BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049I12

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO58315.1|  hypothetical protein CISIN_1g0085681mg                  234   3e-73   Citrus sinensis [apfelsine]
emb|CDP06883.1|  unnamed protein product                                238   3e-70   Coffea canephora [robusta coffee]
ref|XP_010425851.1|  PREDICTED: nicalin-1-like                          237   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010503086.1|  PREDICTED: nicalin-1-like                          237   3e-70   Camelina sativa [gold-of-pleasure]
dbj|BAG15862.1|  hypothetical protein                                   237   4e-70   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009776609.1|  PREDICTED: nicalin-1-like                          231   5e-70   Nicotiana sylvestris
ref|XP_009793459.1|  PREDICTED: nicalin-1-like isoform X2               234   6e-70   Nicotiana sylvestris
ref|XP_007015760.1|  Endoplasmic reticulum, plasma membrane, vacu...    236   6e-70   
gb|KJB55582.1|  hypothetical protein B456_009G084100                    236   6e-70   Gossypium raimondii
gb|KJB55581.1|  hypothetical protein B456_009G084100                    236   7e-70   Gossypium raimondii
ref|XP_010514774.1|  PREDICTED: nicalin-1-like                          236   1e-69   Camelina sativa [gold-of-pleasure]
gb|EYU26731.1|  hypothetical protein MIMGU_mgv1a014013mg                224   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_011088931.1|  PREDICTED: nicalin-1-like                          234   3e-69   Sesamum indicum [beniseed]
ref|XP_009589240.1|  PREDICTED: nicalin-1-like                          232   3e-69   
ref|XP_006404470.1|  hypothetical protein EUTSA_v10010249mg             234   3e-69   Eutrema salsugineum [saltwater cress]
ref|XP_009793458.1|  PREDICTED: nicalin-1-like isoform X1               234   3e-69   Nicotiana sylvestris
ref|XP_008344934.1|  PREDICTED: nicalin-1-like                          233   4e-69   
ref|XP_006292677.1|  hypothetical protein CARUB_v10018921mg             234   4e-69   Capsella rubella
ref|XP_007205001.1|  hypothetical protein PRUPE_ppa003566mg             234   4e-69   Prunus persica
ref|NP_190019.1|  uncharacterized protein                               234   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875659.1|  hypothetical protein ARALYDRAFT_905545             234   5e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_008355243.1|  PREDICTED: nicalin-1-like                          233   9e-69   
ref|XP_008229012.1|  PREDICTED: nicalin-1                               233   1e-68   Prunus mume [ume]
ref|XP_009377813.1|  PREDICTED: nicalin-1-like                          233   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_009595187.1|  PREDICTED: nicalin-1                               233   1e-68   Nicotiana tomentosiformis
gb|KFK33877.1|  hypothetical protein AALP_AA5G071800                    233   2e-68   Arabis alpina [alpine rockcress]
ref|XP_009758150.1|  PREDICTED: nicalin-1-like                          233   2e-68   Nicotiana sylvestris
ref|XP_006481501.1|  PREDICTED: nicalin-1-like                          232   2e-68   Citrus sinensis [apfelsine]
ref|XP_010245975.1|  PREDICTED: nicalin-1 isoform X2                    231   3e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010541265.1|  PREDICTED: nicalin-1                               232   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_010245968.1|  PREDICTED: nicalin-1 isoform X1                    231   4e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006424179.1|  hypothetical protein CICLE_v10028115mg             231   6e-68   Citrus clementina [clementine]
ref|XP_002273260.1|  PREDICTED: nicalin-1                               231   6e-68   Vitis vinifera
gb|KJB35404.1|  hypothetical protein B456_006G113500                    229   4e-67   Gossypium raimondii
ref|XP_006836081.1|  hypothetical protein AMTR_s00114p00123360          229   4e-67   Amborella trichopoda
ref|XP_002523845.1|  Nicalin precursor, putative                        229   4e-67   Ricinus communis
ref|XP_009374972.1|  PREDICTED: nicalin-1-like                          228   6e-67   Pyrus x bretschneideri [bai li]
ref|XP_010031534.1|  PREDICTED: nicalin-1                               228   1e-66   Eucalyptus grandis [rose gum]
ref|XP_011090328.1|  PREDICTED: nicalin-1 isoform X2                    222   4e-66   
ref|XP_009123309.1|  PREDICTED: nicalin-1-like                          226   5e-66   Brassica rapa
ref|XP_004506200.1|  PREDICTED: nicalin-1-like                          226   6e-66   Cicer arietinum [garbanzo]
ref|XP_004228460.1|  PREDICTED: nicalin-1-like                          225   9e-66   
emb|CDY62392.1|  BnaC03g74930D                                          225   1e-65   Brassica napus [oilseed rape]
gb|KEH29830.1|  M28 Zn-peptidase nicastrin                              224   3e-65   Medicago truncatula
gb|KDP24745.1|  hypothetical protein JCGZ_25494                         224   4e-65   Jatropha curcas
emb|CDY47303.1|  BnaA06g38990D                                          224   4e-65   Brassica napus [oilseed rape]
emb|CDY21224.1|  BnaC03g54000D                                          223   5e-65   Brassica napus [oilseed rape]
ref|XP_011006540.1|  PREDICTED: nicalin-1-like isoform X1               223   7e-65   Populus euphratica
gb|EYU36051.1|  hypothetical protein MIMGU_mgv1a003633mg                223   7e-65   Erythranthe guttata [common monkey flower]
ref|XP_011090327.1|  PREDICTED: nicalin-1 isoform X1                    222   2e-64   Sesamum indicum [beniseed]
ref|XP_006362634.1|  PREDICTED: nicalin-1-like isoform X2               222   2e-64   Solanum tuberosum [potatoes]
ref|XP_007132463.1|  hypothetical protein PHAVU_011G096100g             221   2e-64   Phaseolus vulgaris [French bean]
emb|CDY30940.1|  BnaA06g19730D                                          221   2e-64   Brassica napus [oilseed rape]
ref|XP_004139498.1|  PREDICTED: nicalin-like                            221   3e-64   Cucumis sativus [cucumbers]
ref|XP_006384766.1|  hypothetical protein POPTR_0004s20910g             221   3e-64   
gb|KHN21166.1|  Nicalin                                                 221   6e-64   Glycine soja [wild soybean]
ref|XP_008463652.1|  PREDICTED: nicalin-1                               220   7e-64   Cucumis melo [Oriental melon]
ref|XP_009416037.1|  PREDICTED: nicalin                                 220   8e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009150276.1|  PREDICTED: nicalin-1-like                          220   9e-64   Brassica rapa
gb|KHN38614.1|  Nicalin-1                                               219   1e-63   Glycine soja [wild soybean]
gb|ACF83602.1|  unknown                                                 211   1e-63   Zea mays [maize]
ref|XP_003538104.1|  PREDICTED: nicalin-1-like                          219   1e-63   Glycine max [soybeans]
ref|XP_004291695.1|  PREDICTED: nicalin-1                               219   1e-63   Fragaria vesca subsp. vesca
ref|XP_004251075.1|  PREDICTED: nicalin-1-like                          219   1e-63   Solanum lycopersicum
ref|XP_006362903.1|  PREDICTED: nicalin-1-like                          220   2e-63   Solanum tuberosum [potatoes]
gb|KGN64956.1|  hypothetical protein Csa_1G167840                       221   2e-63   Cucumis sativus [cucumbers]
ref|XP_002312837.2|  hypothetical protein POPTR_0009s16200g             219   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_011043354.1|  PREDICTED: nicalin-1-like                          219   3e-63   Populus euphratica
ref|XP_010912330.1|  PREDICTED: nicalin-1-like isoform X3               214   3e-62   
ref|XP_010912332.1|  PREDICTED: nicalin-like isoform X4                 214   4e-62   Elaeis guineensis
ref|XP_010912329.1|  PREDICTED: nicalin-1-like isoform X2               214   6e-62   
ref|XP_004972399.1|  PREDICTED: nicalin-like isoform X1                 214   9e-62   Setaria italica
gb|EEC82760.1|  hypothetical protein OsI_27484                          212   1e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001060766.1|  Os08g0102100                                       214   1e-61   
ref|XP_010912328.1|  PREDICTED: nicalin-like isoform X1                 214   2e-61   Elaeis guineensis
ref|XP_006659731.1|  PREDICTED: nicalin-like                            213   3e-61   Oryza brachyantha
dbj|BAJ94473.1|  predicted protein                                      213   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008784054.1|  PREDICTED: nicalin-like                            213   4e-61   Phoenix dactylifera
ref|XP_010685410.1|  PREDICTED: nicalin-1                               212   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002444854.1|  hypothetical protein SORBIDRAFT_07g000320          211   1e-60   Sorghum bicolor [broomcorn]
gb|KEH29829.1|  M28 Zn-peptidase nicastrin                              212   1e-60   Medicago truncatula
ref|NP_001147070.1|  Nicalin precursor                                  210   3e-60   Zea mays [maize]
ref|XP_010931103.1|  PREDICTED: nicalin-like isoform X1                 211   3e-60   Elaeis guineensis
gb|ACL54544.1|  unknown                                                 210   3e-60   Zea mays [maize]
ref|XP_010234235.1|  PREDICTED: nicalin                                 209   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_008799665.1|  PREDICTED: nicalin-like isoform X1                 207   8e-59   Phoenix dactylifera
gb|ACN25311.1|  unknown                                                 206   2e-58   Zea mays [maize]
ref|NP_001150971.1|  LOC100284604 precursor                             206   2e-58   
ref|XP_006362633.1|  PREDICTED: nicalin-1-like isoform X1               191   1e-52   Solanum tuberosum [potatoes]
gb|KCW50875.1|  hypothetical protein EUGRSUZ_J00522                     188   9e-52   Eucalyptus grandis [rose gum]
ref|XP_010102017.1|  hypothetical protein L484_016307                   183   3e-49   
ref|XP_001784134.1|  predicted protein                                  176   2e-47   
ref|XP_010931104.1|  PREDICTED: nicalin-like isoform X2                 175   4e-47   
ref|XP_008799667.1|  PREDICTED: nicalin-like isoform X2                 157   7e-41   
ref|XP_002977600.1|  hypothetical protein SELMODRAFT_106865             156   3e-40   
ref|XP_002975196.1|  hypothetical protein SELMODRAFT_102752             155   7e-40   
gb|AFW65051.1|  hypothetical protein ZEAMMB73_261569                    153   3e-39   
gb|AFW65052.1|  hypothetical protein ZEAMMB73_261569                    152   8e-39   
ref|XP_006592341.1|  PREDICTED: nicalin-1-like                          124   7e-32   
gb|EMT04918.1|  hypothetical protein F775_32982                         116   1e-26   
gb|EPS72783.1|  hypothetical protein M569_01975                         108   3e-26   Genlisea aurea
gb|EMS68245.1|  Nicalin-1                                               114   3e-25   Triticum urartu
gb|EYU20529.1|  hypothetical protein MIMGU_mgv1a005130mg                109   6e-24   Erythranthe guttata [common monkey flower]
gb|EPS62126.1|  hypothetical protein M569_12666                       97.4    1e-19   Genlisea aurea
gb|KDO44364.1|  hypothetical protein CISIN_1g0376012mg                68.6    2e-11   Citrus sinensis [apfelsine]
ref|XP_007015761.1|  Endoplasmic reticulum, plasma membrane, vacu...  70.9    1e-10   
ref|XP_001626707.1|  predicted protein                                66.2    4e-09   Nematostella vectensis
ref|XP_792553.3|  PREDICTED: nicalin-1-like                           63.9    3e-08   
ref|XP_006822841.1|  PREDICTED: nicalin-like                          63.2    5e-08   Saccoglossus kowalevskii
ref|XP_001604957.1|  PREDICTED: nicalin-1                             63.2    5e-08   Nasonia vitripennis
ref|XP_793964.2|  PREDICTED: nicalin-1-like                           59.7    2e-07   
gb|KFM78747.1|  Nicalin-1                                             58.5    2e-06   Stegodyphus mimosarum
gb|KDR11903.1|  Nicalin                                               56.2    1e-05   Zootermopsis nevadensis
ref|XP_004353530.1|  nicalin, putative                                55.5    1e-05   Acanthamoeba castellanii str. Neff
gb|ELU15334.1|  hypothetical protein CAPTEDRAFT_157684                55.8    1e-05   Capitella teleta
ref|XP_002606253.1|  hypothetical protein BRAFLDRAFT_84005            55.1    3e-05   Branchiostoma floridae
ref|XP_011498906.1|  PREDICTED: nicalin-1                             54.7    3e-05   Ceratosolen solmsi marchali
ref|XP_971811.1|  PREDICTED: nicalin-1                                53.5    9e-05   Tribolium castaneum [rust-red flour beetle]
ref|XP_006607466.1|  PREDICTED: nicalin-1-like                        53.5    9e-05   Apis dorsata [rock honeybee]
ref|XP_005090447.1|  PREDICTED: nicalin-1-like isoform X1             53.1    1e-04   Aplysia californica
ref|XP_394739.3|  PREDICTED: nicalin-1 isoform X1                     52.0    3e-04   
ref|XP_011064630.1|  PREDICTED: nicalin                               50.4    7e-04   Acromyrmex echinatior
ref|XP_009010054.1|  hypothetical protein HELRODRAFT_71336            50.4    8e-04   Helobdella robusta



