BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049J16

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33816.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    410   6e-141   Glycine soja [wild soybean]
emb|CBI18876.3|  unnamed protein product                                413   8e-139   Vitis vinifera
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    416   8e-138   Cucumis melo [Oriental melon]
ref|NP_001183829.1|  uncharacterized protein LOC100502422               406   4e-137   Zea mays [maize]
gb|ACN35033.1|  unknown                                                 406   4e-137   Zea mays [maize]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     412   5e-137   Vitis vinifera
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    414   6e-137   Cicer arietinum [garbanzo]
ref|XP_006656509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    405   1e-136   Oryza brachyantha
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             413   1e-136   Phaseolus vulgaris [French bean]
dbj|BAJ85305.1|  predicted protein                                      396   2e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    412   3e-136   Vitis vinifera
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    411   4e-136   Glycine max [soybeans]
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    412   4e-136   Nelumbo nucifera [Indian lotus]
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         411   5e-136   Jatropha curcas
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    411   8e-136   Cucumis sativus [cucumbers]
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    410   8e-136   Sesamum indicum [beniseed]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    410   1e-135   
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    410   1e-135   Sesamum indicum [beniseed]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    410   2e-135   Citrus sinensis [apfelsine]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             410   2e-135   Citrus clementina [clementine]
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    409   2e-135   Setaria italica
gb|EEC81336.1|  hypothetical protein OsI_24516                          407   3e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    408   8e-135   Tarenaya hassleriana [spider flower]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    407   2e-134   
ref|NP_001058625.1|  Os06g0725900                                       405   7e-134   
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    405   8e-134   Populus euphratica
ref|XP_002301927.1|  Cell division protein ftsH                         405   8e-134   Populus trichocarpa [western balsam poplar]
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          405   1e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    405   1e-133   Populus euphratica
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    405   2e-133   Eucalyptus grandis [rose gum]
emb|CDP07308.1|  unnamed protein product                                404   2e-133   Coffea canephora [robusta coffee]
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            404   3e-133   Morus notabilis
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    404   3e-133   Gossypium arboreum [tree cotton]
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    404   4e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       404   4e-133   
emb|CDX96068.1|  BnaA07g26630D                                          403   4e-133   
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    403   5e-133   Brassica rapa
emb|CDY01840.1|  BnaC06g28800D                                          403   5e-133   
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    403   1e-132   Elaeis guineensis
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             402   2e-132   Arabidopsis lyrata subsp. lyrata
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             402   3e-132   Eutrema salsugineum [saltwater cress]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             402   3e-132   Capsella rubella
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    402   3e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002306970.2|  Cell division protein ftsH                         401   5e-132   Populus trichocarpa [western balsam poplar]
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          400   9e-132   Amborella trichopoda
gb|EMS62975.1|  ATP-dependent zinc metalloprotease FTSH 1, chloro...    393   1e-131   Triticum urartu
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    400   1e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    400   1e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    400   2e-131   Camelina sativa [gold-of-pleasure]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             400   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    399   4e-131   Prunus mume [ume]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             399   5e-131   Prunus persica
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    398   1e-130   Phoenix dactylifera
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    395   5e-130   Brachypodium distachyon [annual false brome]
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    395   8e-130   Solanum tuberosum [potatoes]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    395   1e-129   Genlisea aurea
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   2e-129   Nicotiana tomentosiformis
ref|NP_001234196.1|  FtsH-like protein precursor                        394   2e-129   
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   3e-129   Fragaria vesca subsp. vesca
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   3e-129   Nicotiana sylvestris
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    393   7e-129   Nicotiana tomentosiformis
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    393   7e-129   Nicotiana sylvestris
gb|EMT09942.1|  Cell division protease ftsH-like protein, chlorop...    390   2e-128   
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    391   4e-128   Nicotiana tabacum [American tobacco]
emb|CAA68141.1|  chloroplast FtsH protease                              391   5e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    391   6e-128   
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    389   1e-127   Gossypium arboreum [tree cotton]
gb|KJB14315.1|  hypothetical protein B456_002G118800                    389   2e-127   Gossypium raimondii
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    390   2e-127   Pyrus x bretschneideri [bai li]
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         388   4e-127   Medicago truncatula
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    387   1e-126   
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                382   7e-125   Erythranthe guttata [common monkey flower]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    382   1e-124   Medicago sativa [alfalfa]
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    374   2e-121   Arabis alpina [alpine rockcress]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             371   3e-121   
dbj|BAH20236.1|  AT5G42270                                              367   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   3e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             370   3e-120   Capsella rubella
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         363   4e-120   Medicago truncatula
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   5e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   6e-120   Camelina sativa [gold-of-pleasure]
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             369   1e-119   
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             369   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             369   2e-119   Eutrema salsugineum [saltwater cress]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     367   8e-119   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    363   3e-117   Camelina sativa [gold-of-pleasure]
emb|CAA73318.1|  ATPase                                                 356   2e-115   Arabidopsis thaliana [mouse-ear cress]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    352   2e-113   Capsicum annuum
ref|XP_001760664.1|  predicted protein                                  350   2e-113   
gb|AIS72760.1|  ATP-dependent zinc metalloprotease chloroplastic-...    335   2e-112   Rhizophora apiculata
ref|XP_001753657.1|  predicted protein                                  348   2e-112   
gb|KJB14314.1|  hypothetical protein B456_002G118800                    343   1e-109   Gossypium raimondii
ref|XP_002510649.1|  Cell division protease ftsH, putative              339   2e-108   
ref|XP_005650371.1|  membrane AAA-metalloprotease                       300   7e-93    Coccomyxa subellipsoidea C-169
ref|XP_007510744.1|  cell division protein FtsH2                        298   2e-92    Bathycoccus prasinos
gb|KJB57987.1|  hypothetical protein B456_009G188700                    296   6e-92    Gossypium raimondii
gb|KIY93255.1|  cell division protease FtsH                             292   1e-91    Monoraphidium neglectum
ref|WP_025961749.1|  hypothetical protein                               280   3e-91    
dbj|BAH20250.1|  AT5G42270                                              280   4e-91    Arabidopsis thaliana [mouse-ear cress]
ref|WP_025929131.1|  hypothetical protein                               280   9e-91    
gb|KIZ03250.1|  cell division protease FtsH                             294   2e-90    Monoraphidium neglectum
ref|XP_001690889.1|  membrane AAA-metalloprotease                       291   2e-89    Chlamydomonas reinhardtii
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              290   3e-89    Volvox carteri f. nagariensis
ref|WP_029963924.1|  cell division protein FtsH                         279   3e-89    
ref|WP_025947145.1|  cell division protein FtsH                         279   6e-89    
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit           285   2e-88    Leptolyngbya sp. PCC 7375
ref|WP_023072541.1|  membrane protease catalytic subunit                285   5e-88    Leptolyngbya sp. Heron Island J
ref|WP_025970576.1|  cell division protein FtsH                         278   7e-88    
ref|WP_025954333.1|  cell division protein FtsH                         277   5e-87    
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 284   6e-87    Micromonas commoda
ref|WP_025971093.1|  cell division protein FtsH                         277   9e-87    
ref|XP_003057154.1|  predicted protein                                  284   1e-86    Micromonas pusilla CCMP1545
ref|WP_044452063.1|  cell division protein FtsH                         274   2e-86    Mastigocladus laminosus
gb|KGF94553.1|  cell division protein FtsH2                             278   5e-86    Prochlorococcus marinus str. MIT 9201
ref|WP_025958220.1|  cell division protein FtsH                         276   1e-85    
ref|WP_032522853.1|  cell division protein FtsH                         278   1e-85    Prochlorococcus marinus
ref|WP_025944375.1|  cell division protein FtsH                         278   1e-85    
gb|KGG03814.1|  Cell division protein FtsH                              277   2e-85    Prochlorococcus marinus str. MIT 9321
ref|WP_025935637.1|  MULTISPECIES: cell division protein FtsH           278   2e-85    
ref|WP_025971671.1|  cell division protein FtsH                         278   2e-85    
ref|WP_025939914.1|  MULTISPECIES: cell division protein FtsH           278   3e-85    
gb|KGG06312.1|  Cell division protein FtsH                              277   3e-85    Prochlorococcus marinus str. MIT 9322
ref|WP_025922112.1|  cell division protein FtsH                         278   3e-85    
ref|WP_025900256.1|  MULTISPECIES: cell division protein FtsH           278   3e-85    
ref|WP_025969610.1|  cell division protein FtsH                         277   3e-85    
ref|WP_032519670.1|  cell division protein FtsH                         277   3e-85    Prochlorococcus marinus
ref|WP_025980194.1|  cell division protein FtsH                         277   3e-85    
ref|WP_025924120.1|  MULTISPECIES: cell division protein FtsH           277   3e-85    Prochlorococcus marinus
ref|WP_025890345.1|  MULTISPECIES: cell division protein FtsH           277   3e-85    Prochlorococcus sp. HOT208_60m_808M21
ref|WP_025964562.1|  cell division protein FtsH                         277   3e-85    
ref|WP_025967396.1|  cell division protein FtsH                         277   3e-85    
ref|WP_025959316.1|  cell division protein FtsH                         277   3e-85    
ref|WP_032515715.1|  cell division protein FtsH                         277   3e-85    Prochlorococcus marinus
ref|WP_025951376.1|  cell division protein FtsH                         277   3e-85    
ref|WP_032517345.1|  cell division protein FtsH                         277   4e-85    Prochlorococcus marinus
ref|WP_025892538.1|  cell division protein FtsH                         277   4e-85    
gb|KGF88464.1|  cell division protein FtsH2                             276   5e-85    Prochlorococcus marinus str. GP2
ref|WP_025937982.1|  cell division protein FtsH                         276   6e-85    
ref|WP_006911156.1|  cell division protein FtsH                         276   7e-85    Cyanobium sp. PCC 7001
gb|AIQ94296.1|  Cell division protein FtsH                              276   7e-85    Prochlorococcus sp. MIT 0604
ref|WP_035992112.1|  cell division protein FtsH                         276   8e-85    Leptolyngbya sp. KIOST-1
ref|WP_002806664.1|  cell division protein FtsH                         276   8e-85    Prochlorococcus marinus
ref|WP_025956453.1|  MULTISPECIES: cell division protein FtsH           276   9e-85    
ref|WP_025921388.1|  MULTISPECIES: cell division protein FtsH           276   1e-84    
ref|WP_025941250.1|  cell division protein FtsH                         276   1e-84    
ref|WP_025925903.1|  cell division protein FtsH                         276   1e-84    
ref|WP_011817719.1|  cell division protein FtsH                         276   1e-84    Prochlorococcus marinus
gb|ABX08179.1|  cell division protein FtsH2                             275   1e-84    Prochlorococcus marinus str. MIT 9211
ref|WP_025937318.1|  cell division protein FtsH                         276   1e-84    
ref|WP_025971407.1|  cell division protein FtsH                         275   1e-84    
ref|WP_025933036.1|  cell division protein FtsH                         276   1e-84    
ref|WP_025929709.1|  cell division protein FtsH                         276   1e-84    
ref|WP_025914082.1|  cell division protein FtsH                         276   1e-84    
ref|WP_032523992.1|  cell division protein FtsH                         276   1e-84    Prochlorococcus marinus
ref|WP_012007029.1|  cell division protein FtsH                         276   1e-84    Prochlorococcus marinus
ref|WP_025981174.1|  cell division protein FtsH                         276   1e-84    
ref|WP_025965256.1|  cell division protein FtsH                         276   1e-84    Prochlorococcus sp. HOT208_60m_805A16
ref|WP_025979191.1|  cell division protein FtsH                         276   1e-84    
ref|WP_042849723.1|  cell division protein FtsH                         276   1e-84    Prochlorococcus sp. MIT 0604
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH           275   1e-84    Fischerella thermalis
ref|WP_025925013.1|  MULTISPECIES: cell division protein FtsH           275   1e-84    
ref|WP_041391000.1|  cell division protein FtsH                         275   2e-84    Prochlorococcus marinus
ref|WP_017297226.1|  cell division protein FtsH                         275   2e-84    Nodosilinea nodulosa
ref|WP_011862269.1|  cell division protein FtsH                         275   2e-84    Prochlorococcus marinus
ref|WP_044106285.1|  cell division protein FtsH                         275   2e-84    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_011375794.1|  cell division protein FtsH                         275   2e-84    Prochlorococcus marinus
ref|WP_032514590.1|  cell division protein FtsH                         275   2e-84    Prochlorococcus marinus
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH                 275   3e-84    Stanieria cyanosphaera
gb|ADF81075.1|  FtsH                                                    262   4e-84    Corallina officinalis
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    277   4e-84    Auxenochlorella protothecoides
gb|KGG30054.1|  cell division protein FtsH2                             268   5e-84    Prochlorococcus sp. MIT 0703
ref|WP_036973151.1|  cell division protein FtsH                         268   6e-84    Prochlorococcus sp. MIT 0703
ref|WP_012593655.1|  MULTISPECIES: cell division protein FtsH           274   6e-84    Cyanothece
ref|WP_017320405.1|  cell division protein FtsH                         273   8e-84    cyanobacterium PCC 7702
ref|WP_017312914.1|  cell division protein FtsH                         273   9e-84    Fischerella sp. PCC 9339
ref|WP_016862523.1|  cell division protein FtsH                         273   9e-84    Fischerella muscicola
ref|WP_028953545.1|  cell division protein FtsH                         273   1e-83    Synechococcus sp. CC9616
ref|WP_010871638.1|  cell division protein FtsH                         273   1e-83    Synechocystis
ref|WP_026723275.1|  cell division protein FtsH                         273   1e-83    Hapalosiphonaceae
dbj|GAL91410.1|  cell division protein FtsH                             273   1e-83    Microcystis aeruginosa NIES-44
ref|WP_008275101.1|  cell division protein FtsH                         273   1e-83    Cyanothece sp. CCY0110
ref|WP_019478058.1|  cell division protein FtsH                         273   2e-83    
ref|WP_025922823.1|  cell division protein FtsH                         273   2e-83    
ref|WP_002797753.1|  cell division protein FtsH                         273   2e-83    Microcystis aeruginosa
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...    273   2e-83    Microcystis aeruginosa
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH           273   2e-83    Microcystis
ref|WP_032527521.1|  cell division protein FtsH                         273   2e-83    Prochlorococcus marinus
ref|WP_036922150.1|  cell division protein FtsH                         273   2e-83    
ref|WP_019477234.1|  cell division protein FtsH                         273   2e-83    
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit           272   3e-83    Cyanobacteria [blue-green bacteria]
ref|WP_016867387.1|  cell division protein FtsH                         272   3e-83    Fischerella muscicola
ref|WP_002742170.1|  cell division protein FtsH                         272   3e-83    Microcystis
ref|WP_036901462.1|  cell division protein FtsH                         272   3e-83    Prochlorococcus sp. MIT 0601
ref|WP_002793446.1|  cell division protein FtsH                         272   3e-83    Microcystis aeruginosa
ref|WP_002801795.1|  cell division protein FtsH                         272   3e-83    Microcystis aeruginosa
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3          272   3e-83    Microcystis aeruginosa
ref|WP_002771354.1|  cell division protein FtsH                         272   4e-83    Microcystis aeruginosa
ref|WP_013320241.1|  cell division protein FtsH                         271   5e-83    Cyanothece sp. PCC 7822
ref|WP_012264056.1|  cell division protein FtsH                         271   5e-83    Microcystis aeruginosa
ref|WP_006453661.1|  cell division protein FtsH                         271   6e-83    Synechococcus sp. PCC 7335
ref|WP_019474071.1|  MULTISPECIES: cell division protein FtsH           271   7e-83    
ref|WP_019476442.1|  cell division protein FtsH                         271   8e-83    
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit           271   8e-83    Cyanobacterium aponinum
ref|WP_016876546.1|  cell division protein FtsH                         271   8e-83    Chlorogloeopsis fritschii
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH           271   8e-83    Cyanothece
ref|WP_038542994.1|  cell division protein FtsH                         271   9e-83    Synechococcus sp. KORDI-100
ref|WP_015109466.1|  ATP-dependent metalloprotease FtsH                 271   9e-83    Cyanobacteria [blue-green bacteria]
ref|WP_006102026.1|  cell division protein FtsH                         271   1e-82    Coleofasciculus chthonoplastes
ref|WP_017303138.1|  cell division protein FtsH                         271   1e-82    Spirulina subsalsa
ref|WP_035832496.1|  cell division protein FtsH                         270   1e-82    
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3                270   1e-82    Thermosynechococcus sp. NK55a
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH                 270   1e-82    Xenococcus sp. PCC 7305
ref|WP_011819579.1|  cell division protein FtsH                         270   1e-82    Prochlorococcus marinus
ref|XP_001419590.1|  predicted protein                                  271   1e-82    Ostreococcus lucimarinus CCE9901
ref|WP_011055986.1|  cell division protein FtsH                         270   2e-82    Thermosynechococcus
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH           270   2e-82    Lyngbya confervoides
ref|WP_017293936.1|  cell division protein FtsH                         270   2e-82    Geminocystis herdmanii
ref|WP_009556886.1|  ATP-dependent metalloprotease FtsH                 270   2e-82    Oscillatoriales cyanobacterium JSC-12
ref|WP_028949001.1|  cell division protein FtsH                         270   2e-82    Synechocystis sp. PCC 6714
ref|WP_026730933.1|  cell division protein FtsH                         270   2e-82    Fischerella sp. PCC 9605
ref|WP_039716361.1|  cell division protein FtsH                         270   3e-82    
ref|WP_015955558.1|  cell division protein FtsH                         270   3e-82    Cyanothece sp. PCC 7424
ref|WP_011936606.1|  cell division protein FtsH                         269   3e-82    
ref|WP_027255466.1|  cell division protein FtsH                         269   4e-82    Planktothrix agardhii
ref|WP_026097926.1|  cell division protein FtsH                         269   4e-82    Geitlerinema sp. PCC 7105
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit           269   4e-82    Cyanobacteria [blue-green bacteria]
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH           269   5e-82    Planktothrix
ref|WP_007100703.1|  cell division protein FtsH                         269   5e-82    Synechococcus sp. RS9917
ref|WP_042152619.1|  cell division protein FtsH                         268   6e-82    Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                         268   6e-82    Planktothrix agardhii
ref|WP_011131865.1|  cell division protein FtsH                         268   8e-82    Prochlorococcus marinus
gb|KIE06858.1|  cell division protein FtsH                              268   8e-82    Tolypothrix bouteillei VB521301
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH           268   9e-82    Synechococcus
ref|WP_019506377.1|  cell division protein FtsH                         268   9e-82    Pleurocapsa sp. PCC 7319
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH           268   1e-81    Synechococcus
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH           268   1e-81    Prochlorococcus
ref|WP_011826974.1|  cell division protein FtsH                         268   1e-81    Prochlorococcus sp. MIT 1306
