjct  410  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPELKVNSTKSM  469

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+   + LVG KKERL+IK AL N
Sbjct  470  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDSGVD-TKLLVGPKKERLNIKAALSN  528

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  529  SFGFGGHNSSIIFA  542



>emb|CAC59946.1| beta-ketoacyl-ACP synthase IV [Cuphea lanceolata]
Length=538

 Score =   120 bits (302),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 72/134 (54%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KA+  +GV  EDVNYINA A  TP GD+KEY A+  CFG NS L++N  KS 
Sbjct  403  AGVILCIEKAMAQAGVSREDVNYINAHATSTPAGDIKEYQALAHCFGQNSELRVNSTKSM  462

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA   I AI  GW  PN     PD+ +   + LVG +KERL++K  L N
Sbjct  463  IGHLLGAAGGVEAVTVIQAIRTGWIHPNLNLEDPDKAVD-AKFLVGPEKERLNVKVGLSN  521

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  522  SFGFGGHNSSILFA  535



>ref|XP_006466135.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Citrus sinensis]
Length=275

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GD +E+ A++ CFG N  L++N  KS  
Sbjct  141  GAVACMEKALTNSGVSREDVNYINAHATSTRVGDPREFKAVMHCFGQNPELRMNSTKSMT  200

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+ +   R LVG KKERLDIK A+ N 
Sbjct  201  GHLLGAAGAVEAIATVKAIQTGWIHPNINLENPDKDV-DTRVLVGPKKERLDIKVAMSNS  259

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  260  FGFGGHNSSILFA  272



>ref|XP_009104733.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Brassica rapa]
Length=546

 Score =   120 bits (302),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  LK+N  KS 
Sbjct  411  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPELKVNSTKSM  470

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG KKERL IK AL N
Sbjct  471  IGHLLGAAGAVEAIATVQAIRTGWVHPNINLENPDNGVD-TSLLVGPKKERLSIKAALSN  529

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  530  SFGFGGHNSSIIFA  543



>emb|CDX68154.1| BnaA07g21940D [Brassica napus]
Length=546

 Score =   120 bits (302),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  LK+N  KS 
Sbjct  411  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPELKVNSTKSM  470

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG KKERL IK AL N
Sbjct  471  IGHLLGAAGAVEAIATVQAIRTGWVHPNINLENPDNGVD-TSLLVGPKKERLSIKAALSN  529

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  530  SFGFGGHNSSIIFA  543



>ref|XP_011078136.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=546

 Score =   120 bits (301),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 77/133 (58%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GDLKEY A+I CFG N  L++N  KS  
Sbjct  412  GVILCIEKALSQSGVSKEDVNYINAHATSTLSGDLKEYQALIHCFGQNPELRVNSTKSMT  471

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+G+     LVG  KERLDIK AL N 
Sbjct  472  GHLLGAAGAVEAVATVQAIRTGWIHPNVNLENPDDGVN-TNLLVGPTKERLDIKVALSNT  530

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  531  FGFGGHNSSILFA  543



>gb|AAB37270.1| beta-ketoacyl-ACP synthase II [Cuphea wrightii]
Length=517

 Score =   119 bits (299),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 72/134 (54%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  SGV  EDVNYINA A  TP GD+KEY A+ R F  NS L++N  KS 
Sbjct  382  AGVILCIERALAQSGVSKEDVNYINAHATSTPAGDIKEYQALARIFSQNSELRVNSTKSM  441

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA   + AI  GW  PN     PD+G+   + LVG KKE+L +K  L N
Sbjct  442  IGHLLGAAGGVEAVTVVQAIRTGWIHPNINLENPDDGVD-AKLLVGPKKEKLKVKVGLSN  500

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  501  SFGFGGHNSSILFA  514



>gb|KJB27216.1| hypothetical protein B456_004G285300 [Gossypium raimondii]
Length=525

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  ED+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  391  GVVRCIEKALAQSGVPREDINYINAHATSTPSGDIKEYQALLHCFGKNPELRVNSTKSMI  450

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     PD+ +     LVG KKERL++K AL N 
Sbjct  451  GHLLGAAGAVEAVAAVQAIRTGWVHPNINLENPDQEVD-TNVLVGPKKERLNVKAALSNS  509

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  510  FGFGGHNSSIIFA  522



>ref|XP_008228351.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Prunus mume]
Length=555

 Score =   120 bits (300),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GDLKEY AIIRCF  N  L++N  KS I
Sbjct  421  GVALCIEKALDQSGVCREDVNYINAYAASTPTGDLKEYRAIIRCFRKNPELRVNSTKSMI  480

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A I AI  G   PN     PD G      LVG KKE+LDIK AL N 
Sbjct  481  GHLLGASGAVEAVATIKAIQTGCIHPNINLENPD-GSVDMNVLVGPKKEKLDIKVALSNA  539

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  540  FGFGGHNSSILFA  552



>ref|XP_009106152.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Brassica rapa]
Length=542

 Score =   119 bits (298),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  +K+N  KS 
Sbjct  407  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPEIKVNSTKSM  466

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG +KERLDIK AL N
Sbjct  467  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLESPDNGVD-TNLLVGPEKERLDIKAALSN  525

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  526  SFGFGGHNSSIIFA  539



>ref|XP_002889002.1| hypothetical protein ARALYDRAFT_476635 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65261.1| hypothetical protein ARALYDRAFT_476635 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   119 bits (298),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 75/134 (56%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +GV  E +NYINA A  T  GD+KEY A+  CFG N  LK+N  KS 
Sbjct  408  AGVILCIERALASAGVSKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSM  467

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+   + LVG KKERLDIK AL N
Sbjct  468  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDSGVD-TKLLVGPKKERLDIKAALSN  526

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  527  SFGFGGHNSSIIFA  540



>gb|KHG11340.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Gossypium 
arboreum]
Length=433

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GD+KE+ A++ CFG N  L++N  KS I
Sbjct  299  GAILCIEKALAQSGVAREDVNYINAHASSTAVGDIKEFQALLHCFGKNPELRVNSTKSMI  358

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  359  GHLLGAAGAVEAVAAIQAIQTGWIHPNINLENPDEGVD-ANVLVGPKKERLNVKAALSNS  417

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  418  FGFGGHNSSIIF  429



>ref|XP_009128067.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Brassica rapa]
Length=490

 Score =   119 bits (297),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 72/134 (54%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  +C  +AL  +G+  E +NY+NA A  TP GDLKEY A++ CFG N  LK+N  KS 
Sbjct  355  AGVIICIERALAHAGIPKEQINYVNAHATSTPAGDLKEYKALVHCFGQNPELKVNSTKSM  414

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     P+ G+   + LVG KKERL+IK AL N
Sbjct  415  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLDNPENGVD-TKLLVGSKKERLNIKAALSN  473

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  474  SFGFGGHNSSIIFA  487



>ref|XP_010932371.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=577

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 76/145 (52%), Positives = 87/145 (60%), Gaps = 11/145 (8%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  430  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPP-----------RXLVGFKK  77
            IGH LGA+GAVEA AAI AI  GW  PN     P++ +                LVG +K
Sbjct  490  IGHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPEKSVPSGVYLTSRQIQDINVLVGSRK  549

Query  76   ERLDIKXALXNXFGFGGXNFXXXFA  2
            ERLD+K AL N FGFGG N    FA
Sbjct  550  ERLDVKVALSNSFGFGGHNSSILFA  574



>ref|XP_010932370.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=586

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 76/145 (52%), Positives = 87/145 (60%), Gaps = 11/145 (8%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  439  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  498

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPP-----------RXLVGFKK  77
            IGH LGA+GAVEA AAI AI  GW  PN     P++ +                LVG +K
Sbjct  499  IGHLLGASGAVEAVAAIQAIRTGWVHPNVNLENPEKSVPSGVYLTSRQIQDINVLVGSRK  558

Query  76   ERLDIKXALXNXFGFGGXNFXXXFA  2
            ERLD+K AL N FGFGG N    FA
Sbjct  559  ERLDVKVALSNSFGFGGHNSSILFA  583



>gb|KDO45710.1| hypothetical protein CISIN_1g0448241mg, partial [Citrus sinensis]
Length=367

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GD +E+ A++ CFG N  L++N  KS  
Sbjct  233  GAVACMEKALTNSGVSREDVNYINAHATSTRVGDPREFKAVMHCFGQNPELRMNSTKSMT  292

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+ +   R LVG KKERLDIK A+ N 
Sbjct  293  GHLLGAAGAVEAIATVKAIQTGWIHPNINLENPDKDV-DTRVLVGPKKERLDIKVAMSNS  351

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  352  FGFGGHNSSILFA  364



>ref|XP_006426725.1| hypothetical protein CICLE_v10027447mg [Citrus clementina]
 gb|ESR39965.1| hypothetical protein CICLE_v10027447mg [Citrus clementina]
Length=436

 Score =   118 bits (296),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 73/133 (55%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  +GV  EDVNYINA A  T  GDL+EY A+IRCFG N  L++N  KS I
Sbjct  300  GMVSCMKKALAQAGVAREDVNYINAHAPSTRLGDLREYQAVIRCFGKNPELRMNSTKSLI  359

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GA EA A I AI  GW  PN     PD+ +   + LVG  KERLDIK A+ N 
Sbjct  360  GHLLGASGAAEAVATIKAIQIGWIHPNLNLENPDKHVD-AKVLVGPMKERLDIKVAMSNS  418

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  419  FGFGGHNSSILFA  431



>gb|AAF61739.1|AF244520_1 beta-ketoacyl-ACP synthetase 2 [Brassica napus]
Length=433

 Score =   118 bits (295),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  +K+N  KS 
Sbjct  298  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPEIKVNSTKSM  357

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG +KERLDIK AL N
Sbjct  358  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLESPDNGVD-TNLLVGPEKERLDIKAALSN  416

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  417  SFGFGGHNSSIIFA  430



>emb|CDY45409.1| BnaA07g31890D [Brassica napus]
Length=536

 Score =   119 bits (297),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  +K+N  KS 
Sbjct  401  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPEIKVNSTKSM  460

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG +KERLDIK AL N
Sbjct  461  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLESPDNGVD-TNLLVGPEKERLDIKAALSN  519

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  520  SFGFGGHNSSIIFA  533



>emb|CDX73128.1| BnaC06g35760D [Brassica napus]
Length=544

 Score =   118 bits (296),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  +K+N  KS 
Sbjct  409  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPEIKVNSTKSM  468