>gb|KDO58315.1| hypothetical protein CISIN_1g0085681mg, partial [Citrus sinensis]
Length=198

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YG++GKNI IFAD SSLA+NP YIRSW+DLLS TPRVAPF+SKND
Sbjct  47   IRSVKLVAESLARHIYGYQGKNIQIFADNSSLAVNPSYIRSWLDLLSQTPRVAPFISKND  106

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P IMALKKELADHT +V +QHEVLDGMFTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  107  PFIMALKKELADHTDEVIMQHEVLDGMFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  166

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  167  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  198



>emb|CDP06883.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKLVA+SLA+H Y  +GKNIN+FAD SSLA+NP YIRSW++LLSTTPRVAPFL+KND
Sbjct  433  VRSVKLVAESLARHIYNQDGKNINVFADDSSLAVNPSYIRSWLNLLSTTPRVAPFLTKND  492

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL +HT +V+VQHEVLDG+FTFYDSTSS+LHIYQVASVTFDLLLLL LGSYL
Sbjct  493  PLIMALKKELTEHTVEVNVQHEVLDGLFTFYDSTSSQLHIYQVASVTFDLLLLLVLGSYL  552

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLV+TTRGLDDLISIFRRPPSRKVKTA
Sbjct  553  IILFSFLVVTTRGLDDLISIFRRPPSRKVKTA  584



>ref|XP_010425851.1| PREDICTED: nicalin-1-like [Camelina sativa]
Length=570

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLAKH YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKND
Sbjct  419  IKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKND  478

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  479  PLIMALKKELEDYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  538

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  539  IVLFSFLVITTRGLDDLISLFRRPPSRKVKMA  570



>ref|XP_010503086.1| PREDICTED: nicalin-1-like [Camelina sativa]
Length=565

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLAKH YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKND
Sbjct  414  IKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEDYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVKMA  565



>dbj|BAG15862.1| hypothetical protein [Bruguiera gymnorhiza]
Length=567

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+G+KLVA+S+A+H YGHEGK+I IFAD SSLA+NP YI SW+DLLS TPRVAPFLSKND
Sbjct  416  IKGIKLVAESIARHIYGHEGKDIEIFADDSSLAVNPSYIHSWLDLLSRTPRVAPFLSKND  475

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKELADHT + +VQHEVLDGMFTFYDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  476  PLIMALKKELADHTHEANVQHEVLDGMFTFYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  535

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  536  IILFSFLVITTRGLDDLISLFRRPPSRKVKTA  567



>ref|XP_009776609.1| PREDICTED: nicalin-1-like, partial [Nicotiana sylvestris]
Length=359

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YG EGKN NIF+D SSLA+NP Y+RSW DLLS T RVAPFL KND
Sbjct  208  IRSVKLVAESLARHIYGQEGKNTNIFSDNSSLAVNPSYVRSWPDLLSRTARVAPFLPKND  267

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMAL+KELADHTA+V++QHE LDG+FTFYDS S +LHIYQVASVTFDLLLLL LGSYL
Sbjct  268  PLIMALQKELADHTAEVNIQHETLDGVFTFYDSISGRLHIYQVASVTFDLLLLLVLGSYL  327

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            ITLF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  328  ITLFSFLVITTRGLDDLISLFRRPPSRKVKTA  359



>ref|XP_009793459.1| PREDICTED: nicalin-1-like isoform X2 [Nicotiana sylvestris]
Length=472

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H Y  E KNI+IFAD SSLA+NP YIRSW+DLLSTTPRVAPFLSKND
Sbjct  321  IRSVKLVAESLARHIYNQEQKNISIFADDSSLAVNPSYIRSWLDLLSTTPRVAPFLSKND  380

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI AL+KELADHTA+V+VQHE LDGMFTFYDSTS KLHIYQVASVTFDLLLLL LGSYL
Sbjct  381  PLIKALEKELADHTAEVNVQHETLDGMFTFYDSTSGKLHIYQVASVTFDLLLLLVLGSYL  440

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            ITLF FL ITTRGLDDLIS+FRRPPSRKVK A
Sbjct  441  ITLFSFLFITTRGLDDLISLFRRPPSRKVKAA  472



>ref|XP_007015760.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 1 [Theobroma cacao]
 gb|EOY33379.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 1 [Theobroma cacao]
Length=562

 Score =   236 bits (603),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+GKN+ IFAD SSLA+NP Y+RSW+DLLS TPRVAPFLSKND
Sbjct  411  IRGVKLVAESLARHIYGHQGKNVQIFADDSSLAVNPAYVRSWLDLLSQTPRVAPFLSKND  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT +V+VQHE L+GMFTFYDSTS++L+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PFVMALKKELVDHTDEVNVQHENLEGMFTFYDSTSARLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  531  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  562



>gb|KJB55582.1| hypothetical protein B456_009G084100 [Gossypium raimondii]
Length=562

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            +GVKLVA+SLA+H YGH+GKN+ IFADG SLA+NP YI+SW+DLLS TPRVAPFLSKNDP
Sbjct  412  RGVKLVAESLARHIYGHQGKNVQIFADGGSLAVNPAYIQSWLDLLSQTPRVAPFLSKNDP  471

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             +MALKKELADHT +V++QHEVL+G+FTFYDSTS++L+IYQVASVTFDLLLLL LGSYLI
Sbjct  472  FVMALKKELADHTDEVNMQHEVLEGVFTFYDSTSARLNIYQVASVTFDLLLLLVLGSYLI  531

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  532  VLFSFLVITTRGLDDLISLFRRPPSRKVKTA  562



>gb|KJB55581.1| hypothetical protein B456_009G084100 [Gossypium raimondii]
 gb|KJB55583.1| hypothetical protein B456_009G084100 [Gossypium raimondii]
Length=562

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            +GVKLVA+SLA+H YGH+GKN+ IFADG SLA+NP YI+SW+DLLS TPRVAPFLSKNDP
Sbjct  412  RGVKLVAESLARHIYGHQGKNVQIFADGGSLAVNPAYIQSWLDLLSQTPRVAPFLSKNDP  471

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             +MALKKELADHT +V++QHEVL+G+FTFYDSTS++L+IYQVASVTFDLLLLL LGSYLI
Sbjct  472  FVMALKKELADHTDEVNMQHEVLEGVFTFYDSTSARLNIYQVASVTFDLLLLLVLGSYLI  531

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  532  VLFSFLVITTRGLDDLISLFRRPPSRKVKTA  562



>ref|XP_010514774.1| PREDICTED: nicalin-1-like [Camelina sativa]
Length=565

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLAKH YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKND
Sbjct  414  IKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL ++TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEEYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVKMA  565



>gb|EYU26731.1| hypothetical protein MIMGU_mgv1a014013mg [Erythranthe guttata]
Length=203

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+H YG EGK+I+IFAD SSL+INP YIRSW+  L  TPRVAPFLSKNDP
Sbjct  52   RSVKLVAESLARHIYGQEGKSIDIFADDSSLSINPSYIRSWLQFLLATPRVAPFLSKNDP  111

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            LI ALKKELADHT DVSVQHEVLDGMFTFYDSTSS+LHIYQVASVTFDLLLLL LGSYLI
Sbjct  112  LITALKKELADHTVDVSVQHEVLDGMFTFYDSTSSRLHIYQVASVTFDLLLLLVLGSYLI  171

Query  412  tLFCFLVITTRGLDDLISIFRRPPS-RKVKT  323
            TLF FLVITTRGLDDLIS+FRRP S RK KT
Sbjct  172  TLFSFLVITTRGLDDLISLFRRPTSPRKSKT  202



>ref|XP_011088931.1| PREDICTED: nicalin-1-like [Sesamum indicum]
Length=569

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+H YG EGK+I+IFAD SSL++NP YIRSW+  LSTTPRVAPFLSKNDP
Sbjct  419  RSVKLVAESLARHIYGQEGKSIDIFADNSSLSLNPSYIRSWLQFLSTTPRVAPFLSKNDP  478

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            LIMALKKELADHT +VS+Q EVLDGMFTFYDS SS+LHIYQVASVTFDLLLLL LGSYLI
Sbjct  479  LIMALKKELADHTVEVSLQQEVLDGMFTFYDSISSRLHIYQVASVTFDLLLLLVLGSYLI  538

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            TLFCFL+ITTRGLDDLIS+FRRP SRKVKTA
Sbjct  539  TLFCFLIITTRGLDDLISLFRRPTSRKVKTA  569



>ref|XP_009589240.1| PREDICTED: nicalin-1-like, partial [Nicotiana tomentosiformis]
Length=479

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLAKH Y  E K+I+IFAD SSLA+NP YIRSW+DLLSTTPRVAPFLSKND
Sbjct  328  IRSVKLVAESLAKHIYNQEQKSISIFADDSSLAVNPSYIRSWLDLLSTTPRVAPFLSKND  387

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI AL+KELADHTA+V++QHE LDGMFTFYDSTS KLHIYQVASVTFDLLLLL LGSYL
Sbjct  388  PLIKALEKELADHTAEVNIQHETLDGMFTFYDSTSGKLHIYQVASVTFDLLLLLVLGSYL  447

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            ITLF FL ITTRGLDDLIS+FRRPPSRKVK A
Sbjct  448  ITLFSFLFITTRGLDDLISLFRRPPSRKVKAA  479



>ref|XP_006404470.1| hypothetical protein EUTSA_v10010249mg [Eutrema salsugineum]
 gb|ESQ45923.1| hypothetical protein EUTSA_v10010249mg [Eutrema salsugineum]
Length=565

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+G+KLVA+SLA+H YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKN+
Sbjct  414  IKGIKLVAESLARHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKNE  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEDYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVKMA  565



>ref|XP_009793458.1| PREDICTED: nicalin-1-like isoform X1 [Nicotiana sylvestris]
Length=565

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H Y  E KNI+IFAD SSLA+NP YIRSW+DLLSTTPRVAPFLSKND
Sbjct  414  IRSVKLVAESLARHIYNQEQKNISIFADDSSLAVNPSYIRSWLDLLSTTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI AL+KELADHTA+V+VQHE LDGMFTFYDSTS KLHIYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIKALEKELADHTAEVNVQHETLDGMFTFYDSTSGKLHIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            ITLF FL ITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  ITLFSFLFITTRGLDDLISLFRRPPSRKVKAA  565



>ref|XP_008344934.1| PREDICTED: nicalin-1-like, partial [Malus domestica]
Length=522

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGHEGKN+ IFAD SSLA+NP YI+SW+DLLS TPRVAPFLSKND
Sbjct  371  IRSVKLVAESLARHIYGHEGKNVQIFADNSSLAVNPSYIKSWLDLLSQTPRVAPFLSKND  430

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL D+T +V+VQHEVLDGMFTFYDST +KL++YQVASVTFDLLLLL LGSYL
Sbjct  431  PFILALKKELEDNTDEVNVQHEVLDGMFTFYDSTRAKLNVYQVASVTFDLLLLLVLGSYL  490

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  491  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  522



>ref|XP_006292677.1| hypothetical protein CARUB_v10018921mg [Capsella rubella]
 gb|EOA25575.1| hypothetical protein CARUB_v10018921mg [Capsella rubella]
Length=565

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLAKH YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFL KND
Sbjct  414  IKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLLKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEDYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVKMA  565



>ref|XP_007205001.1| hypothetical protein PRUPE_ppa003566mg [Prunus persica]
 gb|EMJ06200.1| hypothetical protein PRUPE_ppa003566mg [Prunus persica]
Length=565

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGHEGKN+ IFAD SSLA+NP YI+SW+DLLS TPRVAPFLSKND
Sbjct  414  IKSVKLVAESLARHIYGHEGKNVQIFADNSSLAVNPSYIKSWLDLLSQTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL DHT +V+VQHEVLDGMFTFYDST + L++YQVASVTFDLLLLL LGSYL
Sbjct  474  PFILALKKELEDHTDEVNVQHEVLDGMFTFYDSTRASLNVYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  565



>ref|NP_190019.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86911.1| putative protein [Arabidopsis thaliana]
 dbj|BAE98429.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77892.1| uncharacterized protein AT3G44330 [Arabidopsis thaliana]
Length=565

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLAKH YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKN+
Sbjct  414  IKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKNE  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEDYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            I LF FLVITTRGLDDLIS+FRRPPSRKVK
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVK  563



>ref|XP_002875659.1| hypothetical protein ARALYDRAFT_905545 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51918.1| hypothetical protein ARALYDRAFT_905545 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLAKH YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKN+
Sbjct  414  IKGVKLVAESLAKHIYGHQGKDIKIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKNE  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEDYTAEVSVQHESLDGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            I LF FLVITTRGLDDLIS+FRRPPSRKVK
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPSRKVK  563



>ref|XP_008355243.1| PREDICTED: nicalin-1-like [Malus domestica]
Length=570

 Score =   233 bits (595),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGHEGKN+ IFAD SSLA+NP YI+SW+DLLS TPRVAPFLSKND
Sbjct  419  IRSVKLVAESLARHIYGHEGKNVQIFADNSSLAVNPSYIKSWLDLLSQTPRVAPFLSKND  478