emb|CCH67048.1|  Cell division protein FtsH                             264   1e-81    Richelia intracellularis HH01
ref|WP_038331075.1|  cell division protein FtsH                         268   1e-81    filamentous cyanobacterium ESFC-1
ref|WP_017715041.1|  cell division protein FtsH                         268   1e-81    Oscillatoria sp. PCC 10802
ref|WP_017291153.1|  cell division protein FtsH                         268   1e-81    Leptolyngbya boryana
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH                 268   1e-81    Microcoleus sp. PCC 7113
ref|WP_026786321.1|  cell division protein FtsH                         268   1e-81    Planktothrix rubescens
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit           268   1e-81    
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit           268   1e-81    Crinalium epipsammum
ref|WP_011932280.1|  cell division protein FtsH                         268   1e-81    Synechococcus sp. WH 7803
ref|WP_035155002.1|  cell division protein FtsH                         267   2e-81    Calothrix sp. 336/3
ref|WP_006042287.1|  cell division protein FtsH                         268   2e-81    Synechococcus sp. WH 7805
ref|WP_011131165.1|  cell division protein FtsH                         267   2e-81    Prochlorococcus marinus
ref|WP_017743955.1|  cell division protein FtsH                         267   2e-81    Scytonema hofmannii
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH                 267   3e-81    Rubidibacter lacunae
ref|WP_006623490.1|  cell division protein FtsH                         266   3e-81    
gb|KGG16707.1|  Cell division protein FtsH                              267   3e-81    Prochlorococcus sp. MIT 0602
ref|WP_006618677.1|  FtsH peptidase                                     267   3e-81    Arthrospira platensis
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH           267   3e-81    Arthrospira
ref|WP_036916506.1|  MULTISPECIES: cell division protein FtsH           267   3e-81    Prochlorococcus
ref|WP_024546675.1|  cell division protein FtsH                         267   3e-81    Synechococcus
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH                 266   4e-81    Synechocystis sp. PCC 7509
emb|CDN17247.1|  Cell division protein FtsH                             266   4e-81    Richelia intracellularis
ref|WP_011124410.1|  cell division protein FtsH                         266   4e-81    Prochlorococcus marinus
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH                 266   4e-81    Pleurocapsa minor
ref|WP_036001623.1|  cell division protein FtsH                         266   5e-81    [Leptolyngbya] sp. JSC-1
ref|WP_006172329.1|  cell division protein FtsH                         266   6e-81    Synechococcus sp. WH 5701
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit           266   6e-81    Rivularia sp. PCC 7116
ref|WP_036892144.1|  MULTISPECIES: cell division protein FtsH           266   6e-81    Prochlorococcus
ref|WP_040054828.1|  cell division protein FtsH                         266   6e-81    
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH                 266   6e-81    Leptolyngbya sp. PCC 6406
ref|WP_037224718.1|  cell division protein FtsH                         266   6e-81    
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit           266   6e-81    Leptolyngbya sp. PCC 7376
ref|WP_043694696.1|  cell division protein FtsH                         266   6e-81    Synechococcus sp. KORDI-49
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit           266   7e-81    Geitlerinema sp. PCC 7407
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit           266   7e-81    Oscillatoria nigro-viridis
ref|WP_028090468.1|  cell division protein FtsH                         265   9e-81    Dolichospermum circinale
ref|WP_006278775.1|  cell division protein FtsH                         265   1e-80    Cylindrospermopsis
ref|WP_028082599.1|  cell division protein FtsH                         265   1e-80    Dolichospermum circinale
ref|WP_009341877.1|  cell division protein FtsH                         265   1e-80    Aphanizomenonaceae
ref|WP_015162315.1|  ATP-dependent metalloprotease FtsH                 265   1e-80    Chamaesiphon minutus
ref|WP_036486108.1|  cell division protein FtsH                         265   1e-80    Myxosarcina sp. GI1
ref|WP_026099187.1|  cell division protein FtsH                         265   2e-80    Prochlorothrix hollandica
ref|WP_010311939.1|  cell division protein FtsH                         265   2e-80    
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           265   2e-80    
ref|WP_012954347.1|  cell division protein FtsH                         265   2e-80    
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)          265   2e-80    
ref|WP_040935720.1|  cell division protein FtsH                         265   2e-80    
ref|WP_012411183.1|  cell division protein FtsH                         265   2e-80    
ref|WP_008230065.1|  Cell division protein FtsH                         265   2e-80    
ref|WP_036531425.1|  cell division protein FtsH                         265   2e-80    
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit                264   2e-80    
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH                 264   2e-80    
ref|WP_012162910.1|  cell division protein FtsH                         264   3e-80    
ref|WP_027401619.1|  cell division protein FtsH                         264   3e-80    
ref|WP_044492620.1|  cell division protein FtsH                         264   3e-80    
ref|WP_027841867.1|  cell division protein FtsH                         264   4e-80    
ref|WP_019494535.1|  cell division protein FtsH                         264   4e-80    
ref|WP_006633639.1|  cell division protein FtsH                         264   4e-80    
ref|WP_006853632.1|  cell division protein FtsH                         264   4e-80    
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit           263   6e-80    
ref|WP_010995433.1|  cell division protein FtsH                         263   6e-80    
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH           263   6e-80    
ref|WP_011618327.1|  cell division protein FtsH                         263   6e-80    
ref|WP_029633975.1|  cell division protein FtsH [                       263   7e-80    
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH                 263   7e-80    
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit           263   7e-80    
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit           263   8e-80    
ref|WP_013189950.1|  cell division protein FtsH                         263   9e-80    
ref|WP_016949229.1|  cell division protein FtsH                         263   1e-79    
ref|WP_011127179.1|  cell division protein FtsH                         263   1e-79    
gb|EHJ10086.1|  Cell division protein FtsH                              261   1e-79    
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit           262   1e-79    
ref|WP_039740989.1|  cell division protein FtsH                         262   1e-79    
gb|AII47735.1|  cell division protein FtsH                              262   2e-79    
ref|WP_041036156.1|  cell division protein FtsH                         262   2e-79    
ref|WP_012627305.1|  cell division protein FtsH                         262   2e-79    
ref|WP_017315070.1|  cell division protein FtsH                         262   2e-79    
ref|WP_010314566.1|  cell division protein FtsH                         262   2e-79    
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                      262   2e-79    
ref|WP_038551333.1|  cell division protein FtsH                         262   2e-79    
ref|WP_021830407.1|  Cell division protein FtsH                         261   2e-79    
ref|WP_021836615.1|  Cell division protein FtsH                         262   2e-79    
ref|WP_011363329.1|  cell division protein FtsH                         262   3e-79    
ref|WP_007099803.1|  cell division protein FtsH                         261   3e-79    
ref|WP_011317448.1|  cell division protein FtsH                         261   3e-79    
gb|KIJ85386.1|  cell division protein FtsH                              261   3e-79    
ref|WP_009782358.1|  cell division protein FtsH                         261   5e-79    
gb|ADD94882.1|  FtsH peptidase                                          261   5e-79    
ref|WP_011613138.1|  cell division protein FtsH                         261   5e-79    
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3          261   5e-79    
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH                 261   5e-79    
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit           261   5e-79    
ref|WP_017653544.1|  cell division protein FtsH                         260   8e-79    
ref|WP_015197493.1|  membrane protease FtsH catalytic subunit           260   1e-78    
ref|WP_036906170.1|  cell division protein FtsH                         260   1e-78    
ref|WP_011360789.1|  cell division protein FtsH                         260   1e-78    
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit           259   2e-78    
ref|WP_038651066.1|  cell division protein FtsH                         259   3e-78    
ref|WP_009788844.1|  cell division protein FtsH                         259   3e-78    
ref|WP_011294228.1|  cell division protein FtsH                         259   3e-78    
ref|WP_011823081.1|  cell division protein FtsH                         259   4e-78    
ref|WP_006198086.1|  cell division protein FtsH                         258   7e-78    
ref|YP_002049185.1|  cell division protein ftsH                         248   3e-74    
ref|WP_025953358.1|  hypothetical protein                               238   4e-74    
gb|ABH09265.1|  cell division protein                                   248   5e-74    
ref|WP_015167033.1|  ATP-dependent metalloprotease FtsH                 248   6e-74    
ref|WP_011141915.1|  cell division protein FtsH                         246   2e-73    
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                247   2e-73    
ref|XP_005713345.1|  cell division protein FtsH                         247   4e-73    
gb|AFK49239.1|  unknown                                                 235   4e-73    
ref|WP_015165890.1|  ATP-dependent metalloprotease FtsH                 245   5e-73    
ref|WP_023174221.1|  ATP-dependent metalloprotease FtsH                 245   5e-73    
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435              243   2e-71    
ref|WP_019500986.1|  cell division protein FtsH                         241   2e-71    
ref|XP_005708438.1|  AAA-type ATPase                                    243   4e-71    
ref|WP_009628744.1|  membrane protease FtsH catalytic subunit           234   1e-68    
ref|WP_017324919.1|  hypothetical protein                               233   3e-68    
ref|XP_005538209.1|  cell division protein FtsH                         231   2e-66    
ref|WP_011431525.1|  cell division protein FtsH                         227   5e-66    
gb|ACV52574.1|  FtsH-like protein                                       215   6e-66    
ref|WP_011432278.1|  cell division protein FtsH                         226   1e-65    
ref|WP_010468934.1|  cell division protein FtsH                         222   3e-64    
ref|XP_002287516.1|  metalloprotease                                    218   3e-63    
ref|XP_005708136.1|  AAA-type ATPase                                    219   3e-62    
ref|XP_002177215.1|  predicted protein                                  213   2e-60    
gb|EJK55379.1|  hypothetical protein THAOC_24887                        213   2e-60    
ref|XP_002291485.1|  chloroplast ftsH                                   210   6e-60    
gb|KJB14313.1|  hypothetical protein B456_002G118800                    208   4e-59    
gb|AHJ28404.1|  Cell division protein FtsH                              201   2e-56    
ref|WP_006199059.1|  cell division protein FtsH                         201   3e-56    
ref|WP_044452899.1|  cell division protein FtsH                         194   7e-56    
gb|EWM30233.1|  atp-dependent metalloprotease                           201   9e-56    
ref|WP_018875886.1|  MULTISPECIES: ATP-dependent metalloprotease        200   1e-55    
ref|WP_018867786.1|  MULTISPECIES: ATP-dependent metalloprotease        199   1e-55    
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           198   2e-55    
ref|WP_018146241.1|  MULTISPECIES: ATP-dependent metalloprotease        198   3e-55    
ref|WP_018937957.1|  MULTISPECIES: ATP-dependent metalloprotease        198   3e-55    
dbj|BAP57909.1|  ATP-dependent metalloprotease FtsH                     198   4e-55    
ref|WP_019593923.1|  ATP-dependent metalloprotease                      198   4e-55    
ref|WP_018948798.1|  ATP-dependent metalloprotease                      197   6e-55    
gb|AHB35104.1|  putative plastid division protein                       197   6e-55    
ref|YP_009027610.1|  putative plastid division protein                  197   7e-55    
ref|WP_002682906.1|  ATP-dependent metalloprotease                      197   8e-55    
ref|WP_018862431.1|  MULTISPECIES: ATP-dependent metalloprotease        197   1e-54    
ref|WP_036002156.1|  cell division protein FtsH                         191   1e-54    
ref|WP_021202559.1|  ATP-dependent metalloprotease                      190   1e-54    
ref|WP_017322954.1|  cell division protein FtsH                         196   1e-54    
ref|WP_038051416.1|  ATP-dependent metalloprotease                      196   2e-54    
ref|WP_035150451.1|  cell division protein FtsH                         196   2e-54    
ref|WP_018141827.1|  MULTISPECIES: ATP-dependent metalloprotease        196   2e-54    
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           196   2e-54    
ref|WP_016869882.1|  cell division protein FtsH                         196   2e-54    
ref|WP_031388311.1|  cell division protein FtsH                         195   2e-54    
ref|WP_039738012.1|  cell division protein FtsH                         196   3e-54    
ref|WP_016858941.1|  cell division protein FtsH                         195   3e-54    
emb|CCH67560.1|  Cell division protein FtsH                             191   3e-54    
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           196   3e-54    
ref|WP_040355337.1|  ATP-dependent metalloprotease                      195   3e-54    
ref|WP_013191839.1|  cell division protein FtsH                         195   4e-54    
gb|EEV88713.1|  ATP-dependent metallopeptidase HflB                     195   4e-54    
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           195   4e-54    
emb|CBN76650.1|  FtsH protease                                          196   4e-54    
ref|YP_007947857.1|  cell division protein                              195   4e-54    
ref|WP_026719681.1|  cell division protein FtsH                         195   5e-54    
ref|WP_026732891.1|  cell division protein FtsH                         194   5e-54    
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           194   5e-54    
gb|AIA21561.1|  putative plastid division protein                       194   5e-54    
ref|WP_012408087.1|  cell division protein FtsH                         194   6e-54    
ref|YP_537009.1|  cell division protein                                 194   6e-54    
ref|WP_027845285.1|  cell division protein FtsH                         194   7e-54    
ref|WP_016951384.1|  cell division protein FtsH                         194   9e-54    
ref|WP_018864965.1|  ATP-dependent metalloprotease                      194   9e-54    
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           194   1e-53    
ref|WP_024326958.1|  ATP-dependent metalloprotease                      194   1e-53    
ref|WP_019623587.1|  MULTISPECIES: ATP-dependent metalloprotease        194   1e-53    
ref|WP_019584275.1|  ATP-dependent metalloprotease                      194   1e-53    
ref|WP_029633486.1|  cell division protein FtsH [                       194   1e-53    
ref|WP_022344010.1|  aTP-dependent metallopeptidase HflB subfamil...    193   1e-53    
gb|KHD08639.1|  ATP-dependent metalloprotease                           193   2e-53    
ref|WP_019641895.1|  ATP-dependent metalloprotease                      194   2e-53    
ref|WP_011056581.1|  cell division protein FtsH                         193   2e-53    
ref|WP_017312271.1|  cell division protein FtsH                         193   2e-53    
ref|WP_008931990.1|  ATP-dependent metalloprotease                      193   2e-53    
ref|WP_039716067.1|  cell division protein FtsH                         193   2e-53    
ref|WP_018138282.1|  MULTISPECIES: ATP-dependent metalloprotease        193   2e-53    
ref|WP_012629618.1|  cell division protein FtsH                         193   2e-53    
ref|WP_010997786.1|  cell division protein FtsH                         193   2e-53    
ref|WP_017925965.1|  ATP-dependent metalloprotease                      193   2e-53    
ref|WP_019024747.1|  MULTISPECIES: ATP-dependent metalloprotease        193   3e-53    
ref|WP_009302174.1|  ATP-dependent metalloprotease                      193   3e-53    
ref|WP_017941358.1|  MULTISPECIES: ATP-dependent metalloprotease        193   3e-53    
ref|WP_020990697.1|  ATP-dependent metallopeptidase HflB                193   3e-53    
ref|WP_012982116.1|  ATP-dependent metalloprotease                      193   3e-53    
ref|WP_017651155.1|  cell division protein FtsH                         192   3e-53    
ref|WP_018934759.1|  ATP-dependent metalloprotease                      193   3e-53    
ref|WP_015112002.1|  membrane protease FtsH catalytic subunit           192   4e-53    
ref|WP_016876491.1|  cell division protein FtsH                         192   4e-53    
emb|CCP10974.1|  cell division protease FtsH                            184   5e-53    
ref|WP_006508907.1|  ATP-dependent metalloprotease FtsH                 192   5e-53    
ref|WP_018940736.1|  ATP-dependent metalloprotease                      192   5e-53    
ref|WP_000629598.1|  hypothetical protein                               182   5e-53    
gb|AFW93266.1|  ATP-dependent metallopeptidase                          191   5e-53    
ref|WP_011319922.1|  cell division protein FtsH                         192   6e-53    
ref|WP_006456705.1|  cell division protein FtsH                         192   6e-53    
emb|CDN10469.1|  Cell division protein FtsH                             191   6e-53    
ref|YP_007627352.1|  cell division protein                              192   6e-53    
ref|WP_037216619.1|  cell division protein FtsH                         192   7e-53    
ref|WP_009847543.1|  ATP-dependent Zn protease                          184   7e-53    
ref|WP_041739648.1|  cell division protein FtsH                         191   7e-53    
gb|AFZ02140.1|  membrane protease FtsH catalytic subunit                192   7e-53    
ref|WP_025280931.1|  MULTISPECIES: ATP-dependent metalloprotease        192   7e-53    
ref|WP_023174351.1|  ATP-dependent metalloprotease FtsH                 191   7e-53    
ref|WP_036533052.1|  cell division protein FtsH                         191   8e-53    
ref|WP_029891506.1|  ATP-dependent metalloprotease                      192   8e-53    
gb|AFC39995.1|  cell division protein                                   191   8e-53    
gb|AIA21355.1|  putative plastid division protein                       191   9e-53    
ref|WP_022658404.1|  ATP-dependent metalloprotease                      192   9e-53    
gb|EHM53778.1|  cell division protease FtsH                             191   9e-53    
ref|WP_015132046.1|  membrane protease FtsH catalytic subunit           191   1e-52    
ref|WP_040389162.1|  ATP-dependent metalloprotease                      191   1e-52    
ref|WP_042055247.1|  ATP-dependent metalloprotease                      182   1e-52    
ref|WP_041457570.1|  cell division protein FtsH                         191   1e-52    
ref|WP_026082835.1|  cell division protein FtsH                         191   1e-52    
ref|WP_012162627.1|  cell division protein FtsH                         191   1e-52    
gb|EKD74993.1|  hypothetical protein ACD_44C00263G0003                  191   1e-52    
ref|WP_015188757.1|  membrane protease FtsH catalytic subunit           191   1e-52    
ref|WP_015137807.1|  ATP-dependent metalloprotease FtsH                 191   1e-52    
ref|WP_009555904.1|  membrane protease FtsH catalytic subunit           191   1e-52    
ref|YP_008144816.1|  ATP-dependent zinc metalloprotease FtsH            191   1e-52    
ref|WP_023070843.1|  membrane protease catalytic subunit                191   1e-52    
ref|WP_028007612.1|  ATP-dependent metalloprotease                      191   2e-52    
ref|WP_042712540.1|  hypothetical protein                               179   2e-52    
ref|NP_053937.1|  cell division protein                                 191   2e-52    
ref|WP_018234080.1|  ATP-dependent metalloprotease                      191   2e-52    
ref|WP_041067680.1|  ATP-dependent metalloprotease                      191   2e-52    
dbj|GAM55939.1|  cell division protein ftsH                             182   2e-52    
ref|WP_038395594.1|  ATP-dependent metalloprotease                      182   2e-52    
ref|WP_028083738.1|  cell division protein FtsH                         190   2e-52    
ref|WP_020648318.1|  ATP-dependent metalloprotease                      191   2e-52    
dbj|GAM72852.1|  cell division protein ftsH                             182   2e-52    
ref|WP_019491912.1|  cell division protein FtsH                         190   2e-52    
ref|WP_012408423.1|  cell division protein FtsH                         190   2e-52    
gb|EAM48267.1|  Peptidase M41                                           179   2e-52    
ref|YP_001293616.1|  cell division protein                              190   2e-52    
ref|WP_017662490.1|  cell division protein FtsH                         190   2e-52    
ref|WP_044818844.1|  ATP-dependent metalloprotease                      182   2e-52    
ref|WP_031459350.1|  cell division protein FtsH                         190   3e-52    
ref|WP_034863750.1|  ATP-dependent metalloprotease                      190   3e-52    
ref|WP_024328981.1|  ATP-dependent metalloprotease                      190   3e-52    
ref|WP_018946363.1|  ATP-dependent metalloprotease                      190   3e-52    
emb|CCH65009.1|  Cell division protein FtsH                             189   3e-52    
ref|WP_028575310.1|  cell division protein FtsH                         190   3e-52    
ref|WP_009539845.1|  Cell division protein FtsH                         190   3e-52    
ref|WP_010477442.1|  cell division protein FtsH                         190   3e-52    
ref|WP_028089678.1|  cell division protein FtsH                         190   3e-52    
ref|WP_044258630.1|  hypothetical protein                               189   3e-52    
ref|WP_044860217.1|  ATP-dependent metalloprotease                      182   3e-52    
gb|EYI22871.1|  ATP-dependent metalloprotease                           183   3e-52    
ref|WP_038087491.1|  ATP-dependent metalloprotease                      190   4e-52    
ref|WP_031620798.1|  ATP-dependent metalloprotease                      183   4e-52    
ref|WP_006278637.1|  cell division protein FtsH                         189   4e-52    
ref|WP_000223708.1|  hypothetical protein                               183   4e-52    
ref|WP_028948642.1|  cell division protein FtsH                         189   4e-52    