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+     LVG +KERLDIK AL N
Sbjct  469  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLESPDNGVD-TNLLVGPEKERLDIKAALSN  527

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  528  SFGFGGHNSSIIFA  541



>ref|NP_565097.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 ref|NP_849888.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 ref|NP_001185400.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 sp|Q9C9P4.1|KASC2_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic; 
AltName: Full=Beta-ketoacyl-acyl-carrier-protein 
synthase II; Short=AtKAS2; Short=Beta-ketoacyl-ACP synthetase 
2; AltName: Full=Protein FATTY ACID BIOSYNTHESIS 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51920.1|AC013258_14 putative 3-ketoacyl-ACP synthase; 47419-50803 [Arabidopsis thaliana]
 gb|AAK69603.1|AF318307_1 beta-ketoacyl-ACP synthetase 2 [Arabidopsis thaliana]
 gb|AAL31930.1|AF419598_1 At1g74960/F9E10_19 [Arabidopsis thaliana]
 gb|AAL06857.1| At1g74960/F9E10_19 [Arabidopsis thaliana]
 gb|AAM19860.1| At1g74960/F9E10_19 [Arabidopsis thaliana]
 gb|AEE35655.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 gb|AEE35656.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
 gb|AEE35657.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Arabidopsis thaliana]
Length=541

 Score =   118 bits (295),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  T  GD+KEY A+  CFG N  LK+N  KS 
Sbjct  406  AGVILCIERALASAGISKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSM  465

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+   + LVG KKERLDIK AL N
Sbjct  466  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDSGVD-TKLLVGPKKERLDIKAALSN  524

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  525  SFGFGGHNSSIIFA  538



>gb|AAD55280.1|AC008263_11 Similar to gb|AF060519 3-ketoacyl-ACP synthase (Kas4) from Cuphea 
hookeriana [Arabidopsis thaliana]
Length=562

 Score =   118 bits (296),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  T  GD+KEY A+  CFG N  LK+N  KS 
Sbjct  427  AGVILCIERALASAGISKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSM  486

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+   + LVG KKERLDIK AL N
Sbjct  487  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDSGVD-TKLLVGPKKERLDIKAALSN  545

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  546  SFGFGGHNSSIIFA  559



>gb|KJB82970.1| hypothetical protein B456_013G222600 [Gossypium raimondii]
Length=433

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV   D+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  299  GVILCIEKALAHAGVSRGDINYINAHATSTPTGDIKEYQALLHCFGDNPELRVNSTKSMI  358

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PD G+     LVG  KERL++K AL N 
Sbjct  359  GHLLGASGAVEAVATVQAIRTGWVHPNINLENPDVGVD-TSVLVGPNKERLNVKAALSNS  417

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  418  FGFGGHNSSIIFA  430



>ref|XP_006466138.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Citrus sinensis]
Length=487

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 72/132 (55%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  +GV  EDVNYINA A  T  GDL+EY A+IRCFG N  L++N  KS I
Sbjct  351  GMVSCMKKALAQAGVAREDVNYINAHAPSTRLGDLREYQAVIRCFGKNPALRMNSTKSLI  410

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GA EA A I AI  GW  PN     PD+ +   + LVG  KERLDIK A+ N 
Sbjct  411  GHLLGASGAAEAVATIKAIQTGWIHPNLNQENPDKHVD-AKVLVGPMKERLDIKVAMSNS  469

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  470  FGFGGHNSSILF  481



>ref|XP_010428495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Camelina sativa]
 gb|AFU61917.1| beta-ketoacyl-ACP synthase II [Camelina sativa]
Length=553

 Score =   118 bits (295),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +GV  E +NYINA A  T  GDL+EY A++ CFG N  LK+N  KS 
Sbjct  418  AGVILCIERALASAGVSREQINYINAHATSTHAGDLREYQALVNCFGQNPELKVNSTKSM  477

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PD G+   + +VG KKERL+IK AL N
Sbjct  478  IGHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDSGVD-TKLMVGPKKERLNIKAALSN  536

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  537  SFGFGGHNSSIIFA  550



>emb|CDY46021.1| BnaA02g17050D [Brassica napus]
Length=487

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  +C  +AL  +G+  E +NY+NA A  TP GDLKEY A++ CFG N  LK+N  KS I
Sbjct  353  GVIICIERALAHAGIPKEQINYVNAHATSTPAGDLKEYKALVHCFGQNPELKVNSTKSMI  412

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     P+ G+   + LVG KKERL+IK AL N 
Sbjct  413  GHLLGAAGAVEAVATVQAIRTGWVHPNINLDNPENGVD-TKLLVGSKKERLNIKAALSNS  471

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  472  FGFGGHNSSIIFA  484



>ref|XP_008782980.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Phoenix dactylifera]
Length=555

 Score =   117 bits (294),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
             G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  LK+N  KS 
Sbjct  420  GGIILCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELKVNSTKSM  479

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAGAVEA AA+ AI  GW  PN     P+E +   + LVG  KERLD+K AL +
Sbjct  480  TGHLLGAAGAVEAIAAVQAIRTGWVHPNINLDSPEENVDVNK-LVGSNKERLDVKVALSS  538

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  539  SFGFGGHNSSILFA  552



>ref|XP_006300437.1| hypothetical protein CARUB_v10020101mg [Capsella rubella]
 gb|EOA33335.1| hypothetical protein CARUB_v10020101mg [Capsella rubella]
Length=543

 Score =   117 bits (294),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +GV  E +NYINA A  T  GDL+EY A++ CFG N  LK+N  KS 
Sbjct  408  AGVILCIERALASAGVSREQINYINAHATSTHAGDLREYQALVHCFGQNPELKVNSTKSM  467

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A + AI  GW  PN     PD G+   + +VG KKERL+IK AL N
Sbjct  468  IGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDNGVD-TKLMVGPKKERLNIKAALSN  526

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  527  SFGFGGHNSSIIFA  540



>ref|XP_008782961.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=557

 Score =   117 bits (294),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  LK+N  KS  
Sbjct  423  GIILCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELKVNSTKSMT  482

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P+E +   + LVG  KERLD+K AL + 
Sbjct  483  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLDSPEENVDVNK-LVGSNKERLDVKVALSSS  541

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  542  FGFGGHNSSILFA  554



>gb|KJB65355.1| hypothetical protein B456_010G091400 [Gossypium raimondii]
Length=409

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GD+KE+ A++ CFG N  L++N  KS  
Sbjct  275  GAILCIEKALAQSGVAREDVNYINAHASSTAVGDIKEFQALLHCFGKNPKLRVNSTKSMT  334

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  335  GHLLGAAGAVEAVAAIQAIRTGWVHPNINLENPDEGVD-ANVLVGPKKERLNVKAALSNS  393

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  394  FGFGGHNSSIIF  405



>ref|XP_008782971.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=555

 Score =   117 bits (294),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  TP GDLKEY A+I CFG N  LK+N  KS  
Sbjct  421  GIILCIEKALAESGVAREDVNYVNAHATSTPSGDLKEYQALIHCFGQNPELKVNSTKSMT  480

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P+E +   + LVG  KERLD+K AL + 
Sbjct  481  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLDSPEENVDVNK-LVGSNKERLDVKVALSSS  539

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  540  FGFGGHNSSILFA  552



>ref|NP_001290396.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Camelina 
sativa]
 ref|XP_010416356.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Camelina sativa]
 gb|AFU61919.1| beta-ketoacyl-ACP synthase II [Camelina sativa]
Length=556

 Score =   117 bits (293),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +GV  E +NYINA A  T  GDL+EY A++ CFG N  LK+N  KS 
Sbjct  421  AGVILCIERALASAGVSREQINYINAHATSTHAGDLREYQALVNCFGQNPELKVNSTKSM  480

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PD G+   + +VG KKERL+IK AL N
Sbjct  481  IGHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDSGVD-TKLMVGPKKERLNIKAALSN  539

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  540  SFGFGGHNSSIIFA  553



>emb|CDX85866.1| BnaC06g22680D [Brassica napus]
Length=539

 Score =   117 bits (293),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 76/134 (57%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +G+  E +NYINA A  TP GDLKEY A+  CFG N  LK+N  KS 
Sbjct  404  AGVILCIERALADAGISKEQINYINAHATSTPAGDLKEYQALAHCFGQNPELKVNSTKSM  463

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PD G+     LVG KKERL IK AL N
Sbjct  464  IGHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDNGVD-TSLLVGPKKERLSIKAALSN  522

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  523  SFGFGGHNSSIIFA  536



>ref|NP_001289900.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Camelina sativa]
 ref|XP_010471596.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Camelina sativa]
 gb|AFU61918.1| beta-ketoacyl-ACP synthase II [Camelina sativa]
Length=554

 Score =   117 bits (293),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 74/134 (55%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +GV  E +NYINA A  T  GDL+EY A++ CFG N  LK+N  KS 
Sbjct  419  AGVILCIERALASAGVSREQINYINAHATSTHAGDLREYQALVNCFGQNPELKVNSTKSM  478

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAGAVEA A I AI  GW  PN     PD G+   + +VG KKERL+IK AL N
Sbjct  479  IGHLLGAAGAVEAVATIQAIRTGWVHPNINLENPDSGVD-TKLMVGPKKERLNIKAALSN  537

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  538  SFGFGGHNSSIIFA  551



>gb|KHG18322.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic -like 
protein [Gossypium arboreum]
Length=576

 Score =   117 bits (293),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV   D+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHAGVSRGDINYINAHATSTPTGDIKEYQALLHCFGENPELRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PD G+     LVG  KERL++K AL N 
Sbjct  502  GHLLGASGAVEAVATVQAIRTGWVHPNINLENPDVGVD-TSVLVGPNKERLNVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  561  FGFGGHNSSIIFA  573



>gb|AIL53811.1| beta-ketoacyl-[acyl carrier protein] synthase II [Gossypium hirsutum]
Length=576

 Score =   117 bits (293),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV   D+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHAGVSRGDINYINAHATSTPTGDIKEYQALLHCFGENPELRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PD G+     LVG  KERL++K AL N 
Sbjct  502  GHLLGASGAVEAVATVQAIRTGWVHPNINLENPDVGVD-TSVLVGPNKERLNVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  561  FGFGGHNSSIIFA  573



>gb|KJB82969.1| hypothetical protein B456_013G222600 [Gossypium raimondii]
Length=576