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL D+T +V+VQHEVLDGMFTFYDST +KL++YQVASVTFDLLLLL LGSYL
Sbjct  479  PFILALKKELEDNTDEVNVQHEVLDGMFTFYDSTRAKLNVYQVASVTFDLLLLLVLGSYL  538

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  539  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  570



>ref|XP_008229012.1| PREDICTED: nicalin-1 [Prunus mume]
Length=565

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGHEGKN+ IFAD SSLA+NP YI+SW+DLLS TPRVAPFLSKND
Sbjct  414  IKSVKLVAESLARHIYGHEGKNVQIFADNSSLAVNPSYIKSWLDLLSQTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL DHT +V+VQHEVLDGMFTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PCILALKKELEDHTDEVNVQHEVLDGMFTFYDSTRASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPP RKVKTA
Sbjct  534  IVLFSFLVITTRGLDDLISLFRRPPQRKVKTA  565



>ref|XP_009377813.1| PREDICTED: nicalin-1-like [Pyrus x bretschneideri]
Length=570

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGHEGKN+ IFAD SSLA+NP YI+SW+DLLS TPRVAPFLSKND
Sbjct  419  IRSVKLVAESLARHIYGHEGKNVQIFADNSSLAVNPSYIKSWLDLLSQTPRVAPFLSKND  478

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL D+T +V+VQHEVLDGMFTFYDST +KL++YQVASVTFDLLLLL LGSYL
Sbjct  479  PFILALKKELEDNTDEVNVQHEVLDGMFTFYDSTRAKLNVYQVASVTFDLLLLLVLGSYL  538

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  539  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  570



>ref|XP_009595187.1| PREDICTED: nicalin-1 [Nicotiana tomentosiformis]
Length=563

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            IQ VKLVA+SLA+H Y  EGK+ NIFAD SSLA+NP Y+RSW+DLLS T RVAPFL KND
Sbjct  412  IQSVKLVAESLARHIYSQEGKSTNIFADNSSLAVNPSYVRSWLDLLSRTSRVAPFLPKND  471

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMAL+KELADHTA+V++QHE LDGMFTFYDS S +LHIYQVASVTFDLLLLL LGSYL
Sbjct  472  PLIMALQKELADHTAEVNIQHETLDGMFTFYDSISGRLHIYQVASVTFDLLLLLVLGSYL  531

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            ITLF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  532  ITLFSFLVITTRGLDDLISLFRRPPSRKVKTA  563



>gb|KFK33877.1| hypothetical protein AALP_AA5G071800 [Arabis alpina]
Length=567

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKN+
Sbjct  416  IKGVKLVAESLARHIYGHQGKDIRIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKNE  475

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE L+G FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  476  PLIMALKKELEDYTAEVSVQHESLEGSFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  535

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  536  IVLFSFLVITTRGLDDLISLFRRPPSRKVKMA  567



>ref|XP_009758150.1| PREDICTED: nicalin-1-like [Nicotiana sylvestris]
Length=562

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YG EGKN NIF+D SSLA+NP Y+RSW+DLLS T RVAPFL KND
Sbjct  411  IRSVKLVAESLARHIYGQEGKNTNIFSDNSSLAVNPSYVRSWLDLLSRTARVAPFLPKND  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMAL+KELADHTA+V++QHE LDG+FTFYDS S +LHIYQVASVTFDLLLLL LGSYL
Sbjct  471  PLIMALQKELADHTAEVNIQHETLDGVFTFYDSISGRLHIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            ITLF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  531  ITLFSFLVITTRGLDDLISLFRRPPSRKVKTA  562



>ref|XP_006481501.1| PREDICTED: nicalin-1-like [Citrus sinensis]
Length=561

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YG++GKNI IFAD SSLA+NP YIRSW+DLLS TPRVAPF+SKND
Sbjct  410  IRSVKLVAESLARHIYGYQGKNIQIFADNSSLAVNPSYIRSWLDLLSQTPRVAPFISKND  469

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P IMALKKELADHT +V +QHEVLDGMFTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  470  PFIMALKKELADHTDEVIMQHEVLDGMFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  529

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  530  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  561



>ref|XP_010245975.1| PREDICTED: nicalin-1 isoform X2 [Nelumbo nucifera]
Length=538

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+H YGH+GKNI IFADGSSLA+NPFYI+SW+DL+S TPRVAPFL KNDP
Sbjct  388  RSVKLVAESLARHIYGHQGKNIQIFADGSSLAVNPFYIQSWLDLMSQTPRVAPFLPKNDP  447

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             I+ALKKELADHTA+V+VQHE LDG+FTFYD T + L+IYQVASVTFDLLLLL LGSYLI
Sbjct  448  FILALKKELADHTAEVNVQHEALDGIFTFYDLTKASLNIYQVASVTFDLLLLLVLGSYLI  507

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  508  ILFSFLVITTRGLDDLISLFRRPPSRKVKMA  538



>ref|XP_010541265.1| PREDICTED: nicalin-1 [Tarenaya hassleriana]
 ref|XP_010541266.1| PREDICTED: nicalin-1 [Tarenaya hassleriana]
Length=567

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++G KLVA+SLA+H YGH+GK+I IFAD SSLA+NPFY+RSW+DLLS TPRVAPFLSKN+
Sbjct  416  VKGAKLVAESLARHIYGHQGKDIQIFADDSSLAVNPFYVRSWLDLLSQTPRVAPFLSKNE  475

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL DHTA++SVQH+ L+  FTFYDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  476  PLIMALKKELEDHTAEISVQHDSLEETFTFYDSTKAKLNIYQVASVTFDLLLLLGLGSYL  535

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLV+TTRGLDDLIS FRRPPSRKVK A
Sbjct  536  IVLFCFLVLTTRGLDDLISFFRRPPSRKVKMA  567



>ref|XP_010245968.1| PREDICTED: nicalin-1 isoform X1 [Nelumbo nucifera]
Length=564

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+H YGH+GKNI IFADGSSLA+NPFYI+SW+DL+S TPRVAPFL KNDP
Sbjct  414  RSVKLVAESLARHIYGHQGKNIQIFADGSSLAVNPFYIQSWLDLMSQTPRVAPFLPKNDP  473

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             I+ALKKELADHTA+V+VQHE LDG+FTFYD T + L+IYQVASVTFDLLLLL LGSYLI
Sbjct  474  FILALKKELADHTAEVNVQHEALDGIFTFYDLTKASLNIYQVASVTFDLLLLLVLGSYLI  533

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  ILFSFLVITTRGLDDLISLFRRPPSRKVKMA  564



>ref|XP_006424179.1| hypothetical protein CICLE_v10028115mg [Citrus clementina]
 gb|ESR37419.1| hypothetical protein CICLE_v10028115mg [Citrus clementina]
Length=561

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LVA+SLA+H YG++GKNI IFAD SSLA+NP YIRSW+DLLS TPRVAPF+SKND
Sbjct  410  IRSVQLVAESLARHIYGYQGKNIQIFADNSSLAVNPSYIRSWLDLLSQTPRVAPFISKND  469

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P IMALKKELADHT +V +QHEVLDGMFTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  470  PFIMALKKELADHTDEVIMQHEVLDGMFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  529

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  530  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  561



>ref|XP_002273260.1| PREDICTED: nicalin-1 [Vitis vinifera]
 emb|CBI28285.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ +KLVA+SLA+H YGHEGKNI IFAD SSLA+NP YI+SW+ LLS TPRVAPF SKND
Sbjct  412  IRSIKLVAESLARHIYGHEGKNIQIFADDSSLAVNPSYIQSWLHLLSRTPRVAPFCSKND  471

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKELADHT +V+VQHEVLDGMFTFYDST ++L+IYQVASVTFDLLLLL LGSYL
Sbjct  472  PFILALKKELADHTVEVNVQHEVLDGMFTFYDSTKARLNIYQVASVTFDLLLLLVLGSYL  531

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRK+KTA
Sbjct  532  IVLFSFLVITTRGLDDLISLFRRPPSRKLKTA  563



>gb|KJB35404.1| hypothetical protein B456_006G113500 [Gossypium raimondii]
Length=562

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++GVKLVA+SLA+H YGH+GKNI IFAD SSLA+NP YIRSW+D+LS TPRVAPFLSK+D
Sbjct  411  VRGVKLVAESLARHIYGHQGKNIQIFADESSLAVNPAYIRSWLDVLSQTPRVAPFLSKDD  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKELA H  +V+VQHE L+G+FTFYDSTS++L+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PFVMALKKELAGHVDEVNVQHETLEGIFTFYDSTSARLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRK+KTA
Sbjct  531  IVLFSFLVITTRGLDDLISLFRRPPSRKLKTA  562



>ref|XP_006836081.1| hypothetical protein AMTR_s00114p00123360 [Amborella trichopoda]
 gb|ERM98934.1| hypothetical protein AMTR_s00114p00123360 [Amborella trichopoda]
Length=559

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            + G+KLVA+SL +H YG+ GK+  IFAD SSLAINPFY+R W+DL+S TPRVAPFLSKND
Sbjct  408  LNGIKLVAESLVRHIYGYHGKSFEIFADDSSLAINPFYVRQWLDLISRTPRVAPFLSKND  467

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI ALKKEL+DHT DV VQHEVLDG+FTFYD  ++KLHIYQVASVTFDL +LL +GSYL
Sbjct  468  PLIAALKKELSDHTVDVHVQHEVLDGVFTFYDLITAKLHIYQVASVTFDLFILLMVGSYL  527

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLISIFRRPPSRKVKTA
Sbjct  528  ILLFSFLVITTRGLDDLISIFRRPPSRKVKTA  559



>ref|XP_002523845.1| Nicalin precursor, putative [Ricinus communis]
 gb|EEF38571.1| Nicalin precursor, putative [Ricinus communis]
Length=559

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ +KLV +S+A+H Y H+GKNI IFAD SSLA+NP YIRSW+DLLS TPRVAPFLSKND
Sbjct  408  VRSIKLVTESIARHIYDHQGKNIKIFADNSSLAVNPSYIRSWLDLLSQTPRVAPFLSKND  467

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DH  +V+VQHEVLDGMFTFYDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  468  PFVMALKKELEDHVQEVNVQHEVLDGMFTFYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  527

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRK+KTA
Sbjct  528  IVLFSFLVITTRGLDDLISLFRRPPSRKMKTA  559



>ref|XP_009374972.1| PREDICTED: nicalin-1-like [Pyrus x bretschneideri]
Length=568

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I  VKLVA+SLA+H YGHEGKN+ IFAD SSLA+NP YI+SW+DLLS TPRVAPFLSKND
Sbjct  417  IISVKLVAESLARHIYGHEGKNVQIFADNSSLAVNPSYIKSWLDLLSQTPRVAPFLSKND  476

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+A KKEL D+T +V+VQHEVLDGMFTFYDST + L++YQVASVTFDLLLLL LGSYL
Sbjct  477  PFILAFKKELEDNTDEVNVQHEVLDGMFTFYDSTRASLNVYQVASVTFDLLLLLVLGSYL  536

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  537  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  568



>ref|XP_010031534.1| PREDICTED: nicalin-1 [Eucalyptus grandis]
 gb|KCW50874.1| hypothetical protein EUGRSUZ_J00522 [Eucalyptus grandis]
Length=559

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGH+GKNI IFAD  SLA+NP YIRSW+DLLS TPRVAPFLSKND
Sbjct  408  IKSVKLVAESLARHIYGHQGKNIQIFADEGSLAVNPSYIRSWLDLLSQTPRVAPFLSKND  467

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL +HT +V +Q+EVLDGMFTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  468  PFVMALKKELEEHTEEVILQNEVLDGMFTFYDSTKATLNIYQVASVTFDLLLLLVLGSYL  527

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FL+ITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  528  IVLFSFLIITTRGLDDLISLFRRPPSRKVKTA  559



>ref|XP_011090328.1| PREDICTED: nicalin-1 isoform X2 [Sesamum indicum]
Length=400

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            +GVKLVA+SLA+H YG + K+I+IFAD SSL++NP YIRSW+  LSTTPR+APFLSKNDP
Sbjct  250  RGVKLVAESLARHIYGQQEKDIDIFADDSSLSLNPSYIRSWLAFLSTTPRMAPFLSKNDP  309

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            LIMALK+ELADHT +V++Q EVLDGMFTFYDSTS +LHIYQVASVTFDLLLLL LGSYLI
Sbjct  310  LIMALKQELADHTVEVNIQQEVLDGMFTFYDSTSGRLHIYQVASVTFDLLLLLVLGSYLI  369

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            TLF FLVI TRGLDDLIS+FRRP SRKVK A
Sbjct  370  TLFSFLVIITRGLDDLISLFRRPTSRKVKAA  400



>ref|XP_009123309.1| PREDICTED: nicalin-1-like [Brassica rapa]
Length=563

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+GK+I IFAD SSLA+N FY++SW+D LS TPRVAPFLSKN+
Sbjct  412  IKGVKLVAESLARHIYGHQGKDIQIFADNSSLAVNRFYVKSWLDSLSQTPRVAPFLSKNE  471

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VS+Q E LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  472  PLIMALKKELEDYTAEVSIQQESLDGIFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  531

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLISIFRRPPSRK+K A
Sbjct  532  IMLFSFLVITTRGLDDLISIFRRPPSRKIKIA  563