>gb|KHN33816.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Glycine 
soja]
Length=325

 Score =   410 bits (1055),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  117  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  176

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  177  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  236

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKL
Sbjct  237  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIITTHIDILHKL  296

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  297  AQLLIEKETVDGEEFMSLFIDGKAELYVA  325



>emb|CBI18876.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   413 bits (1061),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  330  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  389

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  390  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  449

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKL
Sbjct  450  QVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKL  509

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  510  AQLLIEKETVDGEEFMSLFIDGKAELFVA  538



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   416 bits (1069),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 203/209 (97%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  507  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  566

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  567  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  626

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            QIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHIDILHKL
Sbjct  627  QIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQIITTHIDILHKL  686

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  687  AQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|NP_001183829.1| uncharacterized protein LOC100502422 [Zea mays]
 gb|ACR38427.1| unknown [Zea mays]
Length=475

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  267  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  326

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  327  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  386

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKL
Sbjct  387  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKL  446

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  447  AQLLIEKETVDGEEFMSLFIDGQAELFVA  475



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  255  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  314

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  315  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  374

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKL
Sbjct  375  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKL  434

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  435  AQLLIEKETVDGEEFMSLFIDGQAELFVA  463



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   412 bits (1060),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  455  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  514

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  515  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  574

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKL
Sbjct  575  QVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKL  634

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  635  AQLLIEKETVDGEEFMSLFIDGKAELFVA  663



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   414 bits (1064),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  505  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  564

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  565  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  624

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQM+TQKDYSMATADVVDAEVRELVE+AYSRATQII THIDILHKL
Sbjct  625  QVAIGGPGGNPFLGQQMATQKDYSMATADVVDAEVRELVEKAYSRATQIINTHIDILHKL  684

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  685  AQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>ref|XP_006656509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Oryza brachyantha]
Length=475

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  267  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  326

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  327  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  386

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKL
Sbjct  387  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKL  446

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  447  AQLLMEKETVDGEEFMSLFIDGQAELFVA  475



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   413 bits (1061),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  501  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  560

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  561  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  620

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKL
Sbjct  621  QVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATNIITTHIDILHKL  680

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  681  AQLLIEKETVDGEEFMSLFIDGKAELYVA  709



>dbj|BAJ85305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   396 bits (1017),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  41   KKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  100

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  101  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIG  160

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+L
Sbjct  161  QVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRL  220

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  221  ANLLIEKETVDGEEFMSLFIDGQAELFVA  249



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   412 bits (1058),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  498  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  557

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  558  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  617

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRA QI+TTHIDILHKL
Sbjct  618  QVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRAKQIMTTHIDILHKL  677

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  678  AQLLIEKETVDGEEFMSLFIDGKAELFVA  706



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   411 bits (1057),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  488  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  547

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  548  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  607

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT IITTHIDILHKL
Sbjct  608  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIITTHIDILHKL  667

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  668  AQLLIEKETVDGEEFMSLFIDGKAELYVA  696



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   412 bits (1058),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 199/209 (95%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  512  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  571

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSK+IG
Sbjct  572  GLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKRIG  631

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQIITTHIDILHKL
Sbjct  632  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARATQIITTHIDILHKL  691

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  692  AQLLMEKETVDGEEFMSLFIDGKAELYVA  720



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   411 bits (1057),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  507  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  566

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  567  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  626

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA  IITTHIDILHKL
Sbjct  627  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKHIITTHIDILHKL  686

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  687  AQLLIEKETVDGEEFMSLFIDGKAELFVA  715



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   411 bits (1056),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 201/209 (96%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  507  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  566

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  567  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  626

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            QIAIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRA QIITTH DILHKL
Sbjct  627  QIAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRAKQIITTHNDILHKL  686

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  687  AQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   410 bits (1055),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  495  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  554

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  555  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  614

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RATQIITTHIDILHKL
Sbjct  615  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYTRATQIITTHIDILHKL  674

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  675  AQLLIEKETVDGEEFMSLFIDGKAELYIA  703



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/209 (95%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  486  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  545

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  546  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  605

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAYSRAT II+THIDILHKL
Sbjct  606  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYSRATHIISTHIDILHKL  665

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  666  AQLLIEKETVDGEEFMSLFIDGKAELYVA  694



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/209 (95%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  495  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  554

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  555  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  614

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAY+RA QIITTHIDILHKL
Sbjct  615  QVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYTRAKQIITTHIDILHKL  674

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  675  AQLLIEKETVDGEEFMSLFIDGKAELYVA  703



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  515  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  574

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  575  GLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  634

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKL
Sbjct  635  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKL  694

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  695  AQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/209 (96%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  515  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  574

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  575  GLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  634

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKL
Sbjct  635  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKL  694

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  695  AQLLIEKETVDGEEFMSLFIDGKAELFVA  723



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/209 (95%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  477  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  536

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  537  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  596

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATAD+VDAEVRELVERAYSRATQIITTHIDILHKL
Sbjct  597  QVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAEVRELVERAYSRATQIITTHIDILHKL  656

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  657  AQLLIEKETVDGEEFMSLFIDGQAELFVA  685



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   407 bits (1045),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  422  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  481

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  482  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  541

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKL
Sbjct  542  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKL  601

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  602  AQLLMEKETVDGEEFMSLFIDGQAELFVA  630



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   408 bits (1049),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  507  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  566

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQM+VALGGR+AEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  567  GLYSRSYLENQMSVALGGRIAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  626

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVRELVERAY+RA QIITTHIDILHKL
Sbjct  627  QVAIGGSGGNPFLGQQMSSQKDYSMATADVVDAEVRELVERAYARAKQIITTHIDILHKL  686

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFV+
Sbjct  687  AQLLIEKETVDGEEFMSLFIDGKAELFVS  715



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   407 bits (1045),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  480  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  539

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  540  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  599

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKL
Sbjct  600  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRARQIITTHIDILHKL  659

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  660  AQLLIEKETVDGEEFMSLFIDGQAELFVA  688



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   405 bits (1041),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EK++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  478  KKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  537

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  538  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  597

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKL
Sbjct  598  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKL  657

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  658  AQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   405 bits (1042),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  497  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  556

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  557  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIG  616

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA QI+TTHIDILHKL
Sbjct  617  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHIDILHKL  676

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  677  AQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   405 bits (1042),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  496  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  556  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  615

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKL
Sbjct  616  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKL  675

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  676  AQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   405 bits (1040),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 207/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EK++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  478  KKNAVVSEEKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  537

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  538  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  597

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRATQIITTHIDILHKL
Sbjct  598  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRATQIITTHIDILHKL  657

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AELFVA
Sbjct  658  AQLLMEKETVDGEEFMSLFIDGQAELFVA  686



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  496  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  556  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  615

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AY+RA QIITTHIDILHKL
Sbjct  616  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKL  675

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  676  AQLLIEKESVDGEEFMSLFIDGKAELYVS  704



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  505  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  564

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  565  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  624

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELV+RAYSRA QI+TTH+DILHKL
Sbjct  625  QVAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVDRAYSRAKQIMTTHVDILHKL  684

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  685  AQLLIEKETVDGEEFMSLFIDGKAELYVS  713



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   404 bits (1039),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  498  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  557

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  558  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  617

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA QI+TTHIDILHKL
Sbjct  618  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRAKQIMTTHIDILHKL  677

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEF+SLFIDGKAEL+VA
Sbjct  678  AQLLIEKETVDGEEFLSLFIDGKAELYVA  706



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   404 bits (1038),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  502  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  561

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  562  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  621

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA QI+TTHIDILHKL
Sbjct  622  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKQILTTHIDILHKL  681

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A LLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  682  ALLLIEKETVDGEEFMSLFIDGKAELYVS  710