 Score =   117 bits (292),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV   D+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHAGVSRGDINYINAHATSTPTGDIKEYQALLHCFGDNPELRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A + AI  GW  PN     PD G+     LVG  KERL++K AL N 
Sbjct  502  GHLLGASGAVEAVATVQAIRTGWVHPNINLENPDVGVD-TSVLVGPNKERLNVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  561  FGFGGHNSSIIFA  573



>ref|XP_006843870.1| hypothetical protein AMTR_s00007p00265100 [Amborella trichopoda]
 gb|ERN05545.1| hypothetical protein AMTR_s00007p00265100 [Amborella trichopoda]
Length=606

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 76/132 (58%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  T  GDLKEY A++ CFG N  L++N  KS I
Sbjct  403  GIVLCIEKALSQSGVAREDVNYVNAHATSTQSGDLKEYKALLHCFGQNPELRVNSTKSMI  462

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  GW  PN    +PD+ +   R LVG  KERLDIK AL N 
Sbjct  463  GHLLGAAGAVEAVAVIQAIRTGWIHPNVNLEEPDKDVD-LRVLVGPTKERLDIKVALSNS  521

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  522  FGFGGHNSSILF  533



>gb|KHG11339.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Gossypium 
arboreum]
Length=575

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 76/132 (58%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GD+KE+ A++ CFG N  L++N  KS I
Sbjct  441  GAILCIEKALAQSGVAREDVNYINAHASSTAVGDIKEFQALLHCFGKNPELRVNSTKSMI  500

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  501  GHLLGAAGAVEAVAAIQAIQTGWIHPNINLENPDEGVD-ANVLVGPKKERLNVKAALSNS  559

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  560  FGFGGHNSSIIF  571



>gb|ADK23940.1| KASII [Gossypium hirsutum]
Length=576

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  +AL  +GV   D+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  442  GVILCIEEALAHAGVSRGDINYINARATSTPTGDIKEYQALLHCFGENPELRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GAVEA A I AI  GW  PN     PD G+     LVG  KERL++K AL N 
Sbjct  502  GHLLGASGAVEAAATIQAIRTGWVHPNINLENPDVGVD-TSVLVGPNKERLNVKAALSNS  560

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  561  FGFGGHNSSIIFA  573



>gb|KHG27960.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic -like 
protein [Gossypium arboreum]
Length=525

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  ED+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  391  GVVRCIEKALAQSGVPREDINYINAHATSTPSGDIKEYQALLHCFGKNPELRVNSTKSMI  450

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     PD+ +     LVG KKERL++K AL N 
Sbjct  451  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLENPDQEVD-TNVLVGPKKERLNVKAALSNS  509

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  510  FGFGGHNSSIIFA  522



>ref|XP_003557750.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Brachypodium distachyon]
Length=491

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  +GV  ED+NY+NA A  T  GDLKE+ A++RCFG N  L++N  KS  
Sbjct  357  GVILCVENALADAGVTKEDINYVNAHATSTQMGDLKEFEALVRCFGENPQLRVNSTKSMT  416

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA AAI AI  GW  PN     P++ +     LVG +KER D+K AL N 
Sbjct  417  GHLLGAAGGIEAVAAIQAIRTGWIHPNINLDNPEKNMD-VSLLVGSQKERCDVKVALSNS  475

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  476  FGFGGHNSSILFA  488



>ref|XP_004169836.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cucumis sativus]
Length=564

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNY+NA A  +   D+KEY A++ CFG N  L++N  KS 
Sbjct  429  AGVILCMEKALAQSGISKEDVNYVNAHATSSLAEDVKEYQALVHCFGKNRGLRVNSTKSM  488

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A I AI  GW  PN     PD+G+     LVG KKERL+IK AL N
Sbjct  489  VGHLLGAAGAVEAVATIQAIRTGWIHPNVNLENPDKGVD-TSILVGPKKERLEIKVALSN  547

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  548  SFGFGGHNSSILFA  561



>ref|XP_004144052.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66328.1| hypothetical protein Csa_1G597750 [Cucumis sativus]
Length=565

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNY+NA A  +   D+KEY A++ CFG N  L++N  KS 
Sbjct  430  AGVILCMEKALAQSGISKEDVNYVNAHATSSLAEDVKEYQALVHCFGKNRGLRVNSTKSM  489

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A I AI  GW  PN     PD+G+     LVG KKERL+IK AL N
Sbjct  490  VGHLLGAAGAVEAVATIQAIRTGWIHPNVNLENPDKGVD-TSILVGPKKERLEIKVALSN  548

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  549  SFGFGGHNSSILFA  562



>gb|AIL53812.1| beta-ketoacyl-[acyl carrier protein] synthase II [Gossypium hirsutum]
Length=525

 Score =   115 bits (287),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  ED+NYINA A  TP GD+KEY A++ CFG N  L++N  KS I
Sbjct  391  GVVRCIEKALAQSGVPREDINYINAHATSTPSGDIKEYQALLHCFGKNPELRVNSTKSMI  450

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     PD+ +     LVG KKERL++K AL N 
Sbjct  451  GHLLGAAGAVEAIAAVQAIRTGWVHPNINLENPDQEVD-TNVLVGPKKERLNVKAALSNS  509

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  510  FGFGGHNSSIIFA  522



>ref|XP_011072618.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=571

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  ED+NYINA A  TP  DL E  AI  CFG N+ L++N  KS I
Sbjct  431  GIVLCIEKALAESGVAREDINYINAHATSTPLADLIECQAINHCFGQNTELRMNSTKSMI  490

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN    +PDEG+     LVG K+ERLD+K AL N 
Sbjct  491  GHLLGAAGAVEAVATVKAIQTGWIHPNVNLERPDEGVD-ANILVGCKRERLDVKVALSNS  549

Query  40   FGFGGXNFXXXFA  2
             GFGG N    FA
Sbjct  550  LGFGGHNSSIVFA  562



>ref|XP_008450963.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Cucumis melo]
Length=566

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNY+NA A  +   D+KEY A++ CFG N  L++N  KS 
Sbjct  431  AGVILCMEKALAQSGISKEDVNYVNAHATSSLAEDVKEYQALVHCFGKNRELRVNSTKSM  490

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A I AI  GW  PN     PD+G+     LVG KKERL+IK AL N
Sbjct  491  VGHLLGAAGAVEAVATIQAIRTGWIHPNINLENPDKGVD-TSILVGPKKERLEIKVALSN  549

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  550  SFGFGGHNSSILFA  563



>ref|XP_011072620.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=567

 Score =   115 bits (288),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  ED+NYINA A  TP  DL E  AI  CFG N+ L++N  KS I
Sbjct  427  GIVLCIEKALAESGVAREDINYINAHATSTPLADLIECQAINHCFGQNTELRMNSTKSMI  486

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN    +PDEG+     LVG K+ERLD+K AL N 
Sbjct  487  GHLLGAAGAVEAVATVKAIQTGWIHPNVNLERPDEGVD-ANILVGCKRERLDVKVALSNS  545

Query  40   FGFGGXNFXXXFA  2
             GFGG N    FA
Sbjct  546  LGFGGHNSSIVFA  558



>ref|XP_006426741.1| hypothetical protein CICLE_v10027240mg [Citrus clementina]
 gb|ESR39981.1| hypothetical protein CICLE_v10027240mg [Citrus clementina]
Length=485

 Score =   114 bits (285),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  +GV  EDVNYINA A  T  GDL+EY ++IRCFG N  L++N  KS I
Sbjct  349  GMVSCMKKALAQAGVAREDVNYINAHAPSTRLGDLREYQSVIRCFGKNPELRMNSTKSLI  408

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GA EA A I AI  GW  PN     PD+ +   + LVG  KERL IK A+ N 
Sbjct  409  GHLLGASGAAEAVATIKAIQTGWIHPNLNLENPDKHVD-AKGLVGPMKERLHIKVAMSNS  467

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  468  FGFGGHNSSILFA  480



>tpg|DAA41443.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
Length=237

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  94   GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  153

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A+I AI  GW  PN     P++ +     LVG +KER ++K AL N 
Sbjct  154  GHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVG-ILVGSQKERCEVKVALSNS  212

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  213  FGFGGHNSSILFA  225



>gb|KJB65356.1| hypothetical protein B456_010G091400 [Gossypium raimondii]
Length=575

 Score =   115 bits (287),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 75/132 (57%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  T  GD+KE+ A++ CFG N  L++N  KS  
Sbjct  441  GAILCIEKALAQSGVAREDVNYINAHASSTAVGDIKEFQALLHCFGKNPKLRVNSTKSMT  500

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AAI AI  GW  PN     PDEG+     LVG KKERL++K AL N 
Sbjct  501  GHLLGAAGAVEAVAAIQAIRTGWVHPNINLENPDEGVD-ANVLVGPKKERLNVKAALSNS  559

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  560  FGFGGHNSSIIF  571



>ref|XP_004305765.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=575

 Score =   114 bits (286),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV  EDVNYINA A  TP  DL+EY A+I CFG N  L++N  KS I
Sbjct  442  GIALCIENALSHSGVSREDVNYINAYATSTPT-DLQEYRALIHCFGNNPELRVNSTKSMI  500

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G VEA A I AI  G+  PN     PD G+     LVG KKE+LDIK AL N 
Sbjct  501  GHLLGASGGVEAVATIKAIQTGFVHPNINLENPDAGVD-MNVLVGPKKEKLDIKVALSNS  559

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  560  FGFGGHNSSILFA  572



>ref|XP_007024704.1| Fatty acid biosynthesis 1 [Theobroma cacao]
 gb|EOY27326.1| Fatty acid biosynthesis 1 [Theobroma cacao]
Length=495

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
             G  LC  KAL  +GV  EDVNYINA A  T  GD +EY  ++  FG N  L+IN  KS 
Sbjct  360  TGMNLCIKKALDQAGVAKEDVNYINAFASSTQKGDQREYQTLMDHFGQNPQLRINSSKSM  419

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH  GA+GAVEA A I AI  GW  PN     PDEGL     LVG KKE+LDIK AL N
Sbjct  420  IGHLQGASGAVEAIATIKAIETGWIHPNINLDNPDEGLD-TNILVGPKKEQLDIKLALSN  478

Query  43   XFGFGGXNFXXXFA  2
             FG+GG N    FA
Sbjct  479  SFGYGGQNSSILFA  492



>ref|XP_011467454.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=555

 Score =   114 bits (285),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV  EDVNYINA A  TP  DL+EY A+I CFG N  L++N  KS I
Sbjct  422  GIALCIENALSHSGVSREDVNYINAYATSTPT-DLQEYRALIHCFGNNPELRVNSTKSMI  480

