BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049H10

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008245603.1|  PREDICTED: ABC transporter G family member 11      273   8e-83   Prunus mume [ume]
gb|KDO56035.1|  hypothetical protein CISIN_1g005142mg                   259   4e-81   Citrus sinensis [apfelsine]
emb|CDP18516.1|  unnamed protein product                                266   9e-81   Coffea canephora [robusta coffee]
gb|KDO56033.1|  hypothetical protein CISIN_1g005142mg                   259   3e-79   Citrus sinensis [apfelsine]
ref|XP_006441509.1|  hypothetical protein CICLE_v10019080mg             262   1e-78   Citrus clementina [clementine]
gb|KDO56026.1|  hypothetical protein CISIN_1g005142mg                   261   3e-78   Citrus sinensis [apfelsine]
ref|XP_006478168.1|  PREDICTED: ABC transporter G family member 1...    261   3e-78   Citrus sinensis [apfelsine]
gb|KDO56025.1|  hypothetical protein CISIN_1g005142mg                   260   4e-78   Citrus sinensis [apfelsine]
gb|KJB30233.1|  hypothetical protein B456_005G134100                    253   2e-77   Gossypium raimondii
ref|XP_010069548.1|  PREDICTED: ABC transporter G family member 1...    257   6e-77   Eucalyptus grandis [rose gum]
gb|KHG12988.1|  ABC transporter G family member 11                      254   4e-76   Gossypium arboreum [tree cotton]
ref|XP_010687272.1|  PREDICTED: ABC transporter G family member 11      255   5e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|AAP80385.1|  ABC transporter                                         254   6e-76   Gossypium hirsutum [American cotton]
gb|KJB30234.1|  hypothetical protein B456_005G134100                    254   1e-75   Gossypium raimondii
gb|KJB30235.1|  hypothetical protein B456_005G134100                    254   1e-75   Gossypium raimondii
gb|KJB30230.1|  hypothetical protein B456_005G134100                    253   1e-75   Gossypium raimondii
ref|XP_007208437.1|  hypothetical protein PRUPE_ppa002298mg             247   3e-73   
ref|XP_006372283.1|  ABC transporter family protein                     245   2e-72   
gb|KDP46471.1|  hypothetical protein JCGZ_08443                         244   3e-72   Jatropha curcas
ref|XP_009781344.1|  PREDICTED: ABC transporter G family member 11      244   6e-72   Nicotiana sylvestris
ref|XP_009602146.1|  PREDICTED: ABC transporter G family member 11      244   8e-72   Nicotiana tomentosiformis
ref|XP_011046115.1|  PREDICTED: ABC transporter G family member 1...    243   8e-72   Populus euphratica
ref|XP_002525670.1|  ATP-binding cassette transporter, putative         243   2e-71   
ref|XP_011072099.1|  PREDICTED: ABC transporter G family member 11      241   4e-71   Sesamum indicum [beniseed]
ref|XP_002262619.1|  PREDICTED: ABC transporter G family member 11      241   5e-71   Vitis vinifera
ref|XP_006351519.1|  PREDICTED: ABC transporter G family member 1...    241   7e-71   Solanum tuberosum [potatoes]
ref|XP_006372653.1|  hypothetical protein POPTR_0017s03590g             240   8e-71   
ref|XP_004234313.1|  PREDICTED: ABC transporter G family member 1...    241   1e-70   Solanum lycopersicum
ref|XP_007037082.1|  White-brown complex protein 11                     240   1e-70   
ref|XP_011046113.1|  PREDICTED: ABC transporter G family member 1...    239   3e-70   Populus euphratica
ref|XP_011046116.1|  PREDICTED: ABC transporter G family member 1...    239   3e-70   Populus euphratica
emb|CAN69297.1|  hypothetical protein VITISV_006943                     239   3e-70   Vitis vinifera
ref|XP_004495240.1|  PREDICTED: ABC transporter G family member 1...    223   5e-70   Cicer arietinum [garbanzo]
gb|KGN64232.1|  hypothetical protein Csa_1G044820                       235   7e-70   Cucumis sativus [cucumbers]
ref|XP_007152500.1|  hypothetical protein PHAVU_004G135400g             236   4e-69   Phaseolus vulgaris [French bean]
ref|XP_003534067.1|  PREDICTED: ABC transporter G family member 1...    236   4e-69   Glycine max [soybeans]
ref|XP_003548275.1|  PREDICTED: ABC transporter G family member 1...    236   5e-69   Glycine max [soybeans]
ref|XP_004152433.1|  PREDICTED: ABC transporter G family member 1...    236   6e-69   Cucumis sativus [cucumbers]
gb|KJB08156.1|  hypothetical protein B456_001G068300                    232   7e-69   Gossypium raimondii
ref|XP_010537533.1|  PREDICTED: ABC transporter G family member 11      235   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_008370410.1|  PREDICTED: ABC transporter