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   404 bits (1037),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/209 (93%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  491  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  550

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  551  GLYSRSYLQNQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  610

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA QIITTHIDILHKL
Sbjct  611  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQIITTHIDILHKL  670

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  671  AQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   404 bits (1037),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  498  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  557

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  558  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  617

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRA QIITTH DILHKL
Sbjct  618  QVAIGGSGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRAKQIITTHSDILHKL  677

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDG+EFMSLFIDGKAEL+VA
Sbjct  678  AQLLIEKETVDGDEFMSLFIDGKAELYVA  706



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   404 bits (1037),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/209 (93%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  494  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  553

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  554  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIG  613

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE AY+RA QIITTHIDILHKL
Sbjct  614  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVETAYTRAKQIITTHIDILHKL  673

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGK EL+V+
Sbjct  674  AQLLIEKETVDGEEFMSLFIDGKTELYVS  702



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   403 bits (1035),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  467  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  526

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  527  GLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIG  586

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKL
Sbjct  587  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKL  646

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  647  AQLLIEKETVDGEEFMSLFIDGQAELYVS  675



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  495  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  554

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  555  GLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIG  614

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKL
Sbjct  615  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKL  674

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  675  AQLLIEKETVDGEEFMSLFIDGQAELYVS  703



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  494  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  553

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  554  GLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMIERFGFSKKIG  613

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT IITTHIDILHKL
Sbjct  614  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATDIITTHIDILHKL  673

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  674  AQLLIEKETVDGEEFMSLFIDGQAELYVS  702



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  515  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  574

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  575  GLYSRSYLENQMAVALGGRVAEEVIFGNDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  634

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QI+T +IDILHKL
Sbjct  635  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQIMTDNIDILHKL  694

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  695  AQLLIEKETVDGEEFMSLFIDGKAELYVA  723



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  512  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  571

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  572  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  631

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  632  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  691

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  692  AQLLIEKETVDGEEFMSLFIDGQAELYIS  720



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  514  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  573

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  574  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMIERFGFSKKIG  633

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  634  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  693

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  694  AQLLIEKETVDGEEFMSLFIDGQAELYVS  722



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   402 bits (1032),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  510  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  569

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  570  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  629

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  630  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  689

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  690  AQLLIEKETVDGEEFMSLFIDGQAELYIS  718



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   402 bits (1032),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  507  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  566

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGE+ VTTGASNDFMQVSRVARQMVER GFSK+IG
Sbjct  567  GLYSRSYLENQMAVALGGRVAEEVIFGEEKVTTGASNDFMQVSRVARQMVERLGFSKRIG  626

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVERAY+RA QIITTHIDILHKL
Sbjct  627  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVERAYARAKQIITTHIDILHKL  686

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  687  AQLLIEKETVDGEEFMSLFIDGKAELYVA  715



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   401 bits (1030),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  497  KKNAVVSDEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  556

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  557  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIG  616

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATADVVD EVRELVE AYSRA QI+TTHIDILHKL
Sbjct  617  QVAIGGSGGNPFLGQQMSSQKDYSMATADVVDTEVRELVETAYSRAKQIMTTHIDILHKL  676

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL++A
Sbjct  677  AQLLIEKETVDGEEFMSLFIDGKAELYIA  705



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   400 bits (1029),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  505  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  564

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  565  GLYSRSYLENQMAVALGGRVAEEVIFGKENVTTGASNDFMQVSRVARQMVERFGFSKKIG  624

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELV+ AYSRA  IITT IDILHKL
Sbjct  625  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVDEAYSRAKHIITTQIDILHKL  684

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  685  AQLLIEKETVDGEEFMSLFIDGKAELFVA  713



>gb|EMS62975.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Triticum 
urartu]
Length=494

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  286  KKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  345

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  346  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIG  405

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+L
Sbjct  406  QVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHRL  465

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  466  ANLLIEKETVDGEEFMSLFIDGQAELFVA  494



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  515  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  574

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  575  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  634

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  635  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  694

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  695  AQLLIEKETVDGEEFMSLFIDGQAELYIS  723



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  514  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  573

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  574  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  633

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  634  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  693

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  694  AQLLIEKETVDGEEFMSLFIDGQAELYIS  722



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  516  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  575

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  576  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  635

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  636  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  695

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  696  AQLLIEKETVDGEEFMSLFIDGQAELYIS  724



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   400 bits (1027),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 206/209 (99%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  508  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  567

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  568  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  627

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  628  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  687

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+++
Sbjct  688  AQLLIEKETVDGEEFMSLFIDGQAELYIS  716



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   399 bits (1025),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  511  KKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  570

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  571  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIG  630

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHIDILHKL
Sbjct  631  QVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHIDILHKL  690

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  691  AQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   399 bits (1024),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  511  KKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  570

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  571  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIG  630

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AYSRATQIITTHIDILHKL
Sbjct  631  QVAIGAGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYSRATQIITTHIDILHKL  690

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  691  AQLLMEKETVDGEEFMSLFIDGKAELYVA  719



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   398 bits (1022),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EK+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  516  KKNAVVSEEKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  575

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  576  GLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  635

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVD+EVRELVE+AYSRA QI++ +IDILHKL
Sbjct  636  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDSEVRELVEKAYSRALQIMSDNIDILHKL  695

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+VA
Sbjct  696  AQLLIEKETVDGEEFMSLFIDGKAELYVA  724



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   395 bits (1015),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++K++LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  473  KKNAVVSEQKRRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  532

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  533  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASNDFMQVSRVARQMVERFGFSKKIG  592

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIG  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE++YSRATQII THIDILHKL
Sbjct  593  QVAIGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKSYSRATQIINTHIDILHKL  652

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  653  AQLLIEKETVDGEEFMSLFIDGQAELFVA  681



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   395 bits (1015),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 198/209 (95%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  500  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  559

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  560  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  619

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQIITTHIDILHKL
Sbjct  620  QVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQIITTHIDILHKL  679

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELF++
Sbjct  680  AQLLIEKETVDGEEFMSLFIDGKAELFIS  708



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  489  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  548

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEE IFG D VTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  549  GLYSRSYLENQMAVALGGRVAEEAIFGVDKVTTGASNDFMQVSRVARQMVERFGFSKKIG  608

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMSTQKDYSMATAD+VDAEVRELV+RAY+RA QIITT+IDILH+L
Sbjct  609  QVAIGGPGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDRAYARAKQIITTNIDILHRL  668

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQLLIEKETVDGEEFMSLFIDGKA++
Sbjct  669  AQLLIEKETVDGEEFMSLFIDGKAQM  694



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  499  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  558

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  559  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  618

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+IITTHIDILHKL
Sbjct  619  QVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIITTHIDILHKL  678

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  679  AQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  500  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  559

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  560  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  619

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVE+AY RATQIITTHIDILHKL
Sbjct  620  QVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVEKAYERATQIITTHIDILHKL  679

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  680  AQLLIEKETVDGEEFMSLFIDGKAELYIS  708



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  503  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  562

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+ NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  563  GLYSRSYLENQMAVALGGRVAEEVIFGQANVTTGASNDFMQVSRVARQMVERFGFSKKIG  622

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+G  GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  623  QVAVGSSGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  682

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A LLIEKE+VDGEEFMSLFIDGKAEL+V+
Sbjct  683  ANLLIEKESVDGEEFMSLFIDGKAELYVS  711



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  499  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  558

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  559  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  618

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RATQIITTHIDILHKL
Sbjct  619  QVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATQIITTHIDILHKL  678

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  679  AQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   393 bits (1010),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 195/209 (93%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  507  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  566

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  567  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  626

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQIITTHIDILHKL
Sbjct  627  QVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQIITTHIDILHKL  686

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  687  AQLLIEKETVDGEEFMSLFIDGKAELYIS  715



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   393 bits (1009),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 195/209 (93%), Positives = 205/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  502  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  561

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  562  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  621

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATAD+VDAEVRELV++AY+RATQIITTHIDILHKL
Sbjct  622  QVAIGGGGGNPFLGQQMSTQKDYSMATADIVDAEVRELVDKAYARATQIITTHIDILHKL  681

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  682  AQLLIEKETVDGEEFMSLFIDGKAELYIS  710



>gb|EMT09942.1| Cell division protease ftsH-like protein, chloroplastic [Aegilops 
tauschii]
Length=665

 Score =   390 bits (1003),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 202/210 (96%), Gaps = 1/210 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++K+KLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  456  KKNAVVSEQKRKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  515

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  516  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIG  575

Query  374  QIAIGGP-GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHK  198
            Q+AIG   GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE AYSRATQII THIDILH+
Sbjct  576  QVAIGSSGGGNPFLGQQMSSQKDYSMATADIVDAEVRELVETAYSRATQIINTHIDILHR  635

Query  197  LAQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            LA LLIEKETVDGEEFMSLFIDG+AELFVA
Sbjct  636  LANLLIEKETVDGEEFMSLFIDGQAELFVA  665



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   391 bits (1004),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  499  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  558

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALG RVAEEVIFG+DNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  559  GLYSRSYLENQMAVALGERVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  618

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAY RAT+IITTHIDILHKL
Sbjct  619  QVAIGGGGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYERATEIITTHIDILHKL  678

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  679  AQLLIEKETVDGEEFMSLFIDGKAELYIS  707



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   391 bits (1004),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  508  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  567

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  568  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  627

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  628  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  687

Query  194  AQLLIEKETVDGEEFMSLFIDG  129
            AQLLIEKETVDGEEFMSLFIDG
Sbjct  688  AQLLIEKETVDGEEFMSLFIDG  709



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   391 bits (1004),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  510  KKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  569

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  570  GLYSRSYLENQMAVALGGRVAEEVIFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIG  629

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIG  GGNPFLGQQMS+QKDYSMATADVVDAEVRELVE AYSRA  I+TTHIDILH L
Sbjct  630  QVAIGASGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYSRAKDIVTTHIDILHTL  689

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+VA
Sbjct  690  AQLLMEKETVDGEEFMSLFIDGKAELYVA  718



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  491  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  550

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  551  GLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  610

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKL
Sbjct  611  QVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKL  670

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  671  AQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   389 bits (999),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  491  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  550

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  551  GLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  610

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKL
Sbjct  611  QVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKL  670

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  671  AQLLMEKETVDGEEFMSLFIDGKAELYVS  699



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGG TFFAPSEERLES
Sbjct  513  KKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGFTFFAPSEERLES  572

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  573  GLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIG  632

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            QIA+G  GGNPFLGQQMS+QKDYSMATAD+VD EVRELVE AYSRATQIITTHIDILHKL
Sbjct  633  QIAVGASGGNPFLGQQMSSQKDYSMATADIVDGEVRELVETAYSRATQIITTHIDILHKL  692

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            AQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  693  AQLLIEKETVDGEEFMSLFIDGKAELYV  720



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  498  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  557

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  558  GLYSRSYLENQMAVALGGRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  617

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKL
Sbjct  618  QVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKL  677

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  678  AQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGG TFFAPSEERLES
Sbjct  513  KKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGFTFFAPSEERLES  572

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQM VALGGRVAEEV FG++NVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  573  GLYSRSYLENQMVVALGGRVAEEVSFGQENVTTGASSDFMQVSRVARQMVERFGFSKKIG  632

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            QIA+G  GGNPFLGQ MS+QKDYSMATAD+VD EVRELVE AYSRATQIITTHIDILHKL
Sbjct  633  QIAVGASGGNPFLGQMMSSQKDYSMATADIVDGEVRELVETAYSRATQIITTHIDILHKL  692

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            AQLLIEKETVDGEEFMSLFIDGKAEL+V
Sbjct  693  AQLLIEKETVDGEEFMSLFIDGKAELYV  720



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   382 bits (982),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KKKLVAYHEAGHALVGALMPEYD VAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  497  KKNAVVSEDKKKLVAYHEAGHALVGALMPEYDAVAKISIIPRGQAGGLTFFAPSEERLES  556

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEEVIFG+DNVTTGAS+DFMQVSRVARQMVERFGFSKKIG
Sbjct  557  GLYSRSYLENQMAVALGGRIAEEVIFGQDNVTTGASSDFMQVSRVARQMVERFGFSKKIG  616

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GG+PFLGQQMS+QKDYSMATADVVDAEVRELV+ AYSRA QIITTH+DILHKL
Sbjct  617  QVAIGGGGGDPFLGQQMSSQKDYSMATADVVDAEVRELVDTAYSRAKQIITTHVDILHKL  676

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAELFVA
Sbjct  677  AQLLIEKETVDGEEFMSLFIDGKAELFVA  705



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 1/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  499  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  558

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEV FG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  559  GLYSRSYLENQMAVALGGRVAEEV-FGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  617

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKL
Sbjct  618  QVAIGGGGGNPFLGQQMSSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKL  677

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  678  AQLLIEKETVDGEEFMSLFIDGKAELYVS  706



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  497  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  556

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  557  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  616

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQQMS+QKDYSMATAD+VDAEVRELVE+AY+RATQIITT IDILHKL
Sbjct  617  QVAVGGAGGNPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYARATQIITTQIDILHKL  676

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  677  AQLLIEKETVDGEEFMSLFIDGQAELYVS  705



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+E+KKLVAYHEAGHALVGALMPEYDPVAKISIIPRG AGGLTFFAPSEERLES
Sbjct  420  KKNAVVSEERKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGGAGGLTFFAPSEERLES  479

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEEVIFG +NVTTGASNDF QVSRVARQMVERFGFS KIG
Sbjct  480  GLYSRSYLENQMAVALGGRIAEEVIFGPENVTTGASNDFQQVSRVARQMVERFGFSNKIG  539

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQQ+S Q DYSMATADVVDAEVRELVE AY+RA  +ITTH++ILHKL
Sbjct  540  QVALGGSGGNPFLGQQLSQQSDYSMATADVVDAEVRELVESAYARAKHLITTHVEILHKL  599

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A LLIEKETVDGEEF+SLF+DG AEL++
Sbjct  600  ANLLIEKETVDGEEFLSLFVDGNAELYL  627



>dbj|BAH20236.1| AT5G42270 [Arabidopsis thaliana]
Length=510

 Score =   367 bits (941),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  302  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  361

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  362  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIG  421

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKL
Sbjct  422  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKL  481

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  482  AQLLIEKETVDGEEFMSLFIDGQAELYVS  510



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  497  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  556

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  557  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  616

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            QIAIGG GGNPFLGQQM++ KDYSMATADVVD EVRELVE AY RAT+I+ THIDILHKL
Sbjct  617  QIAIGGGGGNPFLGQQMASSKDYSMATADVVDGEVRELVETAYKRATEIVNTHIDILHKL  676

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+V+
Sbjct  677  AQLLIEKETVDGEEFMSLFIDGKAELYVS  705



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  501  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  560

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  561  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  620

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+IITT IDILHKL
Sbjct  621  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIITTQIDILHKL  680

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  681  AQLLMEKETVDGEEFMSLFIDGQAELYVS  709



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = -2

Query  683  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  504
            EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG
Sbjct  308  EAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALG  367

Query  503  GRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAIGGPGGNPFLGQQM  324
            GRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIGQ+AIGG GGNPFLGQQM
Sbjct  368  GRVAEEVIFGQDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGGGGNPFLGQQM  427

Query  323  STQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLLIEKETVDGEEFMS  144
            S+QKDYSMATAD+VD EVRELV++AY RATQII THIDILHKLAQLLIEKETVDGEEFMS
Sbjct  428  SSQKDYSMATADIVDKEVRELVDKAYERATQIINTHIDILHKLAQLLIEKETVDGEEFMS  487

Query  143  LFIDGKAELFVA  108
            LFIDGKAEL+V+
Sbjct  488  LFIDGKAELYVS  499



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   370 bits (950),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  499  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  558

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  559  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  618