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G VEA A I AI  G+  PN     PD G+     LVG KKE+LDIK AL N 
Sbjct  481  GHLLGASGGVEAVATIKAIQTGFVHPNINLENPDAGVD-MNVLVGPKKEKLDIKVALSNS  539

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  540  FGFGGHNSSILFA  552



>ref|XP_011467455.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
 ref|XP_011467456.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=549

 Score =   114 bits (284),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 74/133 (56%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV  EDVNYINA A  TP  DL+EY A+I CFG N  L++N  KS I
Sbjct  416  GIALCIENALSHSGVSREDVNYINAYATSTPT-DLQEYRALIHCFGNNPELRVNSTKSMI  474

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G VEA A I AI  G+  PN     PD G+     LVG KKE+LDIK AL N 
Sbjct  475  GHLLGASGGVEAVATIKAIQTGFVHPNINLENPDAGVD-MNVLVGPKKEKLDIKVALSNS  533

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  534  FGFGGHNSSILFA  546



>tpg|DAA41444.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
 tpg|DAA41445.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
Length=306

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  163  GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  222

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A+I AI  GW  PN     P++ +     LVG +KER ++K AL N 
Sbjct  223  GHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVG-ILVGSQKERCEVKVALSNS  281

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  282  FGFGGHNSSILFA  294



>ref|NP_001169617.1| uncharacterized protein LOC100383498 precursor [Zea mays]
 gb|ACN34274.1| unknown [Zea mays]
 gb|AFW88074.1| hypothetical protein ZEAMMB73_812704 [Zea mays]
Length=494

 Score =   113 bits (282),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/133 (53%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV  ED+NYINA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  360  GVILCIENALADSGVTKEDINYINAHATSTQMGDLKEFEALNRCFGQNPQLRVNSTKSMT  419

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA AAI AI  GW  PN     P++ +   R LVG +KER D+K AL N 
Sbjct  420  GHLLGAAGGIEAVAAIQAIRTGWVHPNLNLDNPEKTVD-VRMLVGPQKERCDVKVALSNS  478

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  479  FGFGGHNSSILFA  491



>gb|KCW81914.1| hypothetical protein EUGRSUZ_C03291 [Eucalyptus grandis]
Length=526

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  +GV  EDVNYINA A  T  GD+ EY A+ RCFG N+ L++N  KS I
Sbjct  392  GIILCIENALAQAGVSKEDVNYINAHATSTMAGDIMEYQALTRCFGKNTELRVNSTKSMI  451

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P +G+     LVG  KER+D+K AL N 
Sbjct  452  GHLLGAAGAVEAVAAVQAIRTGWVHPNVNLESPADGVD-TSVLVGPTKERVDVKVALSNS  510

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  511  FGFGGHNSSILFA  523



>ref|XP_010049368.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW81915.1| hypothetical protein EUGRSUZ_C03291 [Eucalyptus grandis]
Length=553

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  +GV  EDVNYINA A  T  GD+ EY A+ RCFG N+ L++N  KS I
Sbjct  419  GIILCIENALAQAGVSKEDVNYINAHATSTMAGDIMEYQALTRCFGKNTELRVNSTKSMI  478

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA AA+ AI  GW  PN     P +G+     LVG  KER+D+K AL N 
Sbjct  479  GHLLGAAGAVEAVAAVQAIRTGWVHPNVNLESPADGVD-TSVLVGPTKERVDVKVALSNS  537

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  538  FGFGGHNSSILFA  550



>ref|XP_004984084.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X2 [Setaria italica]
Length=496

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV+ ED+NY+NA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  362  GVILCIENALADSGVRKEDINYVNAHATSTQMGDLKEFEALTRCFGQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA AAI AI  GW  PN     P++ +     LVG +KER D+K AL N 
Sbjct  422  GHLLGAAGGIEAVAAIQAIRTGWLHPNINLDNPEKNVD-VSLLVGQQKERCDVKVALSNS  480

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  481  FGFGGHNSSILFA  493



>gb|EMS61602.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Triticum 
urartu]
Length=435

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  301  GITLCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  360

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A I AI  GW  PN     P E +     LVG +KER ++K AL N 
Sbjct  361  GHLIGAAGGIEAVACIQAIRTGWVHPNLNLENP-EKVVDVGVLVGAEKERCEVKVALSNS  419

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  420  FGFGGHNSSILFA  432



>ref|XP_002973275.1| hypothetical protein SELMODRAFT_149056 [Selaginella moellendorffii]
 gb|EFJ25649.1| hypothetical protein SELMODRAFT_149056 [Selaginella moellendorffii]
Length=508

 Score =   112 bits (281),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 68/134 (51%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +GV  +DVNY+NA A  T  GD++EY AI+RCFG NS +K+N  KS 
Sbjct  370  AGILLCIEKALAQAGVDRQDVNYVNAHATSTRAGDVQEYKAIMRCFGSNSEIKVNSTKSM  429

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAG VEA A I AI  GW  P      P++ +     +VG  K++LD+K AL N
Sbjct  430  TGHLLGAAGGVEAIATIQAIRSGWVHPTINIDTPEKDVN-MEVIVGANKQKLDVKVALSN  488

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  489  SFGFGGHNSSVIFA  502



>ref|XP_002986735.1| hypothetical protein SELMODRAFT_158169 [Selaginella moellendorffii]
 gb|EFJ12298.1| hypothetical protein SELMODRAFT_158169 [Selaginella moellendorffii]
Length=512

 Score =   112 bits (281),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 68/134 (51%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  +GV  +DVNY+NA A  T  GD++EY AI+RCFG NS +K+N  KS 
Sbjct  374  AGILLCIEKALAQAGVDRQDVNYVNAHATSTQAGDVQEYKAIMRCFGSNSEIKVNSTKSM  433

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
             GH LGAAG VEA A I AI  GW  P      P++ +     +VG  K++LD+K AL N
Sbjct  434  TGHLLGAAGGVEAIATIQAIRSGWVHPTINIDTPEKDVN-MEVIVGANKQKLDVKVALSN  492

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  493  SFGFGGHNSSVIFA  506



>gb|EMT21411.1| 3-oxoacyl-(acyl-carrier-protein) synthase I, chloroplastic [Aegilops 
tauschii]
Length=517

 Score =   112 bits (281),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  383  GITLCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  442

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A I AI  GW  PN     P E +     LVG +KER ++K AL N 
Sbjct  443  GHLIGAAGGIEAVACIQAIRTGWVHPNLNLENP-EKVVDVGVLVGAEKERCEVKVALSNS  501

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  502  FGFGGHNSSILFA  514



>ref|XP_007024707.1| Fatty acid biosynthesis 1 [Theobroma cacao]
 gb|EOY27329.1| Fatty acid biosynthesis 1 [Theobroma cacao]
Length=492

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  EDVNY+NA A  T  GDL+E+ A+ RCFG N  L+IN  KS  
Sbjct  358  GMVLCIEKALADAGVAREDVNYVNAHAASTQIGDLREFRALFRCFGNNPELRINSTKSMT  417

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA GAVEA AAI AI  GW  PN     PD+G+     +VG  KERLD+K AL N 
Sbjct  418  GHLLGATGAVEAIAAIKAIQTGWIHPNINLDNPDKGVD-INLIVGPTKERLDVKVALSNS  476

Query  40   FGFGGXNFXXXFA  2
            F FGG N    FA
Sbjct  477  FAFGGQNSCILFA  489



>dbj|BAJ91001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 68/133 (51%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  361  GITLCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  420

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A + AI  GW  PN     P E +     LVG +KER ++K AL N 
Sbjct  421  GHLIGAAGGIEAVACVQAIRTGWVHPNLNLENP-EKVVDVGVLVGSEKERCEVKVALSNS  479

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  480  FGFGGHNSSILFA  492



>emb|CAA84022.1| beta-ketoacyl-ACP synthase [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 68/133 (51%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  361  GITLCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  420

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A + AI  GW  PN     P E +     LVG +KER ++K AL N 
Sbjct  421  GHLIGAAGGIEAVACVQAIRTGWVHPNLNLENP-EKVVDVGVLVGSEKERCEVKVALSNS  479

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  480  FGFGGHNSSILFA  492



>ref|XP_006651481.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like, 
partial [Oryza brachyantha]
Length=443

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  +GV  ED+NY+NA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  309  GVILCIENALADAGVAKEDINYVNAHATSTQMGDLKEFEALNRCFGHNPQLRVNSTKSMT  368

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA AA+ AI  GW  PN     P++ +     LVG +KER D+K AL N 
Sbjct  369  GHLLGAAGGIEAVAAVQAIRTGWVHPNINLDNPEKNVD-VNILVGSEKERCDVKVALSNS  427

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  428  FGFGGHNSSVLFA  440



>ref|XP_006658817.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Oryza brachyantha]
Length=439

 Score =   110 bits (274),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GD+KEY AI+RCFG N  L++N  KS  
Sbjct  305  GITLCIEKALADSGVAREEINYVNAHATSTQSGDVKEYEAIVRCFGQNPQLRVNSTKSMT  364

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA AA+ AI  GW  PN     P++ +     LVG KKER ++  AL N 
Sbjct  365  GHLIGAAGGIEAVAAVQAIRTGWVHPNLNLENPEKTVDVG-VLVGSKKERCEVNVALSNS  423

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  424  FGFGGHNSSILFA  436



>gb|EAZ42784.1| hypothetical protein OsJ_27364 [Oryza sativa Japonica Group]
Length=434

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  300  GIILCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  359

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA AAI AI  GW  PN     P E +     LVG +KER  +  AL N 
Sbjct  360  GHLIGAAGGIEAVAAIQAIRTGWVHPNLNLENP-EKIVDVGVLVGSQKERCKVNVALSNS  418

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  419  FGFGGHNSSILFA  431



>ref|XP_001768920.1| predicted protein [Physcomitrella patens]
 gb|EDQ66274.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 71/134 (53%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV+  DVNY+NA A  T  GDL+EY A+++ FG N  LK+N  KS 
Sbjct  270  AGVLLCIEKALAQSGVERGDVNYVNAHATSTKAGDLQEYKALVKAFGSNPELKVNSTKSM  329

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGA+EA A I AI  GW  P      P E L     +VG +K+RLDIK AL N
Sbjct  330  VGHLLGAAGAIEAIATIQAIRTGWVHPTINLENP-ESLVDMNVIVGAEKQRLDIKVALSN  388

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  389  SFGFGGHNSSVLFA  402



>gb|KDO45712.1| hypothetical protein CISIN_1g037985mg [Citrus sinensis]
Length=520