>ref|XP_004506200.1| PREDICTED: nicalin-1-like [Cicer arietinum]
Length=564

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLAKH YGH+GKN+ IFAD S+LA+NP Y+RSW+D+LS TPRVAPFLSK+D
Sbjct  413  VRSVKLIAESLAKHIYGHQGKNVQIFADNSNLAVNPSYVRSWLDVLSRTPRVAPFLSKDD  472

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P + ALKKEL DHT +V++Q EVLDGMFTFYDST++KL+IYQVASVTFDLLLLL LGSYL
Sbjct  473  PFVTALKKELEDHTDEVNLQREVLDGMFTFYDSTTAKLNIYQVASVTFDLLLLLVLGSYL  532

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  533  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  564



>ref|XP_004228460.1| PREDICTED: nicalin-1-like [Solanum lycopersicum]
Length=565

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            IQ +KLVA+SLA+H Y  E K+I+IFAD SSLA+NP YIRSW+DLLSTTPRVAPFLSKND
Sbjct  414  IQRIKLVAESLARHIYSQEKKSISIFADDSSLAVNPSYIRSWLDLLSTTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI AL+KELADHTA+V+VQHE LDG FTFYDSTS KLHIYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIKALEKELADHTAEVNVQHESLDGTFTFYDSTSGKLHIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKT  323
            ITLF FL ITTRGLDDLIS+FRRP SRKVKT
Sbjct  534  ITLFSFLFITTRGLDDLISLFRRPSSRKVKT  564



>emb|CDY62392.1| BnaC03g74930D [Brassica napus]
Length=562

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+GK+I IFAD SSLA+N FY++SW+D LS TPRVAPFLSKN+
Sbjct  411  IKGVKLVAESLARHIYGHQGKDIQIFADNSSLAVNRFYVKSWLDGLSQTPRVAPFLSKNE  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VS+Q E LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PLIMALKKELEDYTAEVSIQQESLDGIFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLISIFRRPPSRK+K A
Sbjct  531  IMLFSFLVITTRGLDDLISIFRRPPSRKMKIA  562



>gb|KEH29830.1| M28 Zn-peptidase nicastrin [Medicago truncatula]
Length=564

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLAKH YGH+GKN+ IFAD S+LA+NP YIRSW+D+LS TPRVAPFLSK+D
Sbjct  413  VRSVKLIAESLAKHIYGHQGKNVQIFADNSNLAVNPSYIRSWLDVLSRTPRVAPFLSKDD  472

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL DHT +V++Q EVLDGMFTFYDST+++L+IYQVASVTFDLLLLL LGSYL
Sbjct  473  PFITALKKELEDHTDEVNLQREVLDGMFTFYDSTTAQLNIYQVASVTFDLLLLLVLGSYL  532

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRK+KTA
Sbjct  533  IVLFSFLVITTRGLDDLISLFRRPPSRKMKTA  564



>gb|KDP24745.1| hypothetical protein JCGZ_25494 [Jatropha curcas]
Length=555

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ +KLVA+S+A+H Y ++G+ I IFAD SSLA+NP Y+RSW+DLLS TPRVAPFLSKND
Sbjct  404  IRSIKLVAESIARHVYNYQGEKIKIFADDSSLAVNPAYVRSWLDLLSRTPRVAPFLSKND  463

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PL+MAL+KEL DH  +V+VQHEVLDG+FTFYDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  464  PLVMALRKELEDHAPEVTVQHEVLDGIFTFYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  523

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  524  ILLFSFLVITTRGLDDLISLFRRPPSRKVKTA  555



>emb|CDY47303.1| BnaA06g38990D [Brassica napus]
Length=563

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+GK+I IFAD SSLA+N FY++SW+D LS TPRVAPFLSKN+
Sbjct  412  IKGVKLVAESLARHIYGHQGKDIQIFADNSSLAVNRFYVKSWLDSLSQTPRVAPFLSKNE  471

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VS+Q E LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  472  PLIMALKKELEDYTAEVSIQQESLDGIFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  531

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            I LF FLVITTRGLDDLISIFRRPPSRK+K
Sbjct  532  IMLFSFLVITTRGLDDLISIFRRPPSRKMK  561



>emb|CDY21224.1| BnaC03g54000D [Brassica napus]
Length=565

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+ K+I IFAD SSLA+NPF +RSW+DLLS TPRVAPFLSK++
Sbjct  414  IKGVKLVAESLARHIYGHQRKDIKIFADDSSLAVNPFNVRSWLDLLSQTPRVAPFLSKSE  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMALKKEL D+TA+VSVQHE LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PLIMALKKELEDYTAEVSVQHESLDGIFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            I LF FLVITTRG+DDLIS+FRRPPSRKVK
Sbjct  534  IVLFSFLVITTRGVDDLISLFRRPPSRKVK  563



>ref|XP_011006540.1| PREDICTED: nicalin-1-like isoform X1 [Populus euphratica]
Length=565

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ +KLVA+S+A+H YG++GKNI IFAD +SLA+N  YIRSW+DLLS TPRVAPFLSKND
Sbjct  414  VRSIKLVAESIARHVYGYQGKNIQIFADDTSLAVNAPYIRSWLDLLSQTPRVAPFLSKND  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL DHT +V+VQHEVLDGMFT YDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  474  PFIVALKKELEDHTHEVNVQHEVLDGMFTIYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  IILFTFLVITTRGLDDLISLFRRPPSRKVKAA  565



>gb|EYU36051.1| hypothetical protein MIMGU_mgv1a003633mg [Erythranthe guttata]
Length=572

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+  YG +GKNI IFAD SSL++NP Y+RSW++ LSTTPRVAPFL+KNDP
Sbjct  422  RSVKLVAESLARQIYGQQGKNIEIFADDSSLSVNPSYMRSWLEFLSTTPRVAPFLAKNDP  481

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            LIMALKKELADHT +V+VQ E LDGMFTFYDSTS KLHIYQVASVTFDLLLLL LGSYLI
Sbjct  482  LIMALKKELADHTVEVNVQQEPLDGMFTFYDSTSGKLHIYQVASVTFDLLLLLLLGSYLI  541

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKT  323
            TLF FLVI TRGLDDLIS+FRRP SRKVKT
Sbjct  542  TLFSFLVIITRGLDDLISLFRRPTSRKVKT  571



>ref|XP_011090327.1| PREDICTED: nicalin-1 isoform X1 [Sesamum indicum]
Length=569

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            +GVKLVA+SLA+H YG + K+I+IFAD SSL++NP YIRSW+  LSTTPR+APFLSKNDP
Sbjct  419  RGVKLVAESLARHIYGQQEKDIDIFADDSSLSLNPSYIRSWLAFLSTTPRMAPFLSKNDP  478

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            LIMALK+ELADHT +V++Q EVLDGMFTFYDSTS +LHIYQVASVTFDLLLLL LGSYLI
Sbjct  479  LIMALKQELADHTVEVNIQQEVLDGMFTFYDSTSGRLHIYQVASVTFDLLLLLVLGSYLI  538

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            TLF FLVI TRGLDDLIS+FRRP SRKVK A
Sbjct  539  TLFSFLVIITRGLDDLISLFRRPTSRKVKAA  569



>ref|XP_006362634.1| PREDICTED: nicalin-1-like isoform X2 [Solanum tuberosum]
Length=564

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ +KLVA+SLA+H Y  E K+I+IFAD SSLA+NP YIRSW+DLLSTTPRVAPFLSKND
Sbjct  413  IRSIKLVAESLARHIYSQEKKSISIFADDSSLAVNPSYIRSWLDLLSTTPRVAPFLSKND  472

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI AL+KEL DHTA+V+VQHE LDG FTFYDSTS KLHIYQVASVTFDLLLLL LGSYL
Sbjct  473  PLIKALEKELTDHTAEVNVQHETLDGTFTFYDSTSGKLHIYQVASVTFDLLLLLVLGSYL  532

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKT  323
            ITLF FL ITTRGLDDLIS+FRRP SRKVK+
Sbjct  533  ITLFSFLFITTRGLDDLISLFRRPSSRKVKS  563



>ref|XP_007132463.1| hypothetical protein PHAVU_011G096100g [Phaseolus vulgaris]
 gb|ESW04457.1| hypothetical protein PHAVU_011G096100g [Phaseolus vulgaris]
Length=561

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLA+H YGH+GKNI IFAD ++LA+NP Y+RSW+D+LS TPRVAPFLSK+D
Sbjct  410  VRSVKLIAESLARHIYGHQGKNIQIFADNTNLAVNPSYVRSWLDVLSQTPRVAPFLSKDD  469

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MAL+KEL DHT +V++  +VL+G+FTFYDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  470  PFVMALRKELEDHTDEVNLHRDVLEGVFTFYDSTRAKLNIYQVASVTFDLLLLLVLGSYL  529

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  530  IVLFCFLVITTRGLDDLISLFRRPPSRKVKTA  561



>emb|CDY30940.1| BnaA06g19730D [Brassica napus]
Length=562

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+ K+I IFAD SSLA+NPF +RSW+DLLS TPRVAPFLSK++
Sbjct  411  IKGVKLVAESLARHIYGHQKKDIKIFADDSSLAVNPFNVRSWLDLLSQTPRVAPFLSKSE  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI ALKKEL D+TA+VSVQHE LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PLITALKKELEDYTAEVSVQHESLDGIFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            I LF FLVITTRG+DDLIS+FRRPPSRKVK
Sbjct  531  IVLFSFLVITTRGVDDLISLFRRPPSRKVK  560



>ref|XP_004139498.1| PREDICTED: nicalin-like [Cucumis sativus]
 ref|XP_004169889.1| PREDICTED: nicalin-like [Cucumis sativus]
Length=563

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + +KLVA+SLA+H Y +EGKNI +FAD SSLAINP +IRSW+DLLS TPRVAPFLSK+DP
Sbjct  413  KSIKLVAESLARHIYRYEGKNIQVFADDSSLAINPTFIRSWLDLLSRTPRVAPFLSKDDP  472

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             I ALKKEL  HT DVS+QHEV +G+FTFY ST++KLH+YQVASVTFDLLLLL LGSYL+
Sbjct  473  FITALKKELEVHTHDVSLQHEVFEGIFTFYGSTAAKLHVYQVASVTFDLLLLLVLGSYLV  532

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LFCFLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  533  LLFCFLVITTRGLDDLISLFRRPPSRKVKTA  563



>ref|XP_006384766.1| hypothetical protein POPTR_0004s20910g [Populus trichocarpa]
 gb|ERP62563.1| hypothetical protein POPTR_0004s20910g [Populus trichocarpa]
Length=540

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ +KLVA+S+A+H Y ++GKNI IFAD +SLA+N  YIRSW+DLLS TPRVAPFLSKND
Sbjct  389  VRSIKLVAESIARHVYDYQGKNIQIFADDTSLAVNAPYIRSWLDLLSQTPRVAPFLSKND  448

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT +V+VQHEVLDGMFT YDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  449  PFVMALKKELEDHTHEVNVQHEVLDGMFTIYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  508

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVK A
Sbjct  509  IILFTFLVITTRGLDDLISLFRRPPSRKVKAA  540



>gb|KHN21166.1| Nicalin [Glycine soja]
Length=562

 Score =   221 bits (562),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLA+H YGH+GKNI IFAD S+LA+NP Y++SW+D+LS TPRVAPFLSK D
Sbjct  411  VRSVKLIAESLARHIYGHQGKNIQIFADNSNLAVNPSYVQSWLDVLSQTPRVAPFLSKGD  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT +V++  +VLDGMFTFYDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PFVMALKKELEDHTDEVNLHRDVLDGMFTFYDSTRAKLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  531  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  562



>ref|XP_008463652.1| PREDICTED: nicalin-1 [Cucumis melo]
Length=563

 Score =   220 bits (561),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + +KLVA+SLA+H Y +EGKNI +FAD SSLA+NP YIRSW+DLLS TPRVAPFLSK+DP
Sbjct  413  KSIKLVAESLARHIYRYEGKNIQVFADDSSLAVNPTYIRSWVDLLSRTPRVAPFLSKDDP  472

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             I ALKKEL  HT DVS+QHEV +G+FTFY ST++KLH+YQVASVTFDLLLLL LGSYL+
Sbjct  473  FISALKKELEVHTHDVSLQHEVFEGIFTFYGSTAAKLHVYQVASVTFDLLLLLVLGSYLV  532

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LFCFLVITTRGLDDLI +FRRPPSRKVKTA
Sbjct  533  LLFCFLVITTRGLDDLIGLFRRPPSRKVKTA  563



>ref|XP_009416037.1| PREDICTED: nicalin [Musa acuminata subsp. malaccensis]
Length=562

 Score =   220 bits (561),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+H YG+EGKNI IFAD SSLA+NP Y++SW+DLLS TPRVAPFLSKNDP
Sbjct  412  RSVKLVAESLARHIYGYEGKNIQIFADNSSLAVNPSYVKSWLDLLSRTPRVAPFLSKNDP  471

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            +I+ALKKEL+DHT +V +QHE +DGMF+FYDST + L+IYQVASVTFDLLLLLALGSYLI
Sbjct  472  IILALKKELSDHTDEVHLQHESIDGMFSFYDSTRATLNIYQVASVTFDLLLLLALGSYLI  531

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLI++FRRPPSRK K A
Sbjct  532  LLFSFLVITTRGLDDLINMFRRPPSRKAKAA  562