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT IDILHKL
Sbjct  619  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQIDILHKL  678

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  679  AQLLMEKETVDGEEFMSLFIDGQAELYVS  707



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   370 bits (949),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  500  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  559

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  560  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  619

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY+RAT+I+TT IDILHKL
Sbjct  620  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYARATEIVTTQIDILHKL  679

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  680  AQLLMEKETVDGEEFMSLFIDGQAELYVS  708



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  493  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  552

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  553  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIG  612

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKL
Sbjct  613  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKL  672

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  673  AQLLIEKETVDGEEFMSLFIDGQAELYVS  701



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  496  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  556  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIG  615

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVRELVE+AY RA +IITT IDILHKL
Sbjct  616  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRELVEKAYVRAKEIITTQIDILHKL  675

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  676  AQLLIEKETVDGEEFMSLFIDGQAELYVS  704



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISI+PRGQAGGLTFFAPSEERLES
Sbjct  498  KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISILPRGQAGGLTFFAPSEERLES  557

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  558  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIG  617

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY+RA +I+TT IDILHKL
Sbjct  618  QVAVGGAGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYARAKEIVTTQIDILHKL  677

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDG+AEL+V+
Sbjct  678  AQLLIEKETVDGEEFMSLFIDGQAELYVS  706



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   367 bits (941),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  490  KKNAVVSEEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  549

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  550  GLYSRSYLENQMAVALGGRVAEEVIFGKDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  609

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQ MS+QKDYSMATAD+VDAEVRELVERAY RAT IITT IDILHKL
Sbjct  610  QVAIGGGGGNPFLGQSMSSQKDYSMATADIVDAEVRELVERAYERATTIITTQIDILHKL  669

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLLIEKETVDGEEFMSLFIDGKAEL+++
Sbjct  670  AQLLIEKETVDGEEFMSLFIDGKAELYIS  698



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS++KK+LVAYHEAGHALVGALMPEYD VAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  502  KKNAVVSEDKKRLVAYHEAGHALVGALMPEYDAVAKISIIPRGQAGGLTFFAPSEERLES  561

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  562  GLYSRSYLENQMAVALGGRVAEEVIFGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  621

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR+LVE+AY+RAT+I+TT IDILHKL
Sbjct  622  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVRKLVEKAYARATEIVTTQIDILHKL  681

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDG+AEL+V+
Sbjct  682  AQLLMEKETVDGEEFMSLFIDGQAELYVS  710



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHAL G   PEY+PVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  440  KKNAVVSEEKKRLVAYHEAGHALGGCSYPEYNPVAKISIIPRGQAGGLTFFAPSEERLES  499

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMA +LGGRVAEEVIFG++NVTTGASNDFMQVSRVARQM+ERFGFSKKIG
Sbjct  500  GLYSRSYLENQMACSLGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMIERFGFSKKIG  559

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A+GGPGGNPF+GQQMS+QKDYSMATAD+VDAEVRELVE+AY RAT+IITTHIDILHKL
Sbjct  560  QVAVGGPGGNPFMGQQMSSQKDYSMATADIVDAEVRELVEKAYKRATEIITTHIDILHKL  619

Query  194  AQLLIEKETVDGEE  153
            AQLLIEKETV GE+
Sbjct  620  AQLLIEKETVAGED  633



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  476  KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  535

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVER GFSKKIG
Sbjct  536  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERLGFSKKIG  595

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMSTQKDYSMATADVVD+EVRELVE+AY RA QIITTHIDILHKL
Sbjct  596  QVAIGGGGGNPFLGQQMSTQKDYSMATADVVDSEVRELVEKAYERAKQIITTHIDILHKL  655

Query  194  AQLLIEK  174
            AQLLIEK
Sbjct  656  AQLLIEK  662



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EK+KLVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLES
Sbjct  426  KKNAVVSEEKRKLVAYHEAGHALVGALMPEYDPVAKISIVPRGGAGGLTFFAPSEERLES  485

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  486  GLYSRSYLENQMAVALGGRIAEELIYGAENVTTGASNDFMQVSRVARQMVERFGFSKKIG  545

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  I+ THIDILHKL
Sbjct  546  QLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHIDILHKL  605

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  606  AALLLEKETVDGEEFLNLFIDGQAELYV  633



>gb|AIS72760.1| ATP-dependent zinc metalloprotease chloroplastic-like protein, 
partial [Rhizophora apiculata]
Length=236

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  66   KKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  125

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  126  GLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  185

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIIT  222
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AY+RA QI+T
Sbjct  186  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYTRAKQIVT  236



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EK+ LVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLES
Sbjct  439  KKNAVVSEEKRTLVAYHEAGHALVGALMPEYDPVAKISIVPRGGAGGLTFFAPSEERLES  498

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+I+G +NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  499  GLYSRSYLENQMAVALGGRIAEELIYGTENVTTGASNDFMQVSRVARQMVERFGFSKKIG  558

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+++GG GGNPFLGQ    Q D+SMATADV+DAEVRELVE AY+RA  I+ THIDILHKL
Sbjct  559  QLSLGGGGGNPFLGQSAGQQSDHSMATADVIDAEVRELVETAYTRAKTIMETHIDILHKL  618

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A LL+EKETVDGEEF++LFIDG+AEL+V
Sbjct  619  AALLLEKETVDGEEFLNLFIDGQAELYV  646



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 187/209 (89%), Gaps = 17/209 (8%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYH                 AKISIIPRGQAGGLTFFAPSEERLES
Sbjct  491  KKNAVVSDEKKKLVAYH-----------------AKISIIPRGQAGGLTFFAPSEERLES  533

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEEVIFGE+NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  534  GLYSRSYLENQMAVALGGRIAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIG  593

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGG GGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AY+RA QIITTHIDILHKL
Sbjct  594  QVAIGGGGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYTRAKQIITTHIDILHKL  653

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  654  AQLLMEKETVDGEEFMSLFIDGKAELYVS  682



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 179/209 (86%), Gaps = 27/209 (13%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVSDEKKKLVAYH                           AGGLTFFAPSEERLES
Sbjct  511  KKNAVVSDEKKKLVAYH---------------------------AGGLTFFAPSEERLES  543

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG+DNVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  544  GLYSRSYLENQMAVALGGRVAEEVIFGDDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  603

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVRELVE+AYSRA QIITTHIDILHKL
Sbjct  604  QVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVEKAYSRAKQIITTHIDILHKL  663

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQLL+EKETVDGEEFMSLFIDGKAEL+V+
Sbjct  664  AQLLVEKETVDGEEFMSLFIDGKAELYVS  692



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   300 bits (768),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+++ KK+LVAYHEAGHALVGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLES
Sbjct  512  KKGAVMTEAKKRLVAYHEAGHALVGALMPEYDPVAKISIVPRGSAGGLTFFAPSEERLES  571

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGEDNVTTGASNDFMQV+R A+ MV + GFSKK+G
Sbjct  572  GLYSRSYLENQMAVALGGRIAEEIIFGEDNVTTGASNDFMQVARTAKMMVTQMGFSKKLG  631

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A  G GG  FLGQ M    D S  T+D +DAEV++LV+RAY RA  ++ ++I +LHK 
Sbjct  632  QVAWSGGGGPSFLGQSMGQPADCSGQTSDEIDAEVKQLVDRAYRRAKDLMQSNITVLHKT  691

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A++L+E+E +DG+EF+ L ++ +AE ++
Sbjct  692  AEVLLEREQIDGDEFLRLILESQAENYL  719



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  722  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYS  543
            V+S++KK+LVAYHEAGHA+VGALMPEYDPVAKISI+PRG AGGLTFFAPSEERLESGLYS
Sbjct  503  VMSEKKKRLVAYHEAGHAIVGALMPEYDPVAKISIVPRGAAGGLTFFAPSEERLESGLYS  562

Query  542  RSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAI  363
            RSYLENQMAVA+GGRVAEE+IFG ++VTTGAS DF QVS+ ARQM+E  GFSKKIGQIA+
Sbjct  563  RSYLENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVSQTARQMIETMGFSKKIGQIAL  622

Query  362  GGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLL  183
               GG  FLG +M    DY  ATAD+VD+EV+ELV +AY RA  +++ +ID+LHK+A +L
Sbjct  623  KTGGGQSFLGGEMGRSADYGPATADLVDSEVKELVTKAYRRAKDLVSINIDVLHKVADVL  682

Query  182  IEKETVDGEEFMSLFIDGKAELFV  111
            +EKE +DG+EF  +  + K+EL++
Sbjct  683  MEKENIDGDEFEKIMFNAKSELYL  706



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   296 bits (759),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  740  QRRKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERL  561
            +R  +P++  +    + + EAGHALVGAL+PEYDPVAKISIIPRGQAGGLTFFAPSEERL
Sbjct  519  RRNWLPIMVFDFLYALKFTEAGHALVGALIPEYDPVAKISIIPRGQAGGLTFFAPSEERL  578

Query  560  ESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKK  381
            ESGLYSRSYLENQMAVAL GR+AEEVIFGE+NVTTGASNDFMQVSRVAR MVERFGFSKK
Sbjct  579  ESGLYSRSYLENQMAVALSGRIAEEVIFGEENVTTGASNDFMQVSRVARHMVERFGFSKK  638

Query  380  IGQIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQI  228
            IG++AIGGPGGNPFLGQQMS+QKDYSMATADVVDAEVR+LVE AYSRA QI
Sbjct  639  IGRVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRDLVETAYSRAKQI  689



>gb|KIY93255.1| cell division protease FtsH [Monoraphidium neglectum]
Length=548

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KKKLVAYHEAGHALVGALMP+YDPV KISI+PRG AGGLTFFAPSEERLES
Sbjct  327  KKGAVMSDKKKKLVAYHEAGHALVGALMPDYDPVTKISIVPRGAAGGLTFFAPSEERLES  386

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR MV + GFSK +G
Sbjct  387  GLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGFSKVLG  446

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A    GGN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  +I ++IDILHK 
Sbjct  447  QVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKALVERAYRRAKDLIQSNIDILHKT  506

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  507  AAVLLEKENIDGDEFQQIVLESQAQQYL  534



>ref|WP_025961749.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_521C8]
Length=213

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  4    KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  63

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  64   GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  123

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MST +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  124  PVALGQSQGGMFLGRDMSTTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  183

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  184  AQMLIERETIDTEDIQDLL--NRSEVKVA  210



>dbj|BAH20250.1| AT5G42270 [Arabidopsis thaliana]
Length=215

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+EKK+LVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES
Sbjct  60   KKNAVVSEEKKRLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  119

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGRVAEEVIFG++NVTTGASNDFMQVSRVARQMVERFGFSKKIG
Sbjct  120  GLYSRSYLENQMAVALGGRVAEEVIFGDENVTTGASNDFMQVSRVARQMVERFGFSKKIG  179

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVR  267
            Q+A+GG GGNPFLGQ MS+QKDYSMATADVVDAEVR
Sbjct  180  QVAVGGAGGNPFLGQSMSSQKDYSMATADVVDAEVR  215



>ref|WP_025929131.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=242

 Score =   280 bits (716),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  33   KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  92

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  93   GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  152

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  153  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  212

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  213  AQMLIERETIDTEDIQDLL--NRSEVKVA  239



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KKKLVAYHEAGHALVGALMP+YDPV KISI+PRG AGGLTFFAPSEERLES
Sbjct  513  KKGAVMSDKKKKLVAYHEAGHALVGALMPDYDPVTKISIVPRGAAGGLTFFAPSEERLES  572

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+Y ENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R AR MV + GFSK +G
Sbjct  573  GLYSRTYFENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRTARLMVTQLGFSKALG  632

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A    GGN FLGQ M+   D+S  TAD +D EV+ LVERAY RA  +I ++IDILHK 
Sbjct  633  QVAWSSGGGNAFLGQSMAQPADFSSQTADEIDQEVKSLVERAYRRAKDLIQSNIDILHKT  692

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A +L+EKE +DG+EF  + ++ +A+ ++
Sbjct  693  AAVLLEKENIDGDEFQQIVLESQAQQYL  720



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+K++LVAYHEAGHALVGALMPEYDPV KISI+PRG AGGLTFFAPSEERLES
Sbjct  506  KKGAVMSDKKRRLVAYHEAGHALVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLES  565

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR MV + G SKK+G
Sbjct  566  GLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGLSKKLG  625

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A    GG  FLG   +   D+S +TAD +D+EV+ELVERAY RA  ++  +IDILHK+
Sbjct  626  QVAWSNQGGASFLGASAAQPADFSQSTADEIDSEVKELVERAYRRAKDLVEQNIDILHKV  685

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A +LIEKE +DG+EF  + +  +A+ + 
Sbjct  686  AAVLIEKENIDGDEFQQIVLASQAQQYT  713



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S++K++LVAYHEAGHALVGALMPEYDPV KISI+PRG AGGLTFFAPSEERLES
Sbjct  501  KKGAVMSEKKRRLVAYHEAGHALVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLES  560

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YLENQMAVALGGR+AEE+IFGED++TTGAS DF QV+R+AR MV + G SKK+G
Sbjct  561  GLYSRTYLENQMAVALGGRIAEELIFGEDDITTGASGDFQQVTRIARLMVTQLGLSKKLG  620

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A    GG  FLG   +   D+S ATAD +D EV+ELVERAY RA  ++ ++IDILHK+
Sbjct  621  QVAWSSSGGAQFLGASAAQPADFSQATADEIDNEVKELVERAYRRAKDLVVSNIDILHKV  680

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A +LIEKE +DG+EF  + +  +A+ ++
Sbjct  681  AAVLIEKENIDGDEFQQIVLASQAQQYL  708



>ref|WP_029963924.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_526K3]
Length=337

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  128  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  187

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  188  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  247

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  248  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  307

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  308  AQMLIERETIDTEDIQDLL--NRSEVKVA  334



>ref|WP_025947145.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_528N8]
Length=347

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  138  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  197

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  198  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  257

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  258  PVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  317

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  318  AQMLIERETIDTEDIQDLL--NRSEVKVA  344



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLT+F PSEERLES
Sbjct  405  KKDRVMSEKRKSLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTWFTPSEERLES  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQMV RFG S+K+G
Sbjct  465  GLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQMVTRFGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  +L +L
Sbjct  525  PVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRSLVDVAYSRAKQVLVENRKVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +L++KETVD +E   L ID    +
Sbjct  585  ADMLVDKETVDSDELQRLLIDNNVSM  610



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score =   285 bits (728),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLT+F PSEERLES
Sbjct  405  KKDRVMSEKRKSLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTWFTPSEERLES  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+RVARQM+ RFG S+K+G
Sbjct  465  GLYSRSYLKNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVARVARQMITRFGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GNPFLG+ ++T++D+S  TA V+DAEVR LV+ AYSRA Q++  +  +L +L
Sbjct  525  PVALGRQQGNPFLGRDIATERDFSEETAAVIDAEVRGLVDVAYSRAKQVLVENRKVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L++KETVD +E   L ID    +
Sbjct  585  AEMLVDKETVDSDELQRLLIDNNVSM  610



>ref|WP_025970576.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521M10]
Length=396

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  187  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  246

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  247  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  306

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  307  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  366

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  367  AQMLIERETIDTEDIQDLL--NRSEVKVA  393



>ref|WP_025954333.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=445

 Score =   277 bits (708),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  236  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  295

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  296  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  355

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  356  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  415

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  416  AQMLIERETIDTEDIQELL--NRSEVKVA  442



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   284 bits (727),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  722  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYS  543
            V+S++KK+LVAYHEAGHA+VGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYS
Sbjct  501  VMSEKKKRLVAYHEAGHAIVGALMPEYDPVTKISIVPRGAAGGLTFFAPSEERLESGLYS  560