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GD +E+ A++ CFG N  L++N  KS  
Sbjct  386  GAVACMEKALTNSGVSREDVNYINAHATSTRVGDPREFKAVMHCFGQNPELRMNSTKSMT  445

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK A+ N 
Sbjct  446  GHLLGAAGAVEAIATVKAIQTGWIHPNINLENPDKDVD-TKVLVGPKKERLDIKVAMSNS  504

Query  40   FGFGGXNFXXXFA  2
              FGG N    FA
Sbjct  505  LSFGGHNSSILFA  517



>ref|NP_001060274.1| Os07g0616200 [Oryza sativa Japonica Group]
 dbj|BAC79989.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase [Oryza sativa 
Japonica Group]
 dbj|BAF22188.1| Os07g0616200 [Oryza sativa Japonica Group]
 dbj|BAG90343.1| unnamed protein product [Oryza sativa Japonica Group]
Length=507

 Score =   110 bits (274),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  373  GIILCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  432

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA AAI AI  GW  PN     P E +     LVG +KER  +  AL N 
Sbjct  433  GHLIGAAGGIEAVAAIQAIRTGWVHPNLNLENP-EKIVDVGVLVGSQKERCKVNVALSNS  491

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  492  FGFGGHNSSILFA  504



>gb|EAZ04708.1| hypothetical protein OsI_26869 [Oryza sativa Indica Group]
Length=507

 Score =   110 bits (274),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  373  GIILCIEKALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  432

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA AAI AI  GW  PN     P E +     LVG +KER  +  AL N 
Sbjct  433  GHLIGAAGGIEAVAAIQAIRTGWVHPNLNLENP-EKIVDVGVLVGSQKERCKVNVALSNS  491

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  492  FGFGGHNSSILFA  504



>ref|XP_006426746.1| hypothetical protein CICLE_v10025485mg [Citrus clementina]
 gb|ESR39986.1| hypothetical protein CICLE_v10025485mg [Citrus clementina]
Length=485

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GD +E+ A++ CFG N  L++N  KS  
Sbjct  351  GAVACMEKALTNSGVSREDVNYINAHATSTRVGDPREFKAVMHCFGQNPELRMNSTKSMT  410

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI  GW  PN     PD+ +   + LVG KKERLDIK A+ N 
Sbjct  411  GHLLGAAGAVEAIATVKAIQTGWIHPNINLENPDKDVD-TKVLVGPKKERLDIKVAMSNS  469

Query  40   FGFGGXNFXXXFA  2
              FGG N    FA
Sbjct  470  LSFGGHNSSILFA  482



>ref|XP_001773138.1| predicted protein [Physcomitrella patens]
 gb|EDQ61991.1| predicted protein [Physcomitrella patens]
Length=556

 Score =   109 bits (272),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 71/134 (53%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV   DVNY+NA A  T  GDL+EY A+++ FG N  LK+N  KS 
Sbjct  415  AGVLLCIEKALAQSGVNKTDVNYVNAHATSTKAGDLQEYKALMKAFGGNPELKVNSTKSM  474

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A I AI  GW  P      P E       +VG +K+RLDIK AL N
Sbjct  475  VGHLLGAAGAVEAIATIQAIRSGWVHPTINLEDP-ESEVDMNVIVGDEKQRLDIKVALSN  533

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  534  SFGFGGHNSSILFA  547



>gb|KJB34912.1| hypothetical protein B456_006G090100 [Gossypium raimondii]
Length=517

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = -1

Query  388  CXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXIGHXL  209
            C  KAL  +GV  EDVNYINA A  T  GDL E+ A++RCFG N  L+IN  KS  GH  
Sbjct  385  CIEKALAKAGVAREDVNYINAHAPSTQVGDLIEFAALVRCFGNNMELRINSTKSMTGHLA  444

Query  208  GaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNXFGFG  29
            GA GAV+A A I AI  GW  PN     PD+ +     LVG KKERL+IK AL N F  G
Sbjct  445  GATGAVDAIATIKAIQTGWVHPNINLDNPDKAV-DMNLLVGSKKERLNIKVALSNSFTLG  503

Query  28   GXNFXXXFA  2
            G N    FA
Sbjct  504  GQNSSILFA  512



>ref|XP_002463181.1| hypothetical protein SORBIDRAFT_02g039230 [Sorghum bicolor]
 gb|EER99702.1| hypothetical protein SORBIDRAFT_02g039230 [Sorghum bicolor]
Length=496

 Score =   108 bits (270),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  362  GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A++ AI  GW  PN     P++ +     LVG +KER ++K AL N 
Sbjct  422  GHLIGAAGGIEAVASVQAIRTGWVHPNLNLENPEDTVDVG-VLVGSQKERCEVKVALSNS  480

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  481  FGFGGHNSSILFA  493



>gb|ACG25173.1| 3-oxoacyl-synthase I [Zea mays]
Length=496

 Score =   108 bits (270),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  362  GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A+I AI  GW  PN     P++ +     LVG +KER ++K AL N 
Sbjct  422  GHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVG-ILVGSQKERCEVKVALSNS  480

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  481  FGFGGHNSSILFA  493



>emb|CAA84023.1| beta-ketoacyl-ACP synthase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89798.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  +GV  +D+NY+NA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  356  GVILCVENALADAGVTRQDINYVNAHATSTQLGDLKEFEALRRCFGQNPQLRVNSTKSMT  415

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA AAI AI  GW  PN     P++ +     LVG +KER D+K AL N 
Sbjct  416  GHLLGAAGGIEAVAAIQAIRTGWIHPNINLNNPEKNVD-VSLLVGSQKERCDVKVALSNS  474

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  475  FGFGGHNSSILFA  487



>ref|NP_001132041.1| uncharacterized protein LOC100193451 precursor [Zea mays]
 gb|ACF80721.1| unknown [Zea mays]
 tpg|DAA41446.1| TPA: LOW QUALITY PROTEIN: 3-oxoacyl-synthase I [Zea mays]
Length=505

 Score =   108 bits (270),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  362  GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A+I AI  GW  PN     P++ +     LVG +KER ++K AL N 
Sbjct  422  GHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVG-ILVGSQKERCEVKVALSNS  480

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  481  FGFGGHNSSILFA  493



>ref|XP_009380020.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   108 bits (270),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNY+NA A  T  GDLKEY A++ CFG N  L++N  KS  
Sbjct  422  GIVLCIEKALSESGVSREDVNYVNAHATSTLSGDLKEYQALMCCFGKNPELRVNSTKSMT  481

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A + AI   W  PN     P++ +     LVG KKERLD+K A+ N 
Sbjct  482  GHLLGAAGAVEAVAVVQAIRTRWVHPNINLDNPEKSVD-VNLLVGSKKERLDVKVAVSNS  540

Query  40   FGFGGXN  20
            FGFGG N
Sbjct  541  FGFGGHN  547



>ref|XP_001768994.1| predicted protein [Physcomitrella patens]
 gb|EDQ66192.1| predicted protein [Physcomitrella patens]
Length=546

 Score =   108 bits (270),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  +AL  +GV   DVNY+NA A  T  GDL+EY A++R FG N  L+IN  KS 
Sbjct  406  AGVLLCIDRALSQAGVNRHDVNYVNAHATSTKAGDLQEYKALMRSFGQNPELRINSTKSM  465

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGA+GAVEA A + AI  GW  P      P+  +   + +VG +K +LDIK AL N
Sbjct  466  IGHLLGASGAVEAIATVQAIRTGWVHPTINLDNPENDVD-MKVIVGGEKRKLDIKVALSN  524

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  525  SFGFGGQNSSILFA  538



>ref|XP_008651372.1| PREDICTED: uncharacterized protein LOC100280304 isoform X1 [Zea 
mays]
 tpg|DAA63605.1| TPA: hypothetical protein ZEAMMB73_843178 [Zea mays]
Length=496

 Score =   107 bits (268),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  362  GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A+I AI  GW  PN     P++ +     LVG +KER ++K AL N 
Sbjct  422  GHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVG-VLVGSQKERCEVKVALSNS  480

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  481  FGFGGHNSSILFA  493



>ref|XP_007514613.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14853.1| predicted protein [Bathycoccus prasinos]
Length=519

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 79/134 (59%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  L   +ALK +GV  EDVNYINA A  TP GDL E   I   FG NS LKIN  KS 
Sbjct  372  AGVRLAIGRALKNAGVLAEDVNYINAHATSTPAGDLAELRTITDIFGENSELKINSTKSL  431

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAA AVEA A I AI  G   PN     PDEG+     LVG  KE+L +K AL N
Sbjct  432  IGHLLGAASAVEAVAVIKAIGTGELHPNKNLEDPDEGVRTD-LLVGTTKEKLKVKVALSN  490

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  491  SFGFGGHNSAVLFA  504



>ref|XP_003562655.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Brachypodium distachyon]
Length=496

 Score =   107 bits (268),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 68/133 (51%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SG   E++NY+NA A  T  GDLKEY AI+RCFG N  L++N  KS  
Sbjct  362  GITLCIEKALADSGAAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH +GAAG +EA A I AI  G+  PN     P E +     LVG KKER ++K AL N 
Sbjct  422  GHLIGAAGGIEAVAVIQAIRTGFVHPNLNLENP-EKIVDVGVLVGSKKERCEVKVALSNS  480

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  481  FGFGGHNSSILFA  493



>ref|XP_001763306.1| predicted protein [Physcomitrella patens]
 gb|EDQ71836.1| predicted protein [Physcomitrella patens]
Length=481

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 70/134 (52%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SGV   DVNY+NA A  T  GDL+EY A+++ FG N  LK+N  KS 
Sbjct  341  AGVLLCIEKALAQSGVNKADVNYVNAHATSTKAGDLQEYKALMKVFGGNPELKVNSTKSM  400

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            +GH LGAAGAVEA A I AI  GW  P      P E       +VG +K+ LDIK AL N
Sbjct  401  VGHLLGAAGAVEAIATIQAIRTGWVHPTINLENP-ESEVDLNVIVGGEKQELDIKVALSN  459

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  460  SFGFGGQNSSVLFA  473



>ref|XP_002989269.1| hypothetical protein SELMODRAFT_129433, partial [Selaginella 
moellendorffii]
 gb|EFJ09707.1| hypothetical protein SELMODRAFT_129433, partial [Selaginella 
moellendorffii]
Length=420