>ref|XP_009150276.1| PREDICTED: nicalin-1-like [Brassica rapa]
Length=562

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+GVKLVA+SLA+H YGH+ K+I IFAD SSLA+NPF +RSW+DLLS TPRVAP+LSK++
Sbjct  411  IKGVKLVAESLARHIYGHQRKDIKIFADDSSLAVNPFNVRSWLDLLSQTPRVAPYLSKSE  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI ALKKEL D+TA+VSVQHE LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PLITALKKELEDYTAEVSVQHESLDGIFTFYDSTKASLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            I LF FLVITTRG+DDLIS+FRRPPSRKVK
Sbjct  531  IVLFSFLVITTRGVDDLISLFRRPPSRKVK  560



>gb|KHN38614.1| Nicalin-1, partial [Glycine soja]
Length=550

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLA+H YGH+GKNI IFAD S+LA+NP Y+RSW+D+LS TPRVAPF SK+D
Sbjct  399  VRSVKLIAESLARHIYGHQGKNIQIFADNSNLAVNPSYVRSWLDVLSQTPRVAPFFSKSD  458

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT DV++  +VLDG+ TFYDSTS+KL+IYQVASVTFDLLLLL LGSYL
Sbjct  459  PFVMALKKELEDHTDDVNLHRDVLDGIVTFYDSTSTKLNIYQVASVTFDLLLLLVLGSYL  518

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  519  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  550



>gb|ACF83602.1| unknown [Zea mays]
Length=241

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG  G+NI++FA+ SSLAINP Y+RSW+DLLS TPRVAPFL KND
Sbjct  90   IRTVRLVSESLARHIYGLRGRNIDVFAENSSLAINPRYVRSWLDLLSRTPRVAPFLQKND  149

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HT+DV VQ + L+GMFTFYD+T + L++YQVASVTFDLL LL LGSYL
Sbjct  150  PFIAALKKELSEHTSDVHVQSDALEGMFTFYDTTKATLNVYQVASVTFDLLFLLVLGSYL  209

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVI+TRG+DDLI+IFRRPPSRK+K A
Sbjct  210  IVLFCFLVISTRGVDDLINIFRRPPSRKLKGA  241



>ref|XP_003538104.1| PREDICTED: nicalin-1-like [Glycine max]
Length=562

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLA+H YGH+GKNI IFAD S+LA+NP Y+RSW+D+LS TPRVAPF SK+D
Sbjct  411  VRSVKLIAESLARHIYGHQGKNIQIFADNSNLAVNPSYVRSWLDVLSQTPRVAPFFSKSD  470

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT DV++  +VLDG+ TFYDSTS+KL+IYQVASVTFDLLLLL LGSYL
Sbjct  471  PFVMALKKELEDHTDDVNLHRDVLDGIVTFYDSTSTKLNIYQVASVTFDLLLLLVLGSYL  530

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  531  IVLFSFLVITTRGLDDLISLFRRPPSRKVKTA  562



>ref|XP_004291695.1| PREDICTED: nicalin-1 [Fragaria vesca subsp. vesca]
Length=565

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+ LA+H YGH+GKNI IFA+ SSLA+NP YI+SW+DLLS TPRVAPFLSK+D
Sbjct  414  IKSVKLVAEGLARHIYGHKGKNIQIFAENSSLAVNPSYIKSWLDLLSQTPRVAPFLSKSD  473

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL +HT +V+VQHEVLDG+FTFYD T + L++YQVASVTFDLLLLL LGSYL
Sbjct  474  PFILALKKELENHTDEVNVQHEVLDGVFTFYDPTRASLNVYQVASVTFDLLLLLVLGSYL  533

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLV+TTRGLDDLIS+FRRPPSRKVK A
Sbjct  534  IVLFSFLVVTTRGLDDLISLFRRPPSRKVKAA  565



>ref|XP_004251075.1| PREDICTED: nicalin-1-like [Solanum lycopersicum]
Length=564

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+S+A+H Y  EGK  NIFAD  SLA+NP Y+RSW+DLLSTT RVAPFLSK+D
Sbjct  413  IRSVKLVAESVARHIYSQEGKGTNIFADDGSLAVNPSYVRSWLDLLSTTSRVAPFLSKSD  472

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMAL+KELADHTA+V+VQHE LD  FTFYDS S +LH+YQVASVTFDLLLLL LGSYL
Sbjct  473  PLIMALQKELADHTAEVNVQHETLDETFTFYDSISGRLHVYQVASVTFDLLLLLVLGSYL  532

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            ITLF FLVITTRGLDDLIS+FRRPPSRKVK
Sbjct  533  ITLFSFLVITTRGLDDLISLFRRPPSRKVK  562



>ref|XP_006362903.1| PREDICTED: nicalin-1-like [Solanum tuberosum]
Length=578

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+S+A+H Y  EGK  NIFAD  SLA+NP Y+RSW+DLLSTT RVAPFLSK+D
Sbjct  427  IRSVKLVAESVARHIYSQEGKGTNIFADNGSLAVNPSYVRSWLDLLSTTSRVAPFLSKSD  486

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLIMAL+KELADHTA+V+VQHE LD  FTFYDS S KLH+YQVASVTFDLLLLL LGSYL
Sbjct  487  PLIMALQKELADHTAEVNVQHETLDETFTFYDSISGKLHVYQVASVTFDLLLLLVLGSYL  546

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVK  326
            ITLF FLVITTRGLDDLI++FRRPPSRKVK
Sbjct  547  ITLFSFLVITTRGLDDLINLFRRPPSRKVK  576



>gb|KGN64956.1| hypothetical protein Csa_1G167840 [Cucumis sativus]
Length=650

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + +KLVA+SLA+H Y +EGKNI +FAD SSLAINP +IRSW+DLLS TPRVAPFLSK+DP
Sbjct  500  KSIKLVAESLARHIYRYEGKNIQVFADDSSLAINPTFIRSWLDLLSRTPRVAPFLSKDDP  559

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
             I ALKKEL  HT DVS+QHEV +G+FTFY ST++KLH+YQVASVTFDLLLLL LGSYL+
Sbjct  560  FITALKKELEVHTHDVSLQHEVFEGIFTFYGSTAAKLHVYQVASVTFDLLLLLVLGSYLV  619

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LFCFLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  620  LLFCFLVITTRGLDDLISLFRRPPSRKVKTA  650



>ref|XP_002312837.2| hypothetical protein POPTR_0009s16200g [Populus trichocarpa]
 gb|EEE86792.2| hypothetical protein POPTR_0009s16200g [Populus trichocarpa]
Length=572

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ +KLVA+S+A+H YG +GKNI IFAD +SLA+N  YIRSW+DLLS TPRV PFL+KND
Sbjct  421  VRSIKLVAESVARHIYGCQGKNIQIFADDTSLAVNAPYIRSWLDLLSKTPRVVPFLTKND  480

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT +V+V HEVLDGMFT YDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  481  PFVMALKKELEDHTHEVNVHHEVLDGMFTLYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  540

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  541  IILFTFLVITTRGLDDLISLFRRPPSRKVKTA  572



>ref|XP_011043354.1| PREDICTED: nicalin-1-like [Populus euphratica]
Length=572

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ +KLVA+S+A+H YG +GKNI IFAD +SLA+N  YIRSW+DLLS TPRV PFL+KND
Sbjct  421  VRSIKLVAESIARHIYGCQGKNIQIFADDTSLAVNAPYIRSWLDLLSKTPRVVPFLTKND  480

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL DHT +V+V HEVLDGMFT YDST +KL+IYQVASVTFDLLLLL LGSYL
Sbjct  481  PFVMALKKELEDHTHEVNVHHEVLDGMFTLYDSTKAKLNIYQVASVTFDLLLLLVLGSYL  540

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  541  IILFTFLVITTRGLDDLISLFRRPPSRKVKTA  572



>ref|XP_010912330.1| PREDICTED: nicalin-1-like isoform X3 [Elaeis guineensis]
Length=491

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            ++LVA+SLAKH YGH+G+NI IFAD SSLAINPFYI +W+DLLS  PRVAPFLSK DP+I
Sbjct  343  IRLVAESLAKHIYGHQGRNIQIFADNSSLAINPFYISAWLDLLSRAPRVAPFLSKTDPII  402

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             +LKKEL+DHT ++ VQHE +DGMF+FYDST + L++YQVASV FDLLLLLALG+YLI L
Sbjct  403  SSLKKELSDHTVELHVQHETIDGMFSFYDSTRATLNVYQVASVAFDLLLLLALGAYLILL  462

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLV+TTRGLDDLI++FRRPPSRKVK A
Sbjct  463  FSFLVLTTRGLDDLINLFRRPPSRKVKAA  491



>ref|XP_010912332.1| PREDICTED: nicalin-like isoform X4 [Elaeis guineensis]
Length=488

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            ++LVA+SLAKH YGH+G+NI IFAD SSLAINPFYI +W+DLLS  PRVAPFLSK DP+I
Sbjct  340  IRLVAESLAKHIYGHQGRNIQIFADNSSLAINPFYISAWLDLLSRAPRVAPFLSKTDPII  399

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             +LKKEL+DHT ++ VQHE +DGMF+FYDST + L++YQVASV FDLLLLLALG+YLI L
Sbjct  400  SSLKKELSDHTVELHVQHETIDGMFSFYDSTRATLNVYQVASVAFDLLLLLALGAYLILL  459

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLV+TTRGLDDLI++FRRPPSRKVK A
Sbjct  460  FSFLVLTTRGLDDLINLFRRPPSRKVKAA  488



>ref|XP_010912329.1| PREDICTED: nicalin-1-like isoform X2 [Elaeis guineensis]
Length=517

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            ++LVA+SLAKH YGH+G+NI IFAD SSLAINPFYI +W+DLLS  PRVAPFLSK DP+I
Sbjct  369  IRLVAESLAKHIYGHQGRNIQIFADNSSLAINPFYISAWLDLLSRAPRVAPFLSKTDPII  428

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             +LKKEL+DHT ++ VQHE +DGMF+FYDST + L++YQVASV FDLLLLLALG+YLI L
Sbjct  429  SSLKKELSDHTVELHVQHETIDGMFSFYDSTRATLNVYQVASVAFDLLLLLALGAYLILL  488

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLV+TTRGLDDLI++FRRPPSRKVK A
Sbjct  489  FSFLVLTTRGLDDLINLFRRPPSRKVKAA  517



>ref|XP_004972399.1| PREDICTED: nicalin-like isoform X1 [Setaria italica]
Length=555

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG +G+NI++FA+ SSLAINP YI+SW+DLLS TPRVAPFL KND
Sbjct  404  IRTVRLVSESLARHIYGLKGRNIDVFAENSSLAINPHYIQSWLDLLSRTPRVAPFLQKND  463

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HTADV VQ++ LDGMFTFYD+T + L++YQVASVTFDLL LL LGSYL
Sbjct  464  PFIAALKKELSEHTADVHVQNDALDGMFTFYDATKATLNVYQVASVTFDLLFLLLLGSYL  523

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVITTRG+DDLI+IFRRPPSRK+K A
Sbjct  524  IVLFCFLVITTRGVDDLINIFRRPPSRKLKGA  555



>gb|EEC82760.1| hypothetical protein OsI_27484 [Oryza sativa Indica Group]
Length=475

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG +GKNI++F + SSLAINP YI+SW+DLLS TPRVAPFL KND
Sbjct  324  IRTVRLVSESLARHIYGLKGKNIDVFVENSSLAINPHYIQSWLDLLSRTPRVAPFLQKND  383

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HTADV VQ +VLDGMFTFYD+T + L++YQVASVTFDLL LL +GSYL
Sbjct  384  PFIAALKKELSEHTADVHVQSDVLDGMFTFYDATKATLNVYQVASVTFDLLFLLVIGSYL  443

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLI+IFRRPPSRKVK A
Sbjct  444  IILFSFLVITTRGLDDLINIFRRPPSRKVKGA  475



>ref|NP_001060766.1| Os08g0102100 [Oryza sativa Japonica Group]
 dbj|BAD03560.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33156.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22680.1| Os08g0102100 [Oryza sativa Japonica Group]
 dbj|BAG89235.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67893.1| hypothetical protein OsJ_25727 [Oryza sativa Japonica Group]
Length=555

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG +GKNI++FA+ SSLAINP YI+SW+DLLS TPRVAPFL KND
Sbjct  404  IRTVRLVSESLARHIYGLKGKNIDVFAENSSLAINPHYIQSWLDLLSRTPRVAPFLQKND  463

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HTADV VQ +VLDGMFTFYD+T + L++YQVASVTFDLL LL +GSYL
Sbjct  464  PFIAALKKELSEHTADVHVQSDVLDGMFTFYDATKATLNVYQVASVTFDLLFLLVIGSYL  523

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLI+IFRRPPSRKVK A
Sbjct  524  IILFSFLVITTRGLDDLINIFRRPPSRKVKGA  555



>ref|XP_010912328.1| PREDICTED: nicalin-like isoform X1 [Elaeis guineensis]
Length=564

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            ++LVA+SLAKH YGH+G+NI IFAD SSLAINPFYI +W+DLLS  PRVAPFLSK DP+I
Sbjct  416  IRLVAESLAKHIYGHQGRNIQIFADNSSLAINPFYISAWLDLLSRAPRVAPFLSKTDPII  475