Query  542  RSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAI  363
            R+YLENQMAVA+GGRVAEE+IFG +NVTTGAS DF QVSR AR M+E+ GFS+KIGQIA+
Sbjct  561  RTYLENQMAVAMGGRVAEELIFGAENVTTGASGDFQQVSRTARMMIEQMGFSEKIGQIAL  620

Query  362  GGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLL  183
               GG  FLG       DYS ATAD+VD+EV+ LVE AY RA  ++  +I  LH +A++L
Sbjct  621  KTGGGQTFLGNDAGRGADYSQATADIVDSEVQALVEVAYRRAKDLVQENIQCLHDVAEVL  680

Query  182  IEKETVDGEEFMSLFIDGKAELFV  111
            ++KE +DG+EF  + +  KA+L++
Sbjct  681  LDKENIDGDEFEQIMLKAKAKLYL  704



>ref|WP_025971093.1| cell division protein FtsH, partial [Prochlorococcus sp. scB245a_521N5]
Length=471

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  262  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  321

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  322  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  381

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  382  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  441

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  442  AQMLIERETIDTEDIQDLL--NRSEVKVA  468



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -2

Query  722  VVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYS  543
            V+S++KK+LVAYHEAGHA+VGALMPEYDPV KISI+PRG AGGLTFFAPSEERLESGLYS
Sbjct  512  VMSEKKKRLVAYHEAGHAIVGALMPEYDPVTKISIVPRGNAGGLTFFAPSEERLESGLYS  571

Query  542  RSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIGQIAI  363
            R+YLENQMAVA+GGR+AEE+IFG +NVTTGAS DF QVS  AR MVE+ GFS+KIGQIA+
Sbjct  572  RTYLENQMAVAMGGRIAEELIFGAENVTTGASGDFQQVSNTARMMVEQMGFSEKIGQIAL  631

Query  362  GGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKLAQLL  183
               GG  FLG       DYS  TA++VD EV+ LVE AY RA  ++  +ID LH +A++L
Sbjct  632  KTGGGQSFLGNDAGRAADYSQTTANIVDDEVKILVETAYRRAKDLVQENIDCLHAVAEVL  691

Query  182  IEKETVDGEEFMSLFIDGKAELFV  111
            +EKE +DG+EF  + +  +A+L++
Sbjct  692  LEKENIDGDEFEEIMLKARAKLYL  715



>ref|WP_044452063.1| cell division protein FtsH, partial [Mastigocladus laminosus]
 gb|KIY10627.1| cell division protein FtsH, partial [Mastigocladus laminosus 
UU774]
Length=405

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  196  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  255

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G
Sbjct  256  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLG  315

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +L
Sbjct  316  PVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQL  375

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  376  AEMLVEKETVDAEELQDLL  394



>gb|KGF94553.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9201]
Length=580

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  371  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  430

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  431  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  490

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T + ++L ++
Sbjct  491  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRNVLDEM  550

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  551  AQMLIERETIDTEDIQDLL--NRSEVKVA  577



>ref|WP_025958220.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L15]
Length=538

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  329  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  388

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  389  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  448

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  449  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  508

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  509  AQMLIERETIDTEDIQDLL--NRSEVKVA  535



>ref|WP_032522853.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T + ++L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRNVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025944375.1| cell division protein FtsH [Prochlorococcus sp. scB241_529C4]
Length=617

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG03814.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG10073.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9401]
Length=580

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  371  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  430

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  431  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  490

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  491  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEM  550

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  551  AQMLIERETIDTEDIQDLL--NRSEVVVA  577



>ref|WP_025935637.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025971671.1| cell division protein FtsH [Prochlorococcus sp. scB241_527L22]
Length=617

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025939914.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGG06312.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9322]
Length=600

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  391  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  450

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  451  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  510

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  511  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEM  570

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  571  AQMLIERETIDTEDIQDLL--NRSEVVVA  597



>ref|WP_025922112.1| cell division protein FtsH [Prochlorococcus sp. scB241_529D18]
Length=617

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025900256.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQELL--NRSEVKVA  614



>ref|WP_025969610.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520E22]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKQLVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032519670.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG08326.1| Cell division protein FtsH [Prochlorococcus marinus str. SB]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025980194.1| cell division protein FtsH [Prochlorococcus sp. scB243_498F21]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025924120.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025890345.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025964562.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P15]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025967396.1| cell division protein FtsH [Prochlorococcus sp. scB243_498P3]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGLFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025959316.1| cell division protein FtsH [Prochlorococcus sp. scB241_527I9]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032515715.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG01911.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9314]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025951376.1| cell division protein FtsH [Prochlorococcus sp. scB243_495N4]
Length=617

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSSRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032517345.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRSVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVVVA  614



>ref|WP_025892538.1| cell division protein FtsH [Prochlorococcus sp. scB241_527N11]
Length=617

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|KGF88464.1| cell division protein FtsH2 [Prochlorococcus marinus str. GP2]
Length=580

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  371  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  430

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  431  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  490

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++
Sbjct  491  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEM  550

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LIE+ET+D E+   L 
Sbjct  551  AQMLIERETIDTEDIQDLL  569



>ref|WP_025937982.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519A13]
Length=617

 Score =   276 bits (707),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQELL--NRSEVTVA  614



>ref|WP_006911156.1| cell division protein FtsH [Cyanobium sp. PCC 7001]
 gb|EDY39239.1| ATP-dependent metalloprotease FtsH [Cyanobium sp. PCC 7001]
Length=614

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  405  KKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+I+G+D VTTGASND  QV+RVARQMV RFG S+K+G
Sbjct  465  GLYSRAYLQNQMAVALGGRVAEEIIYGDDEVTTGASNDLQQVARVARQMVTRFGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LVE AY RAT+++T +  +L +L
Sbjct  525  PVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSQLVEEAYRRATEVLTNNRAVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKETVD EE   L I
Sbjct  585  ADLLVEKETVDAEELQELLI  604



>gb|AIQ94296.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=603

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  394  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  453

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  454  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  513

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  514  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  573

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  574  AQMLIERETIDTEDIQDLL--NRSEVKVA  600



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score =   276 bits (706),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+RLES
Sbjct  404  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRLES  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G
Sbjct  464  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +DAEVR LV++AY+RA Q++T +  +L +L
Sbjct  524  PVALGRQQGNMFLGRDIAAERDFSEETAATIDAEVRGLVDQAYARAKQVLTNNRHVLDQL  583

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L++KETVD EE   L 
Sbjct  584  AKMLVDKETVDSEELQHLL  602



>ref|WP_002806664.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|EEE40173.1| ATP-dependent metallopeptidase HflB subfamily protein [Prochlorococcus 
marinus str. MIT 9202]
Length=617

 Score =   276 bits (706),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025956453.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQM+VALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMSVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025921388.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025941250.1| cell division protein FtsH [Prochlorococcus sp. scB245a_518O7]
Length=617

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSQLVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025925903.1| cell division protein FtsH [Prochlorococcus sp. scB241_528J8]
Length=617

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_011817719.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM69535.1| cell division protein FtsH2 [Prochlorococcus marinus str. AS9601]
Length=617

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>gb|ABX08179.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9211]
Length=602

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  393  KKDRVMSDRRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  452

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  453  GLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGMSDKLG  512

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++T +  +L +L
Sbjct  513  PVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQVLDQL  572

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+EKETV+ E+   L I  + E+
Sbjct  573  AEMLVEKETVNSEDLQDLLIQSQVEV  598



>ref|WP_025937318.1| cell division protein FtsH [Prochlorococcus sp. scB245a_519O21]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025971407.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L16]
Length=598

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  389  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  448

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  449  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  508

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  509  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  568

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  569  AQMLIERETINTEDIQDLL--NRSEVKVA  595



>ref|WP_025933036.1| cell division protein FtsH [Prochlorococcus sp. scB243_498A3]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025929709.1| cell division protein FtsH [Prochlorococcus sp. scB241_528O2]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  IL ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSELVDMAYKRATKVLSDNRTILDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025914082.1| cell division protein FtsH [Prochlorococcus sp. scB245a_520K10]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_032523992.1| cell division protein FtsH [Prochlorococcus marinus]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSDLVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LIE+ET+D E+   L 
Sbjct  588  AQMLIERETIDTEDIQDLL  606



>ref|WP_012007029.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABV49865.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9215]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025981174.1| cell division protein FtsH [Prochlorococcus sp. scB245a_521B10]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  588  AQMLIERETINTEDIQDLL--NRSEVKVA  614



>ref|WP_025965256.1| cell division protein FtsH [Prochlorococcus sp. scB243_496M6]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDIAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_025979191.1| cell division protein FtsH [Prochlorococcus sp. scB243_497E17]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_042849723.1| cell division protein FtsH [Prochlorococcus sp. MIT 0604]
Length=617

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA Q++T +  +L +L
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKQVLTDNRHVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE   L 
Sbjct  585  AQMLVEKETVDAEELQELL  603



>ref|WP_025925013.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET++ E+   L    ++E+ VA
Sbjct  588  AQMLIERETINTEDIQDLL--NRSEVKVA  614



>ref|WP_041391000.1| cell division protein FtsH [Prochlorococcus marinus]
Length=615

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  406  KKDRVMSDRRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  466  GLYSRSYLHNQMAVALGGRVAEEIVYGEDEVTTGASNDLKQVAQVARQMVTRFGMSDKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++T +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDMAYKRATKVLTNNRQVLDQL  585

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+EKETV+ E+   L I  + E+
Sbjct  586  AEMLVEKETVNSEDLQDLLIQSQVEV  611



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+RLES
Sbjct  404  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRLES  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G
Sbjct  464  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +D+EVR LV++AY+RA Q++T +  +L +L
Sbjct  524  PVALGRQQGNMFLGRDIAAERDFSEETAATIDSEVRGLVDQAYTRAKQVLTNNRHVLDQL  583

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L++KETVD EE   L 
Sbjct  584  ANMLVDKETVDSEELQQLL  602



>ref|WP_011862269.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABO16871.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9301]
Length=617

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S++KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISEKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_044106285.1| cell division protein FtsH [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17558.1| cell division protein [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=616

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA V+D EVR+LV  AY RA  ++  +  IL KL
Sbjct  527  PVALGRQNGNVFLGRDIASDRDFSDETAAVIDEEVRQLVNNAYIRAKDVLVNNRHILDKL  586

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE  S+ 
Sbjct  587  AEMLVEKETVDAEELQSIL  605



>ref|WP_011375794.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABB49290.1| membrane protease FtsH catalytic subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG00943.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9311]
Length=617

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDIAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LIE+ET+D E+   L 
Sbjct  588  AQMLIERETIDTEDIQDLL  606



>ref|WP_032514590.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF89182.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF89938.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF95373.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9123]
Length=617

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ M++ +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMTSSRDFSEDTAATIDEEVSELVDIAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LIE+ET+D E+   L 
Sbjct  588  AQMLIERETIDTEDIQDLL  606



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LV++AY RA +++  +  IL KL
Sbjct  527  PVALGRQSGNVFLGRDIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVGNRHILDKL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +L+EKETVD EEF  L  +   ++
Sbjct  587  ADMLVEKETVDSEEFQDLLANNDVKM  612



>gb|ADF81075.1| FtsH [Corallina officinalis]
Length=221

 Score =   262 bits (670),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K PV+S+ +K LVAYHEAGHA+VGAL P+YD VAKI+IIPRG AGGLTFFAP+E+R++S
Sbjct  8    KKNPVMSEGRKALVAYHEAGHAIVGALTPDYDQVAKITIIPRGGAGGLTFFAPNEQRVDS  67

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR +LE Q+AVALGGR+AEE+IFG++N+TTGASND  +V++VARQMV RFG SKK+G
Sbjct  68   GLYSRQFLEGQLAVALGGRIAEEIIFGDENITTGASNDLQRVTQVARQMVTRFGMSKKVG  127

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADV-VDAEVRELVERAYSRATQIITTHIDILHK  198
            QI     GGNPFLG+QM++Q     +T  + +D EVR LV+ AY+RA  ++TT+  +L  
Sbjct  128  QIVHSSDGGNPFLGRQMASQSPQIGSTTKMAIDDEVRRLVDIAYNRAKTLLTTNRSLLDD  187

Query  197  LAQLLIEKETVDGEEFMSLFIDGKAELFV  111
            LA++LIEKETV  +EF  L    K E+ +
Sbjct  188  LAKMLIEKETVSADEFQRLLATSKVEMMM  216



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  VVS+ K++LVAYHE GHALVGALMPEYD V+KISI+PRG AGGLTFFAPSEERLE+
Sbjct  501  KKGAVVSESKRRLVAYHEGGHALVGALMPEYDAVSKISIVPRGNAGGLTFFAPSEERLEN  560

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQM+VALGGRVAEE+I G DNVTTGAS DF QV+RVAR MVE+ GFS  +G
Sbjct  561  GLYSRSYLENQMSVALGGRVAEELILGPDNVTTGASGDFQQVTRVARMMVEQMGFSDSLG  620

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            Q+A    GG  FLG QM+   + S  T D++D EV+ LV+RAY RA  +I  +I +LH+ 
Sbjct  621  QVAWSQSGGGSFLGAQMAQPANCSGETQDIIDKEVKSLVDRAYRRAKDLIQNNISVLHRT  680

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A++L+EKE +DGEE  +L ++ ++E ++
Sbjct  681  AEILLEKEQMDGEELQALLLEAQSEQYL  708



>gb|KGG30054.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0703]
Length=397

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ES
Sbjct  188  KKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMES  247

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  248  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  307

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +L
Sbjct  308  PVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDEL  367

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKETVD ++   L I
Sbjct  368  ADLLVEKETVDAQDLQELLI  387



>ref|WP_036973151.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=402

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ES
Sbjct  193  KKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMES  252

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  253  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  312

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +L
Sbjct  313  PVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDEL  372

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKETVD ++   L I
Sbjct  373  ADLLVEKETVDAQDLQELLI  392



>ref|WP_012593655.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACK64378.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACU99241.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=616

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 166/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVSRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV++AY RA  ++  +  IL KL
Sbjct  527  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRQLVDQAYKRAKDVLVNNRHILDKL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD +E   +    + ++
Sbjct  587  AQMLVEKETVDADELQEILTSNEVKM  612



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 165/199 (83%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV R+G S+K+G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRYGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA  +D EVR+LV+ AY RA Q++T +  IL +L
Sbjct  525  PVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTENRHILDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQLL+EKETVD EE   L 
Sbjct  585  AQLLMEKETVDAEELQELL  603



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score =   273 bits (699),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +L
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  585  AEMLVEKETVDAEELQDLL  603



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   273 bits (699),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  VD EVR+LV+ AY+RA +++T +  +L +L
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAVDEEVRQLVDSAYARAKKVLTENRHVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  585  AEMLVEKETVDAEELQDLL  603



>ref|WP_028953545.1| cell division protein FtsH [Synechococcus sp. CC9616]
Length=615

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ KK+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ES
Sbjct  406  KKDAVISERKKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQM+ RFG S K+G
Sbjct  466  GLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGMSDKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RATQ++  +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATQVLVDNRSVLDEL  585

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKETVD EE   L I
Sbjct  586  ADLLVEKETVDAEELQELLI  605



>ref|WP_010871638.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 ref|NP_440330.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 sp|P72991.1|FTSH3_SYNY3 RecName: Full=ATP-dependent zinc metalloprotease FtsH 3 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA17010.1| cell division protein; FtsH [Synechocystis sp. PCC 6803]
 dbj|BAK49182.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 dbj|BAL28181.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31351.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34520.1| cell division protein FtsH [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50723.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
 gb|AGF50699.1| cell division protein FtsH [Synechocystis sp. PCC 6803]
Length=616

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++AY RA Q++  +  IL +L
Sbjct  527  PVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKQVLVENRGILDQL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+EKETVD EE  +L  +  A+L
Sbjct  587  AEILVEKETVDSEELQTLLANNNAKL  612