 Score =   104 bits (260),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV+ +DVNY+NA A  T  GD++EY AI++  G N+ L++N  KS +
Sbjct  280  GMLLCIEKALDQSGVRRDDVNYVNAHAASTRSGDVQEYKAIMQSLGDNTELRVNSTKSMM  339

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAV+A A I AI  GW  P      P++ +     +VG +K+R D+K AL N 
Sbjct  340  GHLLGAAGAVDAIATIQAIKTGWLHPTINIENPEKDVNMD-YIVGSQKQRFDVKVALSNS  398

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  399  FGFGGHNSSILFA  411



>ref|XP_002965643.1| hypothetical protein SELMODRAFT_230708 [Selaginella moellendorffii]
 gb|EFJ33063.1| hypothetical protein SELMODRAFT_230708 [Selaginella moellendorffii]
Length=411

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV+ +DVNY+NA A  T  GD++EY AI++  G N+ L++N  KS +
Sbjct  271  GMLLCIEKALDQSGVRRDDVNYVNAHAASTRSGDVQEYKAIMQSLGDNTELRVNSTKSMM  330

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAV+A A I AI  GW  P      P++ +     +VG +K+R D+K AL N 
Sbjct  331  GHLLGAAGAVDAIATIQAIKTGWLHPTINIENPEKDVNMD-YIVGSQKQRFDVKVALSNS  389

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  390  FGFGGHNSSILFA  402



>ref|XP_006426733.1| hypothetical protein CICLE_v10025676mg [Citrus clementina]
 gb|ESR39973.1| hypothetical protein CICLE_v10025676mg [Citrus clementina]
Length=426

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  KAL  SGV  EDVNYINA A  T  GDL+EY A          L++N  KS I
Sbjct  300  GMVSCMEKALAKSGVAKEDVNYINAHAPSTRLGDLREYQA----------LRMNSTKSLI  349

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+GA EA A I AI  GW  PN     PD+ +   + LVG KKERLDIK A+ N 
Sbjct  350  GHLLGASGAAEAVATIKAIQTGWIHPNLNLENPDKHV-DAKVLVGPKKERLDIKVAMSNS  408

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  409  FGFGGHNSSILFA  421



>ref|XP_010554926.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like, 
partial [Tarenaya hassleriana]
Length=497

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 63/111 (57%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL+ +G+  EDVNYINA A  TP GDLKEY A++ CFG N  LK+N  KS 
Sbjct  383  AGVILCIENALEQAGISREDVNYINAHATSTPAGDLKEYQALVHCFGQNPELKVNSTKSM  442

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKER  71
            +GH LGAAGAVEA A + AI  GW  PN     PDEG+   + LVG KKER
Sbjct  443  VGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDEGVD-TKLLVGPKKER  492



>gb|KEH37629.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=451

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC  KAL  SG+  EDVNYINA A  TP GDLKEY A+I CFG N  LK+N  KS 
Sbjct  353  AGVILCIEKALANSGISKEDVNYINAHATSTPAGDLKEYQALIHCFGQNPELKVNSTKSM  412

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGL  110
            IGH LGAAG VEA A I AI  GW  PN     PDE +
Sbjct  413  IGHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEAV  450



>emb|CAN69528.1| hypothetical protein VITISV_027246 [Vitis vinifera]
Length=664

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  EDVNYINA A  TP GDLKE+ A+IRCFG N  L++N  KS I
Sbjct  494  GVVLCIEKALAQAGVAREDVNYINAHATSTPSGDLKEFQALIRCFGQNPKLRVNSTKSMI  553

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGL  110
            GH LGA+GAVEA A + AI  GW  PN     PD+G+
Sbjct  554  GHLLGASGAVEAVATVKAIQTGWVHPNINLENPDQGV  590



>ref|XP_001421280.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99573.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=412

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 76/133 (57%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G      KAL+ +GVK EDVNYINA A  TP GD+ E   + + F   S  KIN  KS I
Sbjct  275  GVNFAIDKALEMTGVKAEDVNYINAHATSTPAGDMAELRVLQKKFKA-SGAKINSTKSLI  333

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAA AVEA   I AI  G   PN     PDEG+     LVG  +E+LD+K AL N 
Sbjct  334  GHLLGAASAVEAVVCIKAITSGEVHPNKNLETPDEGVD-TSMLVGTTREKLDVKVALSNS  392

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  393  FGFGGHNSAVLFA  405



>ref|XP_001421246.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99539.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=412

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 67/133 (50%), Positives = 76/133 (57%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G      KAL+ +GVK EDVNYINA A  TP GD+ E   + + F   S  KIN  KS I
Sbjct  275  GVNFAIDKALEMTGVKAEDVNYINAHATSTPAGDMAELRVLQKKFKA-SGAKINSTKSLI  333

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAA AVEA   I AI  G   PN     PDEG+     LVG  +E+LD+K AL N 
Sbjct  334  GHLLGAASAVEAVVCIKAITSGEVHPNKNLETPDEGVD-TSMLVGTTREKLDVKVALSNS  392

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  393  FGFGGHNSAVLFA  405



>ref|XP_006597884.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Glycine max]
Length=468

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 57/97 (59%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  S +  EDVNYINA A  TP GDLKEY A+I CFG N  L++N  KS I
Sbjct  345  GVILCMEKALNHSRISREDVNYINAHATSTPIGDLKEYKALIHCFGQNLELRVNSTKSMI  404

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGL  110
            GH LGAAG VEA A I AI  GW  PN     PDEG+
Sbjct  405  GHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEGV  441



>ref|XP_003083296.1| Animal-type fatty acid synthase and related proteins (ISS) [Ostreococcus 
tauri]
 emb|CAL57571.1| Thiolase-like, subgroup [Ostreococcus tauri]
Length=489

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 66/133 (50%), Positives = 76/133 (57%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  +   KAL+ + VK +DVNYINA A  TP GDL E   + + F   S  KIN  KS I
Sbjct  352  GVNMAIDKALELANVKADDVNYINAHATSTPAGDLAELRVLQKKFKA-SGAKINSTKSLI  410

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAA AVEA   I AI  G   PN     PDEG+     LVG  +E+LD+K AL N 
Sbjct  411  GHLLGAASAVEAVVCIKAIMSGEVHPNINLETPDEGVD-TSMLVGSTREKLDVKVALSNS  469

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  470  FGFGGHNSAVLFA  482



>gb|KDO73815.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=557

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  EDVNYINA A  TP GD+KEY A+I CFG N  L++N  KS I
Sbjct  442  GVILCIEKALAHSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRGLRVNSTKSMI  501

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPD  119
            GH LGAAGAVEA A + AI  GW  PN     PD
Sbjct  502  GHLLGAAGAVEAIAVVQAIRTGWIHPNINLENPD  535



>ref|XP_002505037.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66295.1| predicted protein [Micromonas sp. RCC299]
Length=430

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 74/133 (56%), Gaps = 1/133 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  L   +ALK SGV    VNY+NA A  TP GD+ E   + R FG NS  KIN  K  I
Sbjct  292  GVQLAITRALKDSGVDASAVNYVNAHATSTPAGDMAELRVLQRMFGKNSEFKINSTKGLI  351

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAA AVEA A + AI  G   PN     P++ +     LVG + ERLD++ AL N 
Sbjct  352  GHLLGAASAVEAVACVKAIQCGEVHPNINLEDPEDDVEMG-LLVGGESERLDVRVALSNS  410

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F 
Sbjct  411  FGFGGHNSAVLFG  423



>ref|XP_002950994.1| hypothetical protein VOLCADRAFT_104947 [Volvox carteri f. nagariensis]
 gb|EFJ47888.1| hypothetical protein VOLCADRAFT_104947 [Volvox carteri f. nagariensis]
Length=462

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  +C  +AL  SGV  EDVNY+NA A  T  GD+ EY AI R F  +  L++N  KS I
Sbjct  328  GVIMCLERALASSGVSAEDVNYVNAHATSTQAGDMAEYRAINRVFN-HEQLRMNSTKSMI  386

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LG AGAVEA AAI AI  GW  P      P+ G+ P R + G K+    +K AL N 
Sbjct  387  GHLLGGAGAVEAVAAIKAIQTGWLHPTINLHDPENGVDPVRVVAGVKQHH-PVKVALSNS  445

Query  40   FGFGGXN  20
            FGFGG N
Sbjct  446  FGFGGHN  452



>ref|XP_003060578.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55347.1| predicted protein [Micromonas pusilla CCMP1545]
Length=564

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  L   +AL   G+  +DV+Y+NA A  TP GD+ E   +   FG N   KIN  K  I
Sbjct  389  GVALAIDRALDACGLDAKDVDYVNAHATSTPAGDMAELRVLQEKFGKNPGFKINSTKGMI  448

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAA AVEA A + AI  GW  PN     P++ +     LVG  KERLD+K AL N 
Sbjct  449  GHLLGAASAVEAVACVKAITDGWVHPNVNLDDPEDDVDLA-LLVGPTKERLDVKVALSNS  507

Query  40   FGFGGXN  20
            FGFGG +
Sbjct  508  FGFGGAS  514



>ref|XP_009404185.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
synthase II, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=402

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
             G  LC  KAL  SGV  EDVN++NA A  T  GDLKEY A+I CFG N  L++N  KS 
Sbjct  295  TGIVLCIEKALSESGVFREDVNHVNAHATSTLSGDLKEYQALIHCFGKNPKLRVNSTKSM  354

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDE  116
             GH LGAAGAVEA A + AI  GW  PN    KP+E
Sbjct  355  TGHLLGAAGAVEAVAVVQAIRTGWVHPNINLDKPEE  390



>ref|XP_001700152.1| 3-ketoacyl-ACP-synthase [Chlamydomonas reinhardtii]
 gb|EDO98446.1| 3-ketoacyl-ACP-synthase [Chlamydomonas reinhardtii]
Length=459

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  +C  +AL  +G+   DVNY+NA A  T  GD+ EY AI   F  +S L+IN  KS I
Sbjct  325  GVIMCLQRALASTGLSASDVNYVNAHATSTQAGDMAEYRAINTVFN-HSDLRINATKSMI  383

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LG A AVEA A I AI  GW  P+     P+ G+   R + G K+    IK AL N 
Sbjct  384  GHLLGGASAVEAVATIKAIQTGWLHPSINLHTPEAGVDLVRVVAGAKQHH-PIKVALSNS  442

Query  40   FGFGGXN  20
            FGFGG N
Sbjct  443  FGFGGHN  449



>ref|XP_011072621.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X3 [Sesamum indicum]
Length=551