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             +LKKEL+DHT ++ VQHE +DGMF+FYDST + L++YQVASV FDLLLLLALG+YLI L
Sbjct  476  SSLKKELSDHTVELHVQHETIDGMFSFYDSTRATLNVYQVASVAFDLLLLLALGAYLILL  535

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLV+TTRGLDDLI++FRRPPSRKVK A
Sbjct  536  FSFLVLTTRGLDDLINLFRRPPSRKVKAA  564



>ref|XP_006659731.1| PREDICTED: nicalin-like [Oryza brachyantha]
Length=557

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG +G+NI++FA+ SSLAINP YI+SW+DLLS TPRVAPFL KND
Sbjct  406  IRTVRLVSESLARHIYGLKGRNIDVFAENSSLAINPHYIQSWLDLLSQTPRVAPFLQKND  465

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HTADV VQ +VLDGMFTFYD+T + L++YQVASVTFDLL LL +GSYL
Sbjct  466  PFIAALKKELSEHTADVHVQSDVLDGMFTFYDATKATLNVYQVASVTFDLLFLLVIGSYL  525

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLI+IFRRPPSRKVK A
Sbjct  526  IILFSFLVITTRGLDDLINIFRRPPSRKVKGA  557



>dbj|BAJ94473.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90738.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKLV++SLA+H YG  G+NI++FAD SSLAI+P YIRSW+DL S TPRVAPFL KND
Sbjct  404  MRTVKLVSESLARHIYGLRGRNIDVFADNSSLAISPHYIRSWLDLFSRTPRVAPFLQKND  463

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I+ALKKEL++HT DV VQ++VLDGMFTFYD+T S L++YQVASVTFDLL LL LGSYL
Sbjct  464  PFIVALKKELSEHTTDVHVQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYL  523

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLI+IFRRPPSRKVK A
Sbjct  524  IVLFSFLVITTRGLDDLINIFRRPPSRKVKGA  555



>ref|XP_008784054.1| PREDICTED: nicalin-like [Phoenix dactylifera]
Length=564

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            ++LV++SLA+H YGH+GKNI IFAD SSLA+NP YI +W+DLLS TPRVAPFLSK DP+I
Sbjct  416  IRLVSESLARHIYGHQGKNIQIFADNSSLALNPSYISAWLDLLSRTPRVAPFLSKTDPII  475

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             ALKKEL+DHT +V VQHE +DGMF+FYDST + L+IYQVASV FDLLLLL +G+YLI L
Sbjct  476  SALKKELSDHTVEVHVQHETIDGMFSFYDSTRATLNIYQVASVAFDLLLLLVVGAYLILL  535

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLV+TTRGLDDLI++FRRPPSRKVK A
Sbjct  536  FGFLVVTTRGLDDLINLFRRPPSRKVKAA  564



>ref|XP_010685410.1| PREDICTED: nicalin-1 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++G+KLVA+SLA H YGHE KNI IFA+ SSLA+NP Y+ SW+ LLS TPRVAPFL K D
Sbjct  409  LRGIKLVAESLAGHIYGHERKNIKIFAENSSLAVNPSYVASWLSLLSRTPRVAPFLPKTD  468

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I AL+KELA+HT +V+VQHE LDG+FTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  469  PFISALRKELAEHTTEVNVQHENLDGIFTFYDSTKATLNIYQVASVTFDLLLLLVLGSYL  528

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LF FLVITTRGLDDLIS+FR+PPSRK+KTA
Sbjct  529  IVLFSFLVITTRGLDDLISLFRKPPSRKMKTA  560



>ref|XP_002444854.1| hypothetical protein SORBIDRAFT_07g000320 [Sorghum bicolor]
 gb|EES14349.1| hypothetical protein SORBIDRAFT_07g000320 [Sorghum bicolor]
Length=553

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            V+LV++SLA+H YG +G+NI++FA+ SSLAINP YIRSW+DLLS TPRVAPFL KNDP I
Sbjct  405  VRLVSESLARHIYGLKGRNIDVFAENSSLAINPHYIRSWLDLLSRTPRVAPFLQKNDPFI  464

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             ALKKEL++HT DV +Q + LDGMFTFYD+T + L++YQVASVTFDLL LL LGSYLI L
Sbjct  465  SALKKELSEHTTDVHIQSDALDGMFTFYDATKATLNVYQVASVTFDLLFLLVLGSYLIVL  524

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            FCFLVITTRG+DDLI+IFRRPPSRK+K A
Sbjct  525  FCFLVITTRGVDDLINIFRRPPSRKLKGA  553



>gb|KEH29829.1| M28 Zn-peptidase nicastrin [Medicago truncatula]
Length=584

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 138/172 (80%), Gaps = 20/172 (12%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ VKL+A+SLAKH YGH+GKN+ IFAD S+LA+NP YIRSW+D+LS TPRVAPFLSK+D
Sbjct  413  VRSVKLIAESLAKHIYGHQGKNVQIFADNSNLAVNPSYIRSWLDVLSRTPRVAPFLSKDD  472

Query  595  PLIMALKK--------------------ELADHTADVSVQHEVLDGMFTFYDSTSSKLHI  476
            P I ALKK                    EL DHT +V++Q EVLDGMFTFYDST+++L+I
Sbjct  473  PFITALKKLEAFLLVSLVYSSKYFACLKELEDHTDEVNLQREVLDGMFTFYDSTTAQLNI  532

Query  475  YQVASVTFDlllllalgsylitLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            YQVASVTFDLLLLL LGSYLI LF FLVITTRGLDDLIS+FRRPPSRK+KTA
Sbjct  533  YQVASVTFDLLLLLVLGSYLIVLFSFLVITTRGLDDLISLFRRPPSRKMKTA  584



>ref|NP_001147070.1| Nicalin precursor [Zea mays]
 gb|ACF87501.1| unknown [Zea mays]
 gb|ACG25361.1| nicalin precursor [Zea mays]
 gb|AFW65053.1| nicalin [Zea mays]
Length=552

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG  G+NI++FA+ SSLAINP Y+RSW+DLLS TPRVAPFL KND
Sbjct  401  IRTVRLVSESLARHIYGLRGRNIDVFAENSSLAINPRYVRSWLDLLSRTPRVAPFLQKND  460

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HT+DV VQ + L+GMFTFYD+T + L++YQVASVTFDLL LL LGSYL
Sbjct  461  PFIAALKKELSEHTSDVHVQSDALEGMFTFYDTTKATLNVYQVASVTFDLLFLLVLGSYL  520

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVI+TRG+DDLI+IFRRPPSRK+K A
Sbjct  521  IVLFCFLVISTRGVDDLINIFRRPPSRKLKGA  552



>ref|XP_010931103.1| PREDICTED: nicalin-like isoform X1 [Elaeis guineensis]
Length=564

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + ++L+A+SLA+H YG++G+NI IFAD SSLA+NP Y++SW+DLLS TPRV PFLSK DP
Sbjct  414  RSIRLIAESLARHIYGYQGRNIQIFADNSSLAVNPSYVKSWLDLLSRTPRVGPFLSKTDP  473

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            +I ALKKEL+DHT +V +QHE++DGMF+FYDST + L+IYQVASV FDLLLLL LGSYLI
Sbjct  474  IISALKKELSDHTVEVHLQHEMIDGMFSFYDSTRATLYIYQVASVAFDLLLLLVLGSYLI  533

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLI++FRRPPSRKVK +
Sbjct  534  LLFSFLVITTRGLDDLINMFRRPPSRKVKAS  564



>gb|ACL54544.1| unknown [Zea mays]
Length=552

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG  G+NI++FA+ SSLAINP Y+RSW+DLLS TPRVAPFL KND
Sbjct  401  IRTVRLVSESLARHIYGLRGRNIDVFAENSSLAINPRYVRSWLDLLSRTPRVAPFLQKND  460

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I ALKKEL++HT+DV VQ + L+GMFTFYD+T + L++YQVASVTFDLL LL LGSYL
Sbjct  461  PFIAALKKELSEHTSDVHVQSDALEGMFTFYDTTKATLNVYQVASVTFDLLFLLVLGSYL  520

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVI+TRG+DDLI+IFRRPPSRK+K A
Sbjct  521  IVLFCFLVISTRGVDDLINIFRRPPSRKLKGA  552



>ref|XP_010234235.1| PREDICTED: nicalin [Brachypodium distachyon]
Length=555

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  766  VKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDPLI  587
            V+LV++SLA+H YG +G+NI++FA+ SSLA+NP YI+SW+DL S TPRVAPFL KNDP I
Sbjct  407  VRLVSESLARHIYGLKGRNIDVFAENSSLAVNPHYIKSWLDLFSRTPRVAPFLQKNDPFI  466

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
             ALKKEL++HTADV VQ +VLDGM TFYD+T S L++YQVASVTFDLL LL LGSYLI L
Sbjct  467  AALKKELSEHTADVHVQTDVLDGMLTFYDATKSTLNVYQVASVTFDLLFLLVLGSYLIVL  526

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLVITTRGLDDLI+IFRRPPSRKVK A
Sbjct  527  FSFLVITTRGLDDLINIFRRPPSRKVKGA  555



>ref|XP_008799665.1| PREDICTED: nicalin-like isoform X1 [Phoenix dactylifera]
Length=564

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + ++LVA+SLA+H YG++G+NI IFAD SSLA+NP Y++SW+DLLS TPRVAPFLSK DP
Sbjct  414  RSIRLVAESLARHIYGYQGRNIQIFADNSSLAVNPSYVKSWLDLLSRTPRVAPFLSKTDP  473

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            +I ALKKEL+DHT +V VQHE +DGMF+FYDST + L+IYQVASV FDLL LL LGSYLI
Sbjct  474  IISALKKELSDHTVEVHVQHETIDGMFSFYDSTRATLNIYQVASVAFDLLFLLVLGSYLI  533

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLI++FRRP  RKVK +
Sbjct  534  LLFSFLVITTRGLDDLINMFRRPTYRKVKAS  564



>gb|ACN25311.1| unknown [Zea mays]
 gb|AFW74196.1| nicalin [Zea mays]
Length=550

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+  +LV++SLA+  YG +G+NI++FA+ SSLAINP YIRSW+DLLS TPRVAPFL KND
Sbjct  399  IRAARLVSESLARRIYGLKGRNIDVFAENSSLAINPHYIRSWLDLLSRTPRVAPFLQKND  458

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I AL+KEL+ HT DV VQ + LDGMFTFYD+T + L++YQVA VTFDLL LL LGSYL
Sbjct  459  PFIAALEKELSAHTTDVRVQSDALDGMFTFYDATKATLNVYQVAGVTFDLLFLLVLGSYL  518

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVITTRG+DDLI+IFRRPPSRK+K A
Sbjct  519  IVLFCFLVITTRGVDDLINIFRRPPSRKLKGA  550



>ref|NP_001150971.1| LOC100284604 precursor [Zea mays]
 gb|ACG41111.1| nicalin precursor [Zea mays]
Length=550

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+  +LV++SLA+  YG +G+NI++FA+ SSLAINP YIRSW+DLLS TPRVAPFL KND
Sbjct  399  IRAARLVSESLARRIYGLKGRNIDVFAENSSLAINPHYIRSWLDLLSRTPRVAPFLQKND  458

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P I AL+KEL+ HT DV VQ + LDGMFTFYD+T + L++YQVA VTFDLL LL LGSYL
Sbjct  459  PFIAALEKELSAHTTDVHVQSDALDGMFTFYDATKATLNVYQVAGVTFDLLFLLVLGSYL  518

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            I LFCFLVITTRG+DDLI+IFRRPPSRK+K A
Sbjct  519  IVLFCFLVITTRGVDDLINIFRRPPSRKLKGA  550



>ref|XP_006362633.1| PREDICTED: nicalin-1-like isoform X1 [Solanum tuberosum]
Length=577

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 129/163 (79%), Gaps = 7/163 (4%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ +KLVA+SLA+H Y  E K+I+IFAD SSLA+NP YIRSW+DLLSTTPRVAPFLSKND
Sbjct  413  IRSIKLVAESLARHIYSQEKKSISIFADDSSLAVNPSYIRSWLDLLSTTPRVAPFLSKND  472

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PLI AL+KEL DHTA+V+VQHE LDG FTFYDSTS KLHIYQVASVTFDLLLLL LGSYL
Sbjct  473  PLIKALEKELTDHTAEVNVQHETLDGTFTFYDSTSGKLHIYQVASVTFDLLLLLVLGSYL  532

Query  415  itLFCFLVITTR-------GLDDLISIFRRPPSRKVKTA*LVK  308
            ITLF FL ITTR        LD LI +++     K +   L++
Sbjct  533  ITLFSFLFITTRVRILVSVTLDSLILVYQSNTKTKKRKCELIQ  575



>gb|KCW50875.1| hypothetical protein EUGRSUZ_J00522 [Eucalyptus grandis]
Length=563

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKLVA+SLA+H YGH+GKNI IFAD  SLA+NP YIRSW+DLLS TPRVAPFLSKND
Sbjct  408  IKSVKLVAESLARHIYGHQGKNIQIFADEGSLAVNPSYIRSWLDLLSQTPRVAPFLSKND  467