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+K+G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSEKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA +++T +  +L +L
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVDSAYARAKKVLTDNRHVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  585  AEMLVEKETVDAEELQDLL  603



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRTILDQL  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD EE  ++  +   ++
Sbjct  588  AQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_008275101.1| cell division protein FtsH [Cyanothece sp. CCY0110]
 gb|EAZ91781.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=617

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AYSRA  ++ ++  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSNETASTIDNEVRQLVDTAYSRAKDVLESNRHILDRL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD +E   + 
Sbjct  588  ADMLVEKETVDSDELQEIL  606



>ref|WP_019478058.1| cell division protein FtsH [Prochlorococcus sp. W8]
Length=618

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  409  KKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  468

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  469  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  528

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++
Sbjct  529  PVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKVLTDNRGMLDEM  588

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A++LIE+ET+D E+   L    ++E+ VA
Sbjct  589  AEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_025922823.1| cell division protein FtsH [Prochlorococcus sp. scB243_495D8]
Length=617

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 169/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S +KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISAKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRIVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD EE  ++  +   ++
Sbjct  588  AQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD EE  ++  +   ++
Sbjct  588  AQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD EE  ++  +   ++
Sbjct  588  AQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_032527521.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF96190.1| Cell division protein FtsH [Prochlorococcus marinus str. MIT 
9302]
Length=617

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  408  KKDRVISDKKKELVAYHEAGHALVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV +LV+ AY RAT++++ +  +L ++
Sbjct  528  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDEEVSDLVDIAYKRATKVLSDNRTVLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A++LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AEMLIERETIDTEDIQDLL--NRSEVKVA  614



>ref|WP_036922150.1| cell division protein FtsH [Prochlorococcus marinus]
Length=618

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  409  KKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  468

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  469  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  528

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++
Sbjct  529  PVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKVLTENRGMLDEM  588

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A++LIE+ET+D E+   L    ++E+ VA
Sbjct  589  AEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_019477234.1| cell division protein FtsH [Prochlorococcus sp. W7]
Length=618

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  409  KKDRVISDRKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERMES  468

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  469  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  528

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D+EV ELV+ AY RAT+++T +  +L ++
Sbjct  529  PVALGRSQGGMFLGRDIASERDFSEDTAATIDSEVSELVDSAYKRATKVLTENRGMLDEM  588

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A++LIE+ET+D E+   L    ++E+ VA
Sbjct  589  AEMLIERETIDSEDIQDLI--NRSEVKVA  615



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+E+
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMET  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  463  GLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA  +D EVRELVE AY RA +++ ++  IL +L
Sbjct  523  PVALGRQQGNMFLGRDIVAERDFSEETAAAIDDEVRELVEVAYRRAKEVLVSNRHILDQL  582

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LI+KETVD EE   L 
Sbjct  583  AQMLIDKETVDAEELQELL  601



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 165/199 (83%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EV +LV+ AY+RA Q++T +  IL +L
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVHQLVDSAYARAKQVLTDNRHILDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  585  AEMLVEKETVDAEELQELL  603



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE  ++ 
Sbjct  588  AQMLVEKETVDAEELQNIL  606



>ref|WP_036901462.1| cell division protein FtsH [Prochlorococcus sp. MIT 0601]
 gb|KGG13140.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0601]
Length=615

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 172/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  406  KKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S+K+G
Sbjct  466  GLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLTQVAQVARQMVTRFGMSEKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIASERDFSEDTAATIDEEVSQLVDFAYKRATKVLIDNRKVLDEL  585

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A++L+EKETVD E+  +L I  K+E+ +A
Sbjct  586  AEMLVEKETVDSEQLQNLLI--KSEVKIA  612



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE  ++ 
Sbjct  588  AQMLVEKETVDAEELQNIL  606



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRVILDQL  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD EE  ++  +   ++
Sbjct  588  AQMLVEKETVDAEELQNILANNDVKM  613



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE  ++ 
Sbjct  588  AQMLVEKETVDAEELQNIL  606



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRAILDQL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE  ++ 
Sbjct  588  AQMLVEKETVDAEELQNIL  606



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKSRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +++  +  IL KL
Sbjct  527  PVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLVNNRHILDKL  586

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +LIEKETVD EE   + 
Sbjct  587  ADMLIEKETVDAEELQDVL  605



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR LVE+AY RA +++  +  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEVLVNNRVILDQL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE  ++ 
Sbjct  588  AQMLVEKETVDAEELQNIL  606



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEERLES
Sbjct  404  KKDRVMSEKRKVLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERLES  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE++FG++ VTTGASND  QV+  ARQMV RFG S  +G
Sbjct  464  GLYSRSYLQNQMAVALGGRLAEEIVFGDEEVTTGASNDLQQVANTARQMVTRFGMSDILG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GNPFLG+ +++++D+S  TA  +DAEVR LV++AY+R  Q++  +  IL +L
Sbjct  524  PVALGRQQGNPFLGRDIASERDFSEKTAASIDAEVRALVDQAYARCKQVLVENRHILDQL  583

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +L++KETVD EE  +L  +  A++
Sbjct  584  ADMLVDKETVDSEELQTLLANSNAKM  609



>ref|WP_019474071.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
Length=617

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLES
Sbjct  408  KKDRVISERKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGRSQGGMFLGRDIASERDFSEDTAATIDVEVSELVDVAYKRATKVLTENRGMLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLI--NRSEVKVA  614



>ref|WP_019476442.1| cell division protein FtsH [Prochlorococcus sp. W4]
Length=617

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 171/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ KK+LVAYHEAGHA+VGALMP+YDPVAK+SIIPRGQAGGLTFF PSEERLES
Sbjct  408  KKDRVISERKKELVAYHEAGHAIVGALMPDYDPVAKVSIIPRGQAGGLTFFTPSEERLES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S+KIG
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSEKIG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  528  PVALGRSQGGMFLGRDIASERDFSEDTAATIDVEVSELVDIAYKRATKVLTENRGMLDEM  587

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            AQ+LIE+ET+D E+   L    ++E+ VA
Sbjct  588  AQMLIERETIDTEDIQDLI--NRSEVKVA  614



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S ++K+LVAYHEAGHALVGALMP+YDP+ KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  406  KKNRVMSQKRKELVAYHEAGHALVGALMPDYDPIQKISIIPRGRAGGLTWFTPSEDRMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE++FGE+ VTTGASND  QV+RVARQM+ RFG S+++G
Sbjct  466  GLYSRSYLQNQMAVALGGRVAEEIVFGEEEVTTGASNDLQQVARVARQMITRFGMSERLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S +TA ++D EV++LV+ AY RA  ++  + ++L  L
Sbjct  526  PVALGRQNGNVFLGRDIASDRDFSDSTAAMIDEEVKKLVDVAYQRAKDVLQNNREVLDTL  585

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            AQ+L+EKETVD EE   L  +   +L
Sbjct  586  AQMLVEKETVDSEELQELLNNNDVKL  611



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score =   271 bits (692),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 165/199 (83%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  405  KKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+ +G
Sbjct  465  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSETLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++T +  +L +L
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYKRAKQVLTDNRHVLDQL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  585  AEMLVEKETVDAEELQELL  603



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  408  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  468  GLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY RA  ++ ++  IL +L
Sbjct  528  PVALGRQNGNVFLGRDIASDRDFSNETASTIDEEVRQLVDTAYKRAKDVLESNRHILDRL  587

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD +E   + 
Sbjct  588  ADMLVEKETVDSDELQEIL  606



>ref|WP_038542994.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
 gb|AII42342.1| cell division protein FtsH [Synechococcus sp. KORDI-100]
Length=615

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 162/201 (81%), Gaps = 0/201 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ KK+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ES
Sbjct  406  KKDAVISERKKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+I+GED VTTGASND  QV++VARQM+ RFG S K+G
Sbjct  466  GLYSRAYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLQQVAQVARQMITRFGMSDKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+++  +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIAAERDFSEDTASTIDQEVYDLVDVAYKRATKVLVDNRLVLDEL  585

Query  194  AQLLIEKETVDGEEFMSLFID  132
            A LL+EKETVD EE   L I+
Sbjct  586  ADLLVEKETVDAEELQELLIN  606



>ref|WP_015109466.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile]
 gb|AFY29018.1| ATP-dependent metalloprotease FtsH [Cyanobium gracile PCC 6307]
Length=614

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHE+GHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  405  KKDRVMSERRKRLVAYHESGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  465  GLYSRSYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  AY RAT+++  +  +L +L
Sbjct  525  PVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSQLVADAYRRATEVLLANRAVLDEL  584

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A+LL+EKETVD EE   L I
Sbjct  585  AELLVEKETVDAEELQELLI  604



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 166/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F PSE+R++S
Sbjct  403  KKDRVMSEKRKRLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPSEDRMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G
Sbjct  463  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D EVR+LV+ AY+RA  ++  +  IL KL
Sbjct  523  PVALGRQNGNMFLGRDIASDRDFSNTTAATIDEEVRKLVDEAYNRAKDVLVGNKHILDKL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            + +LIEKETVD EE   L  +   ++
Sbjct  583  SAMLIEKETVDAEELQELLAENDVKM  608



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  407  KKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+++++ +D+S  TA  +D EVR+LV++AYSRA  +++++  IL  L
Sbjct  527  PVALGRQQGNVFLGREIASDRDFSDETAAAIDEEVRKLVDQAYSRAKDVLSSNRHILDAL  586

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD EE  ++ 
Sbjct  587  ADMLVEKETVDAEELQNIL  605



>ref|WP_035832496.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
 gb|KEF41405.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=614

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 160/200 (80%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  405  KKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  465  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV  AY RAT ++  +  +L +L
Sbjct  525  PVALGRAQGGMFLGRDIAAERDFSEDTAAAIDEEVSALVAEAYRRATDVLVANRSVLDEL  584

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A+LL+EKETVD EE   L I
Sbjct  585  AELLVEKETVDAEELQELLI  604



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD +KKLVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F P+E++++S
Sbjct  403  KKDRVMSDRRKKLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEDQMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  463  GLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +++  +  +L ++
Sbjct  523  PVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRHVLDQI  582

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LIEKET+D EE  S+ 
Sbjct  583  AQVLIEKETIDAEELQSIL  601



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +++ +D+S  TA  +D E+R LV++AY RA +++  +  IL +L
Sbjct  527  PVALGRQNGNVFLGRDIASDRDFSDETASAIDEEIRNLVDQAYRRAKEVLVENRSILDRL  586

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L++KETVD +E   L 
Sbjct  587  AEMLVDKETVDSDELQDLL  605



>ref|WP_011819579.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM71467.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9515]
Length=619

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 167/209 (80%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD+KK+LVAYHEAGHALVGA MP+YD VAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  410  KKDRVISDKKKELVAYHEAGHALVGACMPDYDAVAKVSIIPRGQAGGLTFFTPSEERMES  469

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  470  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  529

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS+ +D+S  TA  +D EV ELV+ AY RAT+++T +  +L ++
Sbjct  530  PVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRATKVLTDNRSVLDEM  589

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A +LIE+ET+D E+   L    ++E+ VA
Sbjct  590  AMMLIERETIDTEDIQDLL--NRSEVKVA  616



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            R+  V+S++KKKLVAYHEAGHALVGALMP+YD V KISI+PRG AGGLTFFAPSEERLES
Sbjct  431  REGAVMSEKKKKLVAYHEAGHALVGALMPDYDAVTKISIVPRGNAGGLTFFAPSEERLES  490

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YLENQMAVA+GGRVAEE+IFG ++VTTGAS DF QV+R AR M+E+ GFSK+IG
Sbjct  491  GLYSRTYLENQMAVAMGGRVAEELIFGAEDVTTGASGDFQQVTRTARMMIEQMGFSKRIG  550

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
            QIAI   GGN FLG  M    DYS ATA +VD EV+ LV  AY RA  ++  ++D+LH +
Sbjct  551  QIAIKSGGGNSFLGNDMGRAADYSAATAAIVDEEVKILVTAAYRRAKDLVQLNMDVLHAV  610

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFV  111
            A +L+EKE +DG+EF  + +  K+EL++
Sbjct  611  ADVLMEKENIDGDEFERIMLGAKSELYL  638



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD +KKLVAYHEAGHALVGALMP+YDPV K+SIIPRG+AGGLT+F P+E++++S
Sbjct  403  KKDRVMSDRRKKLVAYHEAGHALVGALMPDYDPVQKVSIIPRGRAGGLTWFTPNEDQMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE++FGED VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  463  GLYSRAYLQNQMAVALGGRIAEEIVFGEDEVTTGASNDLQQVARVARQMVTRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA  +D EVR LVE+AY RA +++  +  +L ++
Sbjct  523  PVALGRQTGNVFLGRDIMAERDFSEETAATIDDEVRNLVEQAYRRAKEVLVNNRHVLDQI  582

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+LIEKET+D EE  S+ 
Sbjct  583  AQVLIEKETIDAEELQSIL  601



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEERLES
Sbjct  404  KKDRVMSERRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERLES  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+++G + VTTGASND  QV+RVARQM+ RFG S ++G
Sbjct  464  GLYSRAYLQNQMAVALGGRIAEEIVYGNEEVTTGASNDLQQVARVARQMITRFGMSGELG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA ++DAEVR LV++AY RA Q++  +  IL KL
Sbjct  524  PVALGRQQGNMFLGRDITAERDFSEETAAIIDAEVRSLVDQAYDRAKQVLVENRAILDKL  583

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD EE   L 
Sbjct  584  AGMLVEKETVDSEELQELL  602



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S ++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  406  KKNRVMSQKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G
Sbjct  466  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN F+G+ +++ +D+S +TA  +D EV++LV++AY RA Q++  +  +L KL
Sbjct  526  PVALGRQNGNVFMGRDIASDRDFSDSTASAIDDEVKKLVDQAYQRAKQVLVENRAVLDKL  585

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD +E   + 
Sbjct  586  ANMLVEKETVDADELQDIL  604



>ref|WP_009556886.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68121.1| ATP-dependent metalloprotease FtsH [Oscillatoriales cyanobacterium 
JSC-12]
Length=624

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  415  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  474

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  475  GLYSRSYLQNQMAVALGGRIAEELVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  534

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LV++AY RA  ++T +  +L KL
Sbjct  535  PVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVDQAYRRAKAVLTQNRAVLDKL  594

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD EE   L 
Sbjct  595  AQMLVEKETVDAEELQDLL  613



>ref|WP_028949001.1| cell division protein FtsH [Synechocystis sp. PCC 6714]
 gb|AIE73467.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=616

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  ++S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRMMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G  GG  FLG+ +++ +D+S  TA  +D EV +LV++AY RA +++  +  IL +L
Sbjct  527  PVALGRQGGGVFLGRDIASDRDFSDETAAAIDEEVSQLVDQAYQRAKRVLVENRGILDQL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+EKETVD EE  +L     A+L
Sbjct  587  AEMLVEKETVDSEELQTLLASNNAKL  612



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  404  KKDRVMSERRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S K+G
Sbjct  464  GLYSRSYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDKLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY+RA  ++T +  +L +L
Sbjct  524  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDAAYARAKTVLTDNRHVLDQL  583

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD EE   L 
Sbjct  584  ADMLVEKETVDAEELQELL  602



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++
Sbjct  403  KKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDT  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G
Sbjct  463  GLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  ++T +  IL +L
Sbjct  523  PVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTNNRAILDRL  582

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD +E   L 
Sbjct  583  AQMLVEKETVDADELQELL  601



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 166/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKSRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GL+SRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLFSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+++++ +D+S  TA  +D EVR LV++AY RA +++  +  IL +L
Sbjct  527  PVALGRQNGNVFLGREIASDRDFSDETAAAIDEEVRNLVDQAYRRAKEVLMNNRPILDQL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LIEKETVD EE   +  +   ++
Sbjct  587  ASMLIEKETVDAEELQDILANNDVKM  612