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 71/133 (53%), Gaps = 21/133 (16%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  SGV  ED+NYINA A  TP  DL E  AI  CFG N+ L++N  KS I
Sbjct  431  GIVLCIEKALAESGVAREDINYINAHATSTPLADLIECQAINHCFGQNTELRMNSTKSMI  490

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A                      +     LVG K+ERLD+K AL N 
Sbjct  491  GHLLGAAGAVEAVAT---------------------VKDANILVGCKRERLDVKVALSNS  529

Query  40   FGFGGXNFXXXFA  2
             GFGG N    FA
Sbjct  530  LGFGGHNSSIVFA  542



>tpg|DAA41442.1| TPA: hypothetical protein ZEAMMB73_227409 [Zea mays]
Length=245

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KAL  +GV  E++NY+NA A  T  GDLKEY AI+RCF  N  L++N  KS  
Sbjct  94   GITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSMT  153

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDE  116
            GH +GAAG +EA A+I AI  GW  PN     P++
Sbjct  154  GHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPED  188



>ref|XP_002961627.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
 gb|EFJ36887.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
Length=384

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  K+L+ +G+  E+VNYINA A  T  GDL E  AI + F  +S +KIN  KS I
Sbjct  250  GVSTCIEKSLEDAGLSPEEVNYINAHATSTVVGDLAEINAIKKVFSESSDIKINATKSMI  309

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A I AI  GW  P      P+  +   R  V   K++ ++  A+ N 
Sbjct  310  GHCLGAAGGMEAIAVIKAITTGWLHPTINQFDPEPSVNFDR--VANVKKQHEVNVAISNS  367

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  368  FGFGGHNSVVVFA  380



>ref|XP_011398918.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic, 
partial [Auxenochlorella protothecoides]
 gb|KFM26022.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic, 
partial [Auxenochlorella protothecoides]
Length=442

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  + L  +GV  E+V Y+NA    TP GD+ E+ AI    G +  L+IN  K  I
Sbjct  308  GVRLCLERGLAAAGVAPEEVTYVNAHGTSTPAGDVAEFRAIRAVLGHDG-LRINSSKGAI  366

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I A+  GW  PN    +PD+G+     LVG  KE+ D+K AL N 
Sbjct  367  GHLLGAAGAVEAVATIQALRTGWLHPNLNLDEPDKGVD-ASVLVGGVKEQADVKVALSNS  425

Query  40   FGFGGXN  20
            FGFGG N
Sbjct  426  FGFGGHN  432



>ref|XP_010917434.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=477

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  K+L+ +GV  E+VNYINA A  TP GDL E  AI + F   S +KIN  KS I
Sbjct  343  GVSSCIQKSLEHAGVAPEEVNYINAHATSTPAGDLAEVNAIKQVFKNPSDVKINATKSMI  402

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P      P+  +      V  KK++ ++  A+ N 
Sbjct  403  GHCLGAAGGLEAIATVKAIATGWLHPTINQFNPEPAV--EFDTVANKKQQHEVNVAISNS  460

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  461  FGFGGHNSVVVFA  473



>ref|XP_011011532.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=466

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  332  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMI  391

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  392  GHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSV--EFDTVANKKQQHEVNVAISNS  449

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  450  FGFGGHNSVVAFS  462



>ref|XP_011096538.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Sesamum indicum]
Length=472

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   AL+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  338  GVSSCIQSALEDAGVSPEEVNYINAHATSTVVGDLAEVNAIKKVFKNTSGIKINATKSMI  397

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P      P+  +      V  KK++ ++  A+ N 
Sbjct  398  GHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE--FDTVANKKQQHEVNVAISNS  455

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  456  FGFGGHNSVVAFS  468



>gb|KJB66778.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=337

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  203  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSDIKINATKSMI  262

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V  +K++ ++  A+ N 
Sbjct  263  GHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSV--EFDTVANQKKQHEVNVAISNS  320

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  321  FGFGGHNSVVAFS  333



>ref|XP_010319078.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Solanum lycopersicum]
Length=150

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            +G  LC   AL  SGVK EDVNYIN  A  TP GDL EY AI+ CFG N  LKIN  KS 
Sbjct  57   SGVVLCIENALAQSGVKHEDVNYINVHAASTPAGDLNEYQAILHCFGKNPELKINSTKSM  116

Query  223  IGHXLG  206
             GH LG
Sbjct  117  TGHLLG  122



>gb|KJB66775.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=347

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  213  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSDIKINATKSMI  272

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V  +K++ ++  A+ N 
Sbjct  273  GHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSV--EFDTVANQKKQHEVNVAISNS  330

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  331  FGFGGHNSVVAFS  343



>ref|XP_004984083.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X1 [Setaria italica]
Length=521

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV+ ED+NY+NA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  362  GVILCIENALADSGVRKEDINYVNAHATSTQMGDLKEFEALTRCFGQNPQLRVNSTKSMT  421

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGL  110
            GH LGAAG +EA AAI AI  GW  PN     P++ +
Sbjct  422  GHLLGAAGGIEAVAAIQAIRTGWLHPNINLDNPEKNV  458



>gb|KHG12491.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=473

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  339  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSGIKINATKSMI  398

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A++ AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  399  GHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSVE--FDTVANKKQQHEVNVAISNS  456

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  457  FGFGGHNSVVAFS  469



>gb|KJB57278.1| hypothetical protein B456_009G156400 [Gossypium raimondii]
Length=473

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  339  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSGIKINATKSMI  398

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  399  GHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVE--FDTVANKKQQHEVNVAISNS  456

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  457  FGFGGHNSVVAFS  469



>gb|KHN28969.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=305

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 71/133 (53%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   +L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  171  GVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKDTSGIKINATKSMI  230

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P      P+  +      V   K++ +I  A+ N 
Sbjct  231  GHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAV--DFDTVANVKQQHEINVAISNS  288

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  289  FGFGGHNSVVAFS  301



>ref|XP_002305334.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE85845.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=471

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  337  GVSSCIERSLEDAGVSPEEVNYINAHATSTIAGDLAEINAIKKVFKNTSGIKINATKSMI  396

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A++ AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  397  GHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSV--EFDTVANKKQQHEVNVAISNS  454

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  455  FGFGGHNSVVVFS  467



>ref|XP_002960175.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
 ref|XP_002967530.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ32129.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ37714.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
Length=430

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  K+L+ +GV  E+VNYINA A  T  GDL E  AI + F  +S +KIN  KS I
Sbjct  296  GVSTCISKSLEDAGVSPEEVNYINAHATSTVVGDLAEINAIKKVFSESSDIKINATKSMI  355

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A I AI  GW  P+     P+  +  P   V   K++ ++  A+ N 
Sbjct  356  GHCLGAAGGLEAIAVIKAITTGWLHPSINQFDPEPSV--PFDRVANVKKQHEVNVAISNS  413

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  414  FGFGGHNSVVVFA  426



>ref|XP_002519707.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|AAA33873.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR12416.1| plastid 3-keto-acyl-ACP synthase I [Ricinus communis]
 gb|EEF42680.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 dbj|BAM75183.1| ketoacyl-acyl carrier protein synthase [Ricinus communis]
Length=469

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  335  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSDIKINATKSMI  394

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P      P+  +      V  KK++ ++  A+ N 
Sbjct  395  GHCLGAAGGLEAIACVKAITTGWLHPTINQFNPEPSV--EFDTVANKKQQHEVNVAISNS  452

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  453  FGFGGHNSVVAFS  465



>ref|XP_002964698.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
 gb|EFJ33536.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
Length=406

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  K+L+ +GV  E+VNYINA A  T  GDL E  AI + F  +S +KIN  KS I
Sbjct  272  GVSTCIEKSLEDAGVSPEEVNYINAHATSTVVGDLAEINAIKKVFSESSDIKINATKSMI  331

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A I AI  GW  P      P+  +   R  V   K++ ++  A+ N 
Sbjct  332  GHCLGAAGGMEAIAVIKAITTGWLHPTINQFDPEPSVNFDR--VANVKKQHEVNVAISNS  389

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  390  FGFGGHNSVVVFA  402



>ref|XP_011012842.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Populus euphratica]
Length=471

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 75/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  337  GVSSCIERSLEDAGVSPEEVNYINAHAPSTIAGDLAEINAIRKVFKNTSGIKINATKSMI  396

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A++ AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  397  GHCLGAAGGLEAIASVKAITTGWLHPSINQFNPEPSV--EFDTVANKKQQHEVNVAISNS  454

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  455  FGFGGHNSVVVFS  467



>ref|NP_001152921.1| uncharacterized protein LOC100279917 [Zea mays]
 gb|ACL53726.1| unknown [Zea mays]
Length=321

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++LK +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  187  GVSSCIKQSLKDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMI  246

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A I AI  GW  P+     P+E +      V   K++ ++   + N 
Sbjct  247  GHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEEAV--EFDTVPNVKKQHEVNVGISNS  304

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  305  FGFGGHNSVVVFA  317



>ref|WP_006340838.1| 3-oxoacyl-ACP synthase [Parachlamydia acanthamoebae]
 gb|EFB41814.1| hypothetical protein pah_c022o107 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86299.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Parachlamydia 
acanthamoebae UV-7]
 gb|KIA77957.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Parachlamydia acanthamoebae]
Length=419

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 70/135 (52%), Gaps = 7/135 (5%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  KALK +G+  ED+NY+NA A  TP GD+ E  A+       S + +N  KS I
Sbjct  282  GVALCIKKALKDAGISAEDINYVNAHATSTPVGDMAEVNALKLILPNPSKVVMNATKSII  341

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGL--XPPRXLVGFKKERLDIKXALX  47
            GH LGAAG VEA   + AI  G   P      P+ GL    PR       E L IK AL 
Sbjct  342  GHCLGAAGGVEAIVTVKAIAEGKVHPTLNLENPEPGLDFHVPRT-----AEELTIKAALS  396

Query  46   NXFGFGGXNFXXXFA  2
            N FGFGG N    FA
Sbjct  397  NSFGFGGHNATLVFA  411



>gb|KHG12107.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=474

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  340  GVSSCIERSLEDAGVSHEEVNYINAHATSTLAGDLAEINAIKKVFKNTSDIKINATKSMI  399

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V  +K++ ++  A+ N 
Sbjct  400  GHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVE--FDTVANQKKQHEVNVAISNS  457

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  458  FGFGGHNSVVAFS  470



>ref|XP_002316735.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE97347.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=466

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  332  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMI  391

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V  KK++  +  A+ N 
Sbjct  392  GHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSV--EFDTVANKKQQHAVNVAISNS  449