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P +MALKKEL +HT +V +Q+EVLDGMFTFYDST + L+IYQVASVTFDLLLLL LGSYL
Sbjct  468  PFVMALKKELEEHTEEVILQNEVLDGMFTFYDSTKATLNIYQVASVTFDLLLLLVLGSYL  527

Query  415  itLFCFLVITTR  380
            I LF FL+ITTR
Sbjct  528  IVLFSFLIITTR  539



>ref|XP_010102017.1| hypothetical protein L484_016307 [Morus notabilis]
 gb|EXB91237.1| hypothetical protein L484_016307 [Morus notabilis]
Length=766

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 5/148 (3%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ VKL+A+SL +H YGH+ K    FAD SSLA+NPFYIRSW+D LS TPRVAPF+SKND
Sbjct  409  IRSVKLIAESLVRHIYGHQEKETVTFADNSSLAVNPFYIRSWLDFLSRTPRVAPFMSKND  468

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            PL++AL+KEL +HT +VS+QHEVLDGMFTFYDS+ ++L+IYQVASVTFDLLLLL LGSYL
Sbjct  469  PLVLALQKELEEHTHEVSLQHEVLDGMFTFYDSSKARLNIYQVASVTFDLLLLLVLGSYL  528

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRK  332
            I LF FLVITTR +     +  RP  RK
Sbjct  529  IVLFSFLVITTRSM-----LLLRPTLRK  551



>ref|XP_001784134.1| predicted protein [Physcomitrella patens]
 gb|EDQ51058.1| predicted protein [Physcomitrella patens]
Length=554

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            ++ +K+VA+SLA+H YG +GK + +FA GS+LA+NP Y+RSW++LL  T RVAPFL KN 
Sbjct  403  LRNIKVVAESLARHIYGQQGKQVELFAAGSNLALNPSYVRSWLNLLGRTSRVAPFLGKNA  462

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P+I AL KEL+ HT D S+QHE LD  F FYDST ++L++YQVASVTFD ++ LA+GSYL
Sbjct  463  PIINALHKELSQHTKDASLQHETLDSTFLFYDSTKAQLNVYQVASVTFDFIVALAVGSYL  522

Query  415  itLFCFLVITTRGLDDLISIFRRPPSRKVKT  323
            + LF  L I+T+G+ D + IFR+ PSRK K+
Sbjct  523  MLLFIVLFISTKGVKDFVGIFRKAPSRKYKS  553



>ref|XP_010931104.1| PREDICTED: nicalin-like isoform X2 [Elaeis guineensis]
Length=534

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 107/151 (71%), Gaps = 30/151 (20%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + ++L+A+SLA+H YG++G+NI IFAD SSLA+NP Y++SW+DLLS TPRV PFLSK DP
Sbjct  414  RSIRLIAESLARHIYGYQGRNIQIFADNSSLAVNPSYVKSWLDLLSRTPRVGPFLSKTDP  473

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyli  413
            +I ALKKEL+DHT +V +QHE++DGMF+FYDST + L+IYQ                   
Sbjct  474  IISALKKELSDHTVEVHLQHEMIDGMFSFYDSTRATLYIYQ-------------------  514

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
                       GLDDLI++FRRPPSRKVK +
Sbjct  515  -----------GLDDLINMFRRPPSRKVKAS  534



>ref|XP_008799667.1| PREDICTED: nicalin-like isoform X2 [Phoenix dactylifera]
Length=519

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + ++LVA+SLA+H YG++G+NI IFAD SSLA+NP Y++SW+DLLS TPRVAPFLSK DP
Sbjct  414  RSIRLVAESLARHIYGYQGRNIQIFADNSSLAVNPSYVKSWLDLLSRTPRVAPFLSKTDP  473

Query  592  LIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQ  470
            +I ALKKEL+DHT +V VQHE +DGMF+FYDST + L+IYQ
Sbjct  474  IISALKKELSDHTVEVHVQHETIDGMFSFYDSTRATLNIYQ  514



>ref|XP_002977600.1| hypothetical protein SELMODRAFT_106865 [Selaginella moellendorffii]
 gb|EFJ21604.1| hypothetical protein SELMODRAFT_106865 [Selaginella moellendorffii]
Length=547

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I   KLVA+SLA++ Y  + K+I +FADGS+LA++  Y++ W++LLS TPR+APFLS+N 
Sbjct  398  ILSTKLVAESLARYIYDQQDKHITVFADGSNLAVSRSYVQGWLNLLSRTPRMAPFLSRNS  457

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P+I A  KELAD   DV +QHE +D  FTFYDST   L I+QVASVTFDL+++LA+GSYL
Sbjct  458  PIIAAFHKELADRIEDVKIQHETMDSSFTFYDSTKFVLSIFQVASVTFDLVVMLAVGSYL  517

Query  415  itLFCFLVITTRGLDDLISIFRRPP-SRKVK  326
              LF   ++TT+GLDDL   FR+PP SRK+K
Sbjct  518  GLLFVIALVTTKGLDDL---FRKPPSSRKIK  545



>ref|XP_002975196.1| hypothetical protein SELMODRAFT_102752 [Selaginella moellendorffii]
 gb|EFJ23981.1| hypothetical protein SELMODRAFT_102752 [Selaginella moellendorffii]
Length=555

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I   KLVA+SLA++ Y  + K+I +FADGS+LA++  Y++ W++LLS TPR+APFLS+N 
Sbjct  406  ILSTKLVAESLARYIYDQQDKHITVFADGSNLAVSRPYVQGWLNLLSRTPRMAPFLSRNS  465

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsyl  416
            P+I A  KELAD   DV +QHE +D  FTFYDST   L I+QVASVTFDL+++LA GSYL
Sbjct  466  PIIAAFHKELADRIEDVKIQHETMDSSFTFYDSTKFVLSIFQVASVTFDLVVMLAFGSYL  525

Query  415  itLFCFLVITTRGLDDLISIFRRPP-SRKVK  326
              LF   ++TT+GLDDL   FR+PP SRK+K
Sbjct  526  GLLFVIALVTTKGLDDL---FRKPPSSRKIK  553



>gb|AFW65051.1| hypothetical protein ZEAMMB73_261569, partial [Zea mays]
Length=517

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG  G+NI++FA+ SSLAINP Y+RSW+DLLS TPRVAPFL KND
Sbjct  401  IRTVRLVSESLARHIYGLRGRNIDVFAENSSLAINPRYVRSWLDLLSRTPRVAPFLQKND  460

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQV  467
            P I ALKKEL++HT+DV VQ + L+GMFTFYD+T + L++YQV
Sbjct  461  PFIAALKKELSEHTSDVHVQSDALEGMFTFYDTTKATLNVYQV  503



>gb|AFW65052.1| hypothetical protein ZEAMMB73_261569 [Zea mays]
Length=502

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ V+LV++SLA+H YG  G+NI++FA+ SSLAINP Y+RSW+DLLS TPRVAPFL KND
Sbjct  401  IRTVRLVSESLARHIYGLRGRNIDVFAENSSLAINPRYVRSWLDLLSRTPRVAPFLQKND  460

Query  595  PLIMALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQ  470
            P I ALKKEL++HT+DV VQ + L+GMFTFYD+T + L++YQ
Sbjct  461  PFIAALKKELSEHTSDVHVQSDALEGMFTFYDTTKATLNVYQ  502



>ref|XP_006592341.1| PREDICTED: nicalin-1-like [Glycine max]
Length=89

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -1

Query  586  MALKKELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitL  407
            MALKKEL DHT +V++  +VLDGMFTFYDST +KL+IYQVASVTFDLLLLL LGSYLI L
Sbjct  1    MALKKELEDHTDEVNLHRDVLDGMFTFYDSTRAKLNIYQVASVTFDLLLLLVLGSYLIVL  60

Query  406  FCFLVITTRGLDDLISIFRRPPSRKVKTA  320
            F FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  61   FSFLVITTRGLDDLISLFRRPPSRKVKTA  89



>gb|EMT04918.1| hypothetical protein F775_32982 [Aegilops tauschii]
Length=409

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = -1

Query  688  SSLAINPFYIRSWMDLLSTTPRV-APFLSKNDPLIMALKKELADHTADVSVQHEVLDGMF  512
            S L+  P ++ S   L  T   V    + +   L+  +  EL++HT DV VQ++VLDGMF
Sbjct  286  SELSTPPEFLESTGGLYDTRESVDVESVMRTVKLVSEILAELSEHTTDVHVQNDVLDGMF  345

Query  511  TFYDSTSSKLHIYQVASVTFDlllllalgsylitLFCFLVITTRGLDDLISIFRRPPSRK  332
            TFYD+T S L++YQVASVTFDLL LL LGSYLI LF FLVITTRGLDDLI+IFRRPPSRK
Sbjct  346  TFYDATKSTLNVYQVASVTFDLLFLLVLGSYLIVLFSFLVITTRGLDDLINIFRRPPSRK  405

Query  331  VKTA  320
            VK A
Sbjct  406  VKGA  409



>gb|EPS72783.1| hypothetical protein M569_01975, partial [Genlisea aurea]
Length=82

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  568  LADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitLFCFLVI  389
            L DHT++++VQ+EVLDG+FTFY STSS+LHIYQVASVTFDLLLLL LGSYLITLF FL+I
Sbjct  1    LGDHTSELNVQNEVLDGIFTFYGSTSSRLHIYQVASVTFDLLLLLVLGSYLITLFTFLII  60

Query  388  TTRGLDDLISIFRRPPSRKVKT  323
             TRG+DDLIS+FRRP SRKVK+
Sbjct  61   ITRGVDDLISLFRRPASRKVKS  82



>gb|EMS68245.1| Nicalin-1 [Triticum urartu]
Length=591

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -1

Query  571  ELADHTADVSVQHEVLDGMFTFYDSTSSKLHIYQVASVTFDlllllalgsylitLFCFLV  392
            EL++HT DV VQ++VLDGMFTFYD+T S L++YQVASVTFDLL LL LGSYLI LF FLV
Sbjct  508  ELSEHTTDVHVQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYLIVLFSFLV  567

Query  391  ITTRGLDDLISIFRRPPSRKVKTA  320
            ITTRGLDDLI+IFRRPPSRKVK A
Sbjct  568  ITTRGLDDLINIFRRPPSRKVKGA  591



>gb|EYU20529.1| hypothetical protein MIMGU_mgv1a005130mg [Erythranthe guttata]
Length=496

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VKLVA+SLA+H YG EGK+I+IFAD SSL+INP YIRSW+  LS TPRVAPFLSKNDP
Sbjct  416  RSVKLVAESLARHIYGQEGKSIDIFADDSSLSINPSYIRSWLQFLSATPRVAPFLSKNDP  475

Query  592  LIMALKK  572
            LI ALKK
Sbjct  476  LITALKK  482



>gb|EPS62126.1| hypothetical protein M569_12666, partial [Genlisea aurea]
Length=485

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            I+ +KLVA+SLA+  YG EGK I++FAD SSL++N F++RSW+  LS TPRVAPFL+K+D
Sbjct  414  IRTIKLVAESLARQIYGLEGKGIDVFADDSSLSVNVFHVRSWLKYLSATPRVAPFLAKDD  473

Query  595  PLIMALKK  572
            PLI ALKK
Sbjct  474  PLITALKK  481



>gb|KDO44364.1| hypothetical protein CISIN_1g0376012mg, partial [Citrus sinensis]
Length=100

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  673  NPFYIRSWMDLLSTTPRVAPFLSKNDPLIMALKKELAD  560
            NP YIRSW+DLLS TPRVAPF+SKNDP IMALKK L D
Sbjct  47   NPSYIRSWLDLLSQTPRVAPFISKNDPFIMALKKGLDD  84



>ref|XP_007015761.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 2 [Theobroma cacao]
 gb|EOY33380.1| Endoplasmic reticulum, plasma membrane, vacuole, EF-Hand 1, calcium-binding 
site, Nicastrin isoform 2 [Theobroma cacao]
Length=473

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 64/91 (70%), Gaps = 13/91 (14%)
 Frame = -1

Query  553  ADVSVQHEVLDGMFTFYDST----------SSKL---HIYQVASVTFDlllllalgsyli  413
            +++SV  ++L+G    +DS             KL    + QVASVTFDLLLLL LGSYLI
Sbjct  383  SELSVAPDILEGTGGLFDSRQFVNETAIIRGVKLVAESLAQVASVTFDLLLLLVLGSYLI  442

Query  412  tLFCFLVITTRGLDDLISIFRRPPSRKVKTA  320
             LF FLVITTRGLDDLIS+FRRPPSRKVKTA
Sbjct  443  VLFSFLVITTRGLDDLISLFRRPPSRKVKTA  473



>ref|XP_001626707.1| predicted protein [Nematostella vectensis]
 gb|EDO34607.1| predicted protein [Nematostella vectensis]
Length=563

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = -1

Query  766  VKLVAKSLAKHXYG--HEG--KNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKN  599
            +K +A++LA+H +   H+G  +N+ +F  G  L ++  +I++WMD L + PR A  + K+
Sbjct  413  IKFIAETLARHIFNLTHKGYPRNLEVFQAG--LEVDSEFIKTWMDYLGSQPRAAQLIQKD  470

Query  598  DPLIMALKKELADHTADV---SVQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
             P++  L+  L     DV   +++ +  D  F FYD   +K+  Y+V    FD
Sbjct  471  HPMLAGLETVLTKFVKDVKKITMKADKRDPEFVFYDQFEAKMSAYRVKPAIFD  523