>ref|WP_011936606.1| cell division protein FtsH [Synechococcus sp. RCC307]
 emb|CAK29096.1| Cell division protein FtsH [Synechococcus sp. RCC307]
Length=618

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 166/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHE+GHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  409  KKDRVMSEKRKRLVAYHESGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  468

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GED VTTGASND  QV+RVARQMV RFG S K+G
Sbjct  469  GLYSRSYLQNQMAVALGGRVAEELVYGEDEVTTGASNDLQQVARVARQMVTRFGMSDKLG  528

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV  LV+ AY+RA Q+++ +  +L +L
Sbjct  529  PVALGRSQGGMFLGRDIAAERDFSEDTAATIDKEVSSLVDAAYTRAVQVLSDNRALLDEL  588

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+E ETVD E+   L I   A++
Sbjct  589  AEMLVEMETVDAEQLQELLISRDAKV  614



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++S
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G
Sbjct  463  GLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++L
Sbjct  523  PVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LI+KETVD +E   L  + + ++
Sbjct  583  ANILIDKETVDADELQELLANNEVKM  608



>ref|WP_026097926.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=614

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLT+F PSEER++S
Sbjct  405  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGAAGGLTWFTPSEERMDS  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+++G
Sbjct  465  GLYSRSYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMVTRFGMSERLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +D EV +LV+ AY+RA Q+++ +  +L +L
Sbjct  525  PVALGRQQGNMFLGRDIAAERDFSEETAAAIDEEVSKLVDEAYTRAKQVLSENRSVLDRL  584

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            +++L+EKETVD EE   L  +   ++
Sbjct  585  SEMLVEKETVDAEELQDLLANSDVKM  610



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++
Sbjct  403  KKDRVMSEKRKQLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDT  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQM+ RFG S ++G
Sbjct  463  GLYSRSYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVARQMITRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA V+D EV +LV+ AY RA  ++T +  IL +L
Sbjct  523  PVALGRQQGNMFLGRDIVAERDFSEETAAVIDEEVHQLVDTAYKRAKSVLTDNRAILDRL  582

Query  194  AQLLIEKETVDGEEFMSLF  138
            AQ+L+EKETVD +E   L 
Sbjct  583  AQMLVEKETVDADELQELL  601



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++S
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G
Sbjct  463  GLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++L
Sbjct  523  PVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LI+KETVD +E   L  + + ++
Sbjct  583  ANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_007100703.1| cell division protein FtsH [Synechococcus sp. RS9917]
 gb|EAQ68631.1| cell division protein [Synechococcus sp. RS9917]
Length=616

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRGQAGGLTFF PSEER+ES
Sbjct  407  KKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGQAGGLTFFTPSEERMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  467  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV  AY RATQ++T +  +L +L
Sbjct  527  PVALGRAQGGMFLGRDIAAERDFSEDTAATIDEEVSDLVSVAYKRATQVLTQNRSVLDEL  586

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A++L+++ETVD E+   L +
Sbjct  587  AEMLVDQETVDAEDLQELLM  606



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++S
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G
Sbjct  463  GLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++L
Sbjct  523  PVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LI+KETVD +E   L  + + ++
Sbjct  583  ADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++S
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G
Sbjct  463  GLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++L
Sbjct  523  PVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LI+KETVD +E   L  + + ++
Sbjct  583  ADVLIDKETVDADELQELLANNEVKM  608



>ref|WP_011131865.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE18685.1| cell division protein FtsH2 [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 gb|KGF86466.1| Cell division protein FtsH [Prochlorococcus marinus str. EQPAC1]
Length=618

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+SD KK+LVAYHEAGHALVGA MP+YD VAK+SIIPRGQAGGLTFF PSEER+ES
Sbjct  409  KKDRVISDRKKELVAYHEAGHALVGACMPDYDAVAKVSIIPRGQAGGLTFFTPSEERMES  468

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+++GE+ VTTGASND  QV+ VARQM+ +FG S KIG
Sbjct  469  GLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQMITKFGMSDKIG  528

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ MS  +D+S  TA  +D EV ELV+ AY RAT++++ +  +L ++
Sbjct  529  PVALGQSQGGMFLGRDMSATRDFSEDTAATIDVEVSELVDTAYKRATKVLSDNRSVLDEM  588

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A +LIE+ET+D E+   L    ++E+ VA
Sbjct  589  ASMLIERETIDTEDIQDLL--NRSEVKVA  615



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++
Sbjct  405  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDT  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  465  GLYSRAYLENQMAVALGGRIAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE AY RA +++  +  IL KL
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVETAYRRAKEVLENNRHILDKL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   + 
Sbjct  585  AEMLVEKETVDAEELQDVL  603



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  407  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+ VARQM+ RFG S ++G
Sbjct  467  GLYSRAYLQNQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVANVARQMITRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN F+G+ +++ +D+S  TA V+D EVR LVE AY RA  ++  +  +L KL
Sbjct  527  PVALGRQNGNVFMGRDIASDRDFSDETAAVIDEEVRGLVEEAYKRAKDVLVGNRSVLDKL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +L+EKETVD EE  +L ++   ++
Sbjct  587  AAMLVEKETVDAEELQTLLMESDVQM  612



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  407  KKNRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+I+GE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  467  GLYSRSYLQNQMAVALGGRLAEEIIYGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN F+G+ +++ +D+S  TA  +D EVR  V++AYSRA +++  + +IL +L
Sbjct  527  PVALGRQNGNVFMGRDIASDRDFSNETAAAIDEEVRNYVDQAYSRAKKVLLDNRNILDRL  586

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++LIEKETV+ +E   +  +   ++
Sbjct  587  AEMLIEKETVEADELQDILANNDVKM  612



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 166/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER+ES
Sbjct  404  KKDRVMSEKRKVLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMES  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  464  GLYSRTYLQNQMAVALGGRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +D EVR+LV+ AY RA +++  +  IL +L
Sbjct  524  PVALGRQQGNMFLGRDIAAERDFSEETAATIDDEVRQLVDVAYDRAKKVLIENRSILDQL  583

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+EKETVD EE   L  + +  +
Sbjct  584  AKMLVEKETVDAEELQDLLNNNEVRM  609



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ES
Sbjct  406  KKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  466  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDEL  585

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKETVD ++   L I
Sbjct  586  ADLLVEKETVDAQDLQELLI  605



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ES
Sbjct  406  KKDRVMSERRKQLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  466  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDEL  585

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKETVD ++   L I
Sbjct  586  ADLLVEKETVDAQDLQDLLI  605



>emb|CCH67048.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=465

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F P+E+R++S
Sbjct  256  KKDRVMSERRKLLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPNEDRMDS  315

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYLENQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  316  GLYSRSYLENQMAVALGGRLAEEIIFGDEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  375

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LV+ AY RA Q++  +  IL++L
Sbjct  376  PVALGRQQGNMFLGRDIMSERDFSEETAATIDEEVRQLVDAAYIRAKQVLEENRHILNQL  435

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD EE   + 
Sbjct  436  ADILVEKETVDAEELQDIL  454



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSEER++S
Sbjct  409  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMDS  468

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  469  GLYSRAYLQNQMAVALGGRVAEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  528

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN F+G+ +++ +D+S  TA  +D EVR+LV++AY R  +++  +  IL KL
Sbjct  529  PVALGRQNGNMFMGRDIASDRDFSDETASAIDEEVRKLVDQAYERTVEVLKGNRQILDKL  588

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A++L+E ETVD EE  +L  +   ++
Sbjct  589  AEMLVEAETVDSEELQNLLAESDVKM  614



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  404  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQMV RFG S+++G
Sbjct  464  GLYSRSYLQNQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVARVARQMVMRFGMSERLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA V+D EV  LVE+AY RA +++ ++  +L  L
Sbjct  524  PVALGRQQGNMFLGRDIMAERDFSEETASVIDEEVSTLVEQAYRRAKEVLVSNRHVLDTL  583

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +L+EKETVD EE   L  +   ++
Sbjct  584  ADMLVEKETVDSEELQDLLANSDVKM  609



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 169/209 (81%), Gaps = 2/209 (1%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K+LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  404  KKDRVMSEKRKELVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE++FGE+ VTTGASND  QV+RVA+QMV RFG S ++G
Sbjct  464  GLYSRSYLQNQMAVALGGRIAEEIVFGEEEVTTGASNDLQQVARVAKQMVTRFGMSDRLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +D EVR LVE+AY RA  ++  +  +L KL
Sbjct  524  PVALGRQQGNMFLGRDIAAERDFSEETAAAIDDEVRNLVEQAYRRAKAVLVQNRPVLDKL  583

Query  194  AQLLIEKETVDGEEFMSLFIDGKAELFVA  108
            A++L++KETVD EE   L   G +++ +A
Sbjct  584  AEMLVDKETVDAEELQELL--GNSDVQIA  610



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDT  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  463  GLYSRSYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVTRVARQMVTRFGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+++++ +D+S  TA  +D EVR LV+ AY RA  ++  +  IL KL
Sbjct  523  PVALGRQNGNMFLGREIASDRDFSDTTAATIDEEVRRLVDEAYERAKNVLLGNKHILDKL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LIEKETVD +E   L  +   ++
Sbjct  583  AGMLIEKETVDSDELQELLANNDVKI  608



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVG+LMP+YDPV KISIIPRG+AGGLT+F PSEER++S
Sbjct  403  KKDRVMSEKRKTLVAYHEAGHALVGSLMPDYDPVQKISIIPRGRAGGLTWFMPSEERMDS  462

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GL+SRSYLENQMAVALGGRVAEE+IFGE+ VTTGASND  QV+RVARQM+ R+G S ++G
Sbjct  463  GLFSRSYLENQMAVALGGRVAEEIIFGEEEVTTGASNDLQQVTRVARQMITRYGMSDRLG  522

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +DAEVR LV+ AY RA Q++  +  +L++L
Sbjct  523  PVALGRQQGNVFLGRDIMSERDFSEETASTIDAEVRILVDAAYKRAKQVLVENRHVLNQL  582

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LI+KETVD +E   L  + + ++
Sbjct  583  ANVLIDKETVDADELQELLANNEVKM  608



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+ES
Sbjct  406  KKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQM+ RFG S ++G
Sbjct  466  GLYSRSYLQNQMAVALGGRIAEEIIFGQEEVTTGASNDLQQVARVARQMITRFGMSDRLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN F+G+ +++ +D+S  TA  +D EV +LVERAY RA  ++  +  IL KL
Sbjct  526  PVALGRQNGNVFMGRDIASDRDFSDTTAATIDEEVSQLVERAYQRAKDVLVQNRPILDKL  585

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETV+ +E   + 
Sbjct  586  AEMLVEKETVEADELQEIL  604



>ref|WP_015204207.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 gb|AFZ14101.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=613

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLT+F PSE+RL+S
Sbjct  404  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTWFTPSEDRLDS  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSRSYL+NQMAVALGGR+AEE+IFG++ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  464  GLYSRSYLQNQMAVALGGRIAEEIIFGDEEVTTGASNDLQQVARVARQMVMRFGMSDRLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ ++ ++D+S  TA  +D EV  LVE+AY RA +++  +  +L KL
Sbjct  524  PVALGRQQGNMFLGRDINAERDFSDETAATIDDEVHNLVEQAYKRAKEVLVNNKHVLDKL  583

Query  194  AQLLIEKETVDGEEFMSLFIDGKAEL  117
            A +LIEKETVD EE   L  +   ++
Sbjct  584  AVMLIEKETVDSEELQELLANNDVKM  609



>ref|WP_011932280.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 emb|CAK22781.1| Cell division protein FtsH [Synechococcus sp. WH 7803]
Length=617

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ES
Sbjct  408  KKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMES  467

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  468  GLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  527

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV ELV+ AY RAT+++  +  +L +L
Sbjct  528  PVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSELVDVAYKRATKVLVGNRSVLDEL  587

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A++L+E+ETVD E+   L I
Sbjct  588  AEMLVEQETVDAEQLQELLI  607



>ref|WP_035155002.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB84628.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=613

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R++S
Sbjct  404  KKDRVISEKRKLLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDS  463

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YLENQMAVALGGR+AEE+IFGE+ VTTGASND  QV+RVA+QMV RFG S ++G
Sbjct  464  GLYSRAYLENQMAVALGGRIAEEIIFGEEEVTTGASNDLQQVARVAKQMVTRFGMSDRLG  523

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ +  ++D+S  TA  +D EVR LV+ AY+RA  ++T +  IL KL
Sbjct  524  PVALGRQQGNMFLGRDIMAERDFSEETAAAIDEEVRHLVDAAYNRAKHVLTENRHILDKL  583

Query  194  AQLLIEKETVDGEEFMSLF  138
            A +L+EKETVD EE   L 
Sbjct  584  AGMLVEKETVDAEELQDLL  602



>ref|WP_006042287.1| cell division protein FtsH [Synechococcus sp. WH 7805]
 gb|EAR19163.1| cell division protein FtsH2 [Synechococcus sp. WH 7805]
Length=616

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHEAGHALVGALMP+YDPV KISIIPRG AGGLTFF PSEER+ES
Sbjct  407  KKDRVMSERRKRLVAYHEAGHALVGALMPDYDPVQKISIIPRGNAGGLTFFTPSEERMES  466

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  467  GLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  526

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ ++ ++D+S  TA  +D EV +LV+ AY RAT+++ ++  +L ++
Sbjct  527  PVALGRSQGGMFLGRDIAAERDFSEDTAATIDEEVSDLVDVAYKRATKVLVSNRSVLDEI  586

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A++L+E+ETVD EE   L I
Sbjct  587  AEMLVEQETVDAEELQELLI  606



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+ +K+LVAYHE+GHALVGALMP+YD V KISIIPRGQAGGLTFF PSEER+ES
Sbjct  406  KKDRVMSERRKRLVAYHESGHALVGALMPDYDSVQKISIIPRGQAGGLTFFTPSEERMES  465

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YL+NQMAVALGGRVAEE+++GED VTTGASND  QV++VARQMV RFG S K+G
Sbjct  466  GLYSRAYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVAQVARQMVTRFGMSDKLG  525

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   G  FLG+ +++++D+S  TA ++DAEV +LV+ AY RAT+++  +  +L +L
Sbjct  526  PVALGRSQGGMFLGRDIASERDFSEDTAAIIDAEVSDLVDVAYKRATKVLIENRSVLDEL  585

Query  194  AQLLIEKETVDGEEFMSLFI  135
            A LL+EKET+D ++   L I
Sbjct  586  ADLLVEKETLDAQDLQELLI  605



>ref|WP_017743955.1| cell division protein FtsH [Scytonema hofmanni]
Length=614

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  734  RKMPVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLES  555
            +K  V+S+++K LVAYHEAGHALVGALMP+YDPV KISIIPRG+AGGLT+F PSE+R+++
Sbjct  405  KKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEDRMDT  464

Query  554  GLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTGASNDFMQVSRVARQMVERFGFSKKIG  375
            GLYSR+YLENQMAVALGGR++EE+IFGE+ VTTGASND  QV+RVARQMV RFG S ++G
Sbjct  465  GLYSRAYLENQMAVALGGRISEELIFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLG  524

Query  374  QIAIGGPGGNPFLGQQMSTQKDYSMATADVVDAEVRELVERAYSRATQIITTHIDILHKL  195
             +A+G   GN FLG+ + +++D+S  TA  +D EVR+LVE AY R+ +++  +  IL KL
Sbjct  525  PVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRQLVEAAYRRSKEVLENNRHILDKL  584

Query  194  AQLLIEKETVDGEEFMSLF  138
            A++L+EKETVD EE   L 
Sbjct  585  AEMLVEKETVDAEELQELL  603



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630