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  450  FGFGGHNSVVAFS  462



>ref|XP_010932374.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
isoform X5 [Elaeis guineensis]
Length=551

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL  +GV  EDVNY+NA A  TP GDLKEY A+IRCFG N  L++N  KS 
Sbjct  439  AGIALCIENALAQAGVAKEDVNYVNAHATSTPAGDLKEYQALIRCFGQNPELRVNSTKSM  498

Query  223  IGHXLG  206
            IGH LG
Sbjct  499  IGHLLG  504



>gb|KJB66777.1| hypothetical protein B456_010G165600 [Gossypium raimondii]
Length=473

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  339  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSDIKINATKSMI  398

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V  +K++ ++  A+ N 
Sbjct  399  GHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVE--FDTVANQKKQHEVNVAISNS  456

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  457  FGFGGHNSVVAFS  469



>gb|AFW88073.1| hypothetical protein ZEAMMB73_812704 [Zea mays]
Length=484

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV  ED+NYINA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  360  GVILCIENALADSGVTKEDINYINAHATSTQMGDLKEFEALNRCFGQNPQLRVNSTKSMT  419

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDE  116
            GH LGAAG +EA AAI AI  GW  PN     P++
Sbjct  420  GHLLGAAGGIEAVAAIQAIRTGWVHPNLNLDNPEK  454



>gb|AAC04691.1| beta-ketoacyl-ACP synthase I [Perilla frutescens]
Length=474

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   AL+ SGV  E+VNYINA A  T  GDL +  AI + F   S +KIN  KS I
Sbjct  340  GVSSCIQSALEDSGVSPEEVNYINAHATSTIVGDLADVNAIKKVFKNTSGIKINATKSMI  399

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A++ AI  GW  P      P+  +      V  +K++ ++  A+ N 
Sbjct  400  GHCLGAAGGLEAIASVKAITTGWLHPTINQFNPEPSIG--FDTVANEKQQHEVNVAISNS  457

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  458  FGFGGHNSVVAFS  470



>ref|XP_005642959.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE18415.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
Length=464

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 76/132 (58%), Gaps = 2/132 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC  K+L+ +G+  E+VNY+NA A  T  GDL EY AI   F   S L+IN  KS I
Sbjct  330  GVLLCIQKSLEQAGISPEEVNYVNAHATSTQAGDLAEYRAIRAAF-PGSDLRINGTKSMI  388

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAGAVEA A I AI  G+  P      P++ +     +VG  K+ +D+  AL N 
Sbjct  389  GHLLGAAGAVEAIATIQAIRTGYLHPTINVEDPEDEVDMG-VIVGASKQAMDVNVALSNS  447

Query  40   FGFGGXNFXXXF  5
            FGFGG N    F
Sbjct  448  FGFGGHNSSILF  459



>ref|XP_006467495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
 gb|KDO78133.1| hypothetical protein CISIN_1g012221mg [Citrus sinensis]
Length=468

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   +L+ +GV  E+VNYINA A  T  GDL E  AI + F   + +KIN  KS I
Sbjct  334  GVSSCIESSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTTGIKINATKSMI  393

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  394  GHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSV--EFDTVANKKQQHEVNVAISNS  451

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  452  FGFGGHNSVVAFS  464



>gb|AFW88075.1| hypothetical protein ZEAMMB73_812704 [Zea mays]
Length=466

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G  LC   AL  SGV  ED+NYINA A  T  GDLKE+ A+ RCFG N  L++N  KS  
Sbjct  360  GVILCIENALADSGVTKEDINYINAHATSTQMGDLKEFEALNRCFGQNPQLRVNSTKSMT  419

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDE  116
            GH LGAAG +EA AAI AI  GW  PN     P++
Sbjct  420  GHLLGAAGGIEAVAAIQAIRTGWVHPNLNLDNPEK  454



>gb|AGH32916.1| ketoacyl-ACP synthase I [Camellia chekiangoleosa]
Length=469

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 75/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  TP GD+ E  AI + F   S +K+N  KS I
Sbjct  335  GVSSCIERSLEDAGVSPEEVNYINAHATSTPAGDVAEVNAIKKVFKNTSEIKMNSTKSMI  394

Query  220  GHXLGaagaveaxaaimAIXXGWXXP--NTXXXKPDEGLXPPRXLVGFKKERLDIKXALX  47
            GH LGAAG +EA A++ AI  GW  P  N    +P          V  KK++ ++  A+ 
Sbjct  395  GHCLGAAGGLEAIASVKAINTGWLHPTINQFNLEPSVEF----DTVANKKQQHEVNVAIS  450

Query  46   NXFGFGGXNFXXXFA  2
            N FGFGG N    F+
Sbjct  451  NSFGFGGHNSVVVFS  465



>ref|XP_004293525.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=469

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ SGV  E+VNYINA A  T  GDL E  AI + F     +KIN  KS I
Sbjct  335  GVSTCIERSLEDSGVSPEEVNYINAHATSTLAGDLAEVNAIKKVFKNTKEIKINATKSMI  394

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGA+G +EA A + AI  GW  P+     P+  +      V   K++ ++  A+ N 
Sbjct  395  GHCLGASGGLEAIATVKAIQTGWLHPSINQFNPEPSVE--FDTVANVKQQHEVNVAISNS  452

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  453  FGFGGHNSVVAFS  465



>ref|XP_010917436.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=469

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 58/133 (44%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  K+L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  335  GVSSCIQKSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKNPSHIKINATKSMI  394

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P      P+  +      V  KK++ ++  A+ N 
Sbjct  395  GHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPAV--EFDTVANKKQQHEVNVAISNS  452

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  453  FGFGGHNSVVVFA  465



>ref|XP_010241300.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nelumbo nucifera]
Length=471

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   +L+ +GV  E+VNYINA A  T  GDL E  AI + F     +KIN  KS I
Sbjct  337  GVSSCIESSLEDAGVSPEEVNYINAHATSTIAGDLAEVNAIKKVFKSTKEIKINATKSMI  396

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  397  GHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVE--FDTVANKKKQHEVNVAISNS  454

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  455  FGFGGHNSVVAFS  467



>gb|KIZ02816.1| hypothetical protein MNEG_5138 [Monoraphidium neglectum]
Length=273

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   ALK +G++ E VNYINA A  T  GD+ E  AI + F   S LK+N  KS I
Sbjct  138  GVSTCIELALKDAGIEREQVNYINAHATSTLVGDVAEVKAIKKVFTDTSNLKMNATKSLI  197

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXK-PDEGLXPPRXLVGFKKERLDIKXALXN  44
            GH LGAA  +EA A + AI  GW  P        DE        V  +K++L +  A+ N
Sbjct  198  GHCLGAAAGIEAVAVVKAIQTGWLHPTLNQHNLVDE--VAGIDTVPNEKKQLAVTAAVSN  255

Query  43   XFGFGGXNFXXXFA  2
             FGFGG N    FA
Sbjct  256  SFGFGGHNSAVVFA  269



>ref|WP_032125192.1| 3-oxoacyl-ACP synthase [Chlamydia sp. 'Diamant']
Length=415

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 57/128 (45%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  403  AGTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSX  224
            AG  LC   AL+ +G+K ED+NYINA A  TP GD+ E  A+ + F   + +K+N  KS 
Sbjct  281  AGVALCIRHALQDAGIKPEDINYINAHATSTPAGDMAEVNALKQVFKNPAAIKMNATKSM  340

Query  223  IGHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXN  44
            IGH LGAAG VEA A I AI      P      P+  L      V  K E  ++K A+ N
Sbjct  341  IGHLLGAAGGVEAIATIKAILDHRIHPTINLENPEPNLGFD---VSTKAEEFEVKHAISN  397

Query  43   XFGFGGXN  20
             FGFGG N
Sbjct  398  SFGFGGHN  405



>ref|XP_011085258.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Sesamum indicum]
Length=471

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 70/133 (53%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   AL+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  337  GVSSCIQSALEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKVFKNTSEIKINATKSMI  396

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P       +  +      V  KK+  ++  A+ N 
Sbjct  397  GHCLGAAGGLEAIATVKAITTGWLHPTINQFSAEPSV--EFDTVANKKQEHEVNVAISNS  454

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  455  FGFGGHNSVVAFS  467



>ref|XP_010052073.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75930.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=465

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  ++L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +KIN  KS I
Sbjct  331  GVSSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMI  390

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  391  GHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVD--FDTVANKKQQHEVNVAISNS  448

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  449  FGFGGHNSVVAFS  461



>ref|XP_001762048.1| predicted protein [Physcomitrella patens]
 gb|EDQ73152.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 58/133 (44%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C  K+L+ +GV  E+VNYINA A  T  GDL E  AI + F   S +K+N  KS I
Sbjct  297  GVSTCIEKSLEDAGVATEEVNYINAHATSTLVGDLAEVNAIKKVFKDTSEIKMNATKSMI  356

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A I AI  GW  P+     P+E +      V   K++ ++  A+ N 
Sbjct  357  GHCLGAAGGLEAIATIKAIQTGWLHPSINQFNPEESVT--FDTVPNVKKQHEVNVAISNS  414

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    FA
Sbjct  415  FGFGGHNSCVVFA  427



>ref|XP_009627828.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=467

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   +L+ +GV  E+VNYINA A  T  GDL E  A+ + F   S +K+N  KS I
Sbjct  333  GVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAVKKVFKNPSEIKMNATKSMI  392

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  393  GHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVE--FDTVANKKQQHEVNVAISNS  450

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  451  FGFGGHNSVVVFS  463



>ref|XP_009763087.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=467

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 73/133 (55%), Gaps = 2/133 (2%)
 Frame = -1

Query  400  GTXLCXXKALKXSGVKXEDVNYINAXAXLTPXGDLKEYPAIIRCFGXNSXLKINXXKSXI  221
            G   C   +L+ +GV  E+VNYINA A  T  GDL E  A+ + F   S +K+N  KS I
Sbjct  333  GVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAVKKVFKNPSEIKMNATKSMI  392

Query  220  GHXLGaagaveaxaaimAIXXGWXXPNTXXXKPDEGLXPPRXLVGFKKERLDIKXALXNX  41
            GH LGAAG +EA A + AI  GW  P+     P+  +      V  KK++ ++  A+ N 
Sbjct  393  GHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVE--FDTVANKKQQHEVNVAISNS  450

Query  40   FGFGGXNFXXXFA  2
            FGFGG N    F+
Sbjct  451  FGFGGHNSVVVFS  463



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552667832160