>ref|XP_792553.3| PREDICTED: nicalin-1-like [Strongylocentrotus purpuratus]
Length=733

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VK++A++LA H +G     + +F DG    +N   I SW+  LS+ PR A  L+K++P
Sbjct  586  RNVKIIAETLAHHIFGIGSSEMEVFVDGYD--VNKDSIDSWIKYLSSEPRSAQLLTKDEP  643

Query  592  LIMALKKELADHTADV---SVQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
            L+  L+  L+ +  DV   +++ +  +  + FYD     +H Y++    FD
Sbjct  644  LLNTLQSALSRYLKDVKRLTIKADKREPEYVFYDGLKFTVHAYKLKPAVFD  694



>ref|XP_006822841.1| PREDICTED: nicalin-like [Saccoglossus kowalevskii]
Length=509

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 64/115 (56%), Gaps = 9/115 (8%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKN----INIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS  605
            + +K++A+S+A++ Y     N    I++F D +  A+N  ++ SWMD LS+ PR AP ++
Sbjct  357  RNIKIIAESIARYIYSINSVNQTDPIHVFTDAT--AVNREFVESWMDYLSSYPRAAPLMN  414

Query  604  KNDPLIMALKKELADHTADV---SVQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
            K+  L+  L+  ++ +  +V   +V+ +  D  F FYD     ++ Y V    FD
Sbjct  415  KDHHLLHTLEHTMSRYLKEVKRFNVKADKRDPEFVFYDGLMFTMYAYNVKPAVFD  469



>ref|XP_001604957.1| PREDICTED: nicalin-1 [Nasonia vitripennis]
Length=556

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (58%), Gaps = 14/111 (13%)
 Frame = -1

Query  760  LVAKSLAKHXYGHEGKNIN---IFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KNDP  593
            +VA++LA+H Y     NI+   IFA+   L+++   ++ WMD L++ PR AP L+ K++P
Sbjct  415  IVAEALARHMY-----NISYSQIFAE--PLSVSKDSLKMWMDFLASQPRSAPLLADKHNP  467

Query  592  LIMALKKELADHTADVSVQ---HEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
            L+  LK+ L  +  DV +     +  D  F FYD T + L++Y V    FD
Sbjct  468  LVNTLKEALQKYLGDVKMTLHTPDKRDPEFVFYDVTKASLNVYSVKPAVFD  518



>ref|XP_793964.2| PREDICTED: nicalin-1-like, partial [Strongylocentrotus purpuratus]
Length=215

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 5/103 (5%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VK++A++LA H +G     + +F DG    +N   I SW+  LS+ PR A  L+K++P
Sbjct  115  RNVKIIAETLAHHIFGIGSSEMEVFVDG--YDVNKDSIDSWIKYLSSEPRSAQLLTKDEP  172

Query  592  LIMALKKELADHTADV---SVQHEVLDGMFTFYDSTSSKLHIY  473
            L+  L+  L+ +  DV   +++ +  +  + FYD     +H Y
Sbjct  173  LLNTLQSALSRYLKDVKRLTIKADKREPEYVFYDGLKFTVHAY  215



>gb|KFM78747.1| Nicalin-1, partial [Stegodyphus mimosarum]
Length=563

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND-  596
            + VK++A+SLA+H Y   G+ ++      SL+I   Y+++W+D LS+  R A  LS    
Sbjct  410  RNVKIIAESLARHMYNISGETLSTGIFSESLSIKKEYLQAWIDQLSSQARSAQMLSSGSV  469

Query  595  --PLIMALKKELADHTADVS---VQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
              PLI +L++ ++ +  DV     + +  +    FY+   ++++ Y+V    FD
Sbjct  470  RHPLISSLEQAMSRYLKDVKFSIFKSDKREPELVFYEPVYTQMNAYRVKPAIFD  523



>gb|KDR11903.1| Nicalin [Zootermopsis nevadensis]
Length=556

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 61/112 (54%), Gaps = 8/112 (7%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KND  596
            +  +++A+ LA+H +      I      S++ +    +RSW+D L+T PR    LS KN+
Sbjct  409  ENTQILAEVLARHIFNLTTGEIF----SSTVGVKLDSLRSWLDFLATQPRSVQLLSEKNN  464

Query  595  PLIMALKKELADHTADVSVQHEVLDGM---FTFYDSTSSKLHIYQVASVTFD  449
            PL+++LK  ++ +  +V + +++ D     F  YD T + +++Y V    FD
Sbjct  465  PLVISLKDAMSRYLKEVKIIYQMPDKRDPEFVLYDVTKTVVNLYSVKPAIFD  516



>ref|XP_004353530.1| nicalin, putative, partial [Acanthamoeba castellanii str. Neff]
 gb|ELR24002.1| nicalin, putative, partial [Acanthamoeba castellanii str. Neff]
Length=296

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 64/128 (50%), Gaps = 23/128 (18%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + VK+V + LA++ Y   G       +GS  A++  ++RSW+  +++ PRV P+L+   P
Sbjct  131  RNVKVVGEGLARYVY-KLGNQSGAVLEGSH-AVHADFLRSWLATVASFPRVYPYLAPASP  188

Query  592  LIMALKKELADHTADVSVQHEVLDGMFT--------------------FYDSTSSKLHIY  473
            L  AL+K L D+ A+V+ Q +  DG  T                    FY   ++ L ++
Sbjct  189  LFGALEKALGDY-AEVTRQTQPWDGEVTPAAAADADVSRPASRASSVVFYQPATASLAVH  247

Query  472  QVASVTFD  449
            +V   TFD
Sbjct  248  KVKPGTFD  255



>gb|ELU15334.1| hypothetical protein CAPTEDRAFT_157684 [Capitella teleta]
Length=556

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (51%), Gaps = 12/116 (10%)
 Frame = -1

Query  775  IQGVKLVAKSLAKHXYG---HEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS  605
            +Q +++VA++LAKH +     EG  + +F+DG  L + P  + +W+  L++ PR    L 
Sbjct  403  VQNIQVVAEALAKHIFNLTSEEG--VELFSDG--LRVEPSLVSAWLSHLTSVPRAQQLLP  458

Query  604  KNDPLIMALKKELADHTADVSVQHEVL----DGMFTFYDSTSSKLHIYQVASVTFD  449
             + PL+ +L+   + H  +V  +H V+    D  F FY      +  Y V    FD
Sbjct  459  PSSPLLHSLEHAFSRHLKEVK-RHMVVADKRDPEFLFYSGQEYTMSAYSVKPAIFD  513



>ref|XP_002606253.1| hypothetical protein BRAFLDRAFT_84005 [Branchiostoma floridae]
 gb|EEN62263.1| hypothetical protein BRAFLDRAFT_84005 [Branchiostoma floridae]
Length=557

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 63/116 (54%), Gaps = 11/116 (9%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXY-----GHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFL  608
            + ++ +A++LA+H Y     GH+G ++ IF DG  L ++P  I +W++ ++  PR A  +
Sbjct  404  RNIRGLAEALARHIYNLTAKGHDG-SMEIFQDG--LNLHPKSIEAWLNSVTAQPRAAQLI  460

Query  607  SKNDPLIMALKKELADHTADV---SVQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
             K+  L+  +++ +  +  DV   + + +  D  F FY +  + ++ Y V    FD
Sbjct  461  GKDHTLLSTMEQAMNGYLKDVRRLTFKPDKRDPEFVFYSAMQTTMNAYNVKPAVFD  516



>ref|XP_011498906.1| PREDICTED: nicalin-1 [Ceratosolen solmsi marchali]
Length=555

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 14/111 (13%)
 Frame = -1

Query  760  LVAKSLAKHXYGHEGKNIN---IFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KNDP  593
            +VA++LA+H Y     NI+   IFA+  SL+I+   +  WM+ L++ PR    LS K + 
Sbjct  414  VVAEALARHIY-----NISYSKIFAE--SLSISKDSLNMWMNFLASQPRAGSLLSDKQNI  466

Query  592  LIMALKKELADHTADVSVQ---HEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
            L+  LK+ +  +  DV V     +  D  F FYD T + L++Y V    FD
Sbjct  467  LVNTLKEAMQKYLGDVKVTLHTPDKRDPEFVFYDVTKAMLNVYSVKPAVFD  517



>ref|XP_971811.1| PREDICTED: nicalin-1 [Tribolium castaneum]
 gb|EFA05879.1| hypothetical protein TcasGA2_TC008691 [Tribolium castaneum]
Length=552

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 8/112 (7%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KND  596
            Q  K++A++LA   Y      I     G SL ++  Y+ +W++ L++ PR    LS K++
Sbjct  406  QNTKVIAEALANFVYNTSLSEIF----GGSLDVDKSYLEAWINYLTSQPRATQLLSNKDN  461

Query  595  PLIMALKKELADHTADVSVQHEVLDGM---FTFYDSTSSKLHIYQVASVTFD  449
             L+  LK     +  DV V + V D     F FYD T   +++Y V    FD
Sbjct  462  ALVTFLKDNFNKYLRDVKVSYAVPDKRDPDFLFYDVTKGVVNVYGVKPAIFD  513



>ref|XP_006607466.1| PREDICTED: nicalin-1-like [Apis dorsata]
Length=555

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 8/109 (7%)
 Frame = -1

Query  763  KLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KNDPLI  587
            +++A++LA+H Y      I I    + L ++   +  W   L++ PR AP L+ KN+ L+
Sbjct  413  QVIAEALARHIYNLSSSQIFI----NPLDVSKESLSLWFSYLASQPRAAPLLADKNNILV  468

Query  586  MALKKELADHTADVSV---QHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
              L++ +A +  DV +     +  D  F FYD T + L++Y V    FD
Sbjct  469  NTLREAMARYLGDVKITFHSPDKQDPEFVFYDVTKAILNVYSVKPAVFD  517



>ref|XP_005090447.1| PREDICTED: nicalin-1-like isoform X1 [Aplysia californica]
 ref|XP_005090448.1| PREDICTED: nicalin-1-like isoform X2 [Aplysia californica]
Length=561

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGK-NINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKND  596
            +  ++VA++LA+  Y    + +  +F D  +L++    ++SW+D LS+ PR A  L  + 
Sbjct  410  RNTQIVAEALARQIYNLTSQGSFEMFTD--TLSVEEPVVQSWLDYLSSGPRAAQLLKSDS  467

Query  595  PLIMALKKELADHTADVS---VQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
             ++M L++ +  +  DV    ++ +  D  F FY  +   ++ Y V    FD
Sbjct  468  EMVMTLEQTMGRYLKDVRKTLIKADKRDPEFLFYSGSEYVMNAYNVKPAVFD  519



>ref|XP_394739.3| PREDICTED: nicalin-1 isoform X1 [Apis mellifera]
Length=555

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -1

Query  763  KLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KNDPLI  587
            +++A++LA+H Y      I I    + L ++   +  W   L++ PR AP L+ KN+ L+
Sbjct  413  QVIAEALARHMYNLSSSQIFI----NPLDVSKESLSLWFSYLASQPRAAPLLADKNNILV  468

Query  586  MALKKELADHTADVSV---QHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
              L++ +  +  DV +     +  D  F FYD T + L++Y V    FD
Sbjct  469  NTLREAMTRYLGDVKITFHSPDKQDPEFVFYDVTKAILNVYSVKPAVFD  517



>ref|XP_011064630.1| PREDICTED: nicalin [Acromyrmex echinatior]
Length=555

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 8/109 (7%)
 Frame = -1

Query  763  KLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLS-KNDPLI  587
            ++V+++LA+H Y      I  FA    L ++   +  W +  ++ PR A  L+ KN+ L+
Sbjct  413  QIVSEALARHIYNLSSSQI--FA--GPLDVSKESLSLWFNYFASQPRAASLLADKNNLLV  468

Query  586  MALKKELADHTADVSVQHEVLDGM---FTFYDSTSSKLHIYQVASVTFD  449
              LK+ +A +  DV V     D     F FYD T + L++Y V    FD
Sbjct  469  GTLKEAMARYLGDVKVTFHTPDKQDPEFVFYDVTKATLNVYSVKPAVFD  517



>ref|XP_009010054.1| hypothetical protein HELRODRAFT_71336 [Helobdella robusta]
 gb|ESO11566.1| hypothetical protein HELRODRAFT_71336 [Helobdella robusta]
Length=518

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (46%), Gaps = 5/111 (5%)
 Frame = -1

Query  772  QGVKLVAKSLAKHXYGHEGKNINIFADGSSLAINPFYIRSWMDLLSTTPRVAPFLSKNDP  593
            + ++++A  LA   +       +IF D   L++N   + SW++ +S+ PR A  L K+ P
Sbjct  390  RNIRIIADGLAGQIFNLSNPGSDIFVD--HLSVNKELVSSWLEHISSVPRSAQLLKKDSP  447

Query  592  LIMALKKELADHTADV---SVQHEVLDGMFTFYDSTSSKLHIYQVASVTFD  449
            LI   +   + H   V   + + +  +  F FY      L +Y V    FD
Sbjct  448  LISTFEGWFSKHLRSVKRHTFKADKREPEFVFYTGAEYSLGVYSVKPAVFD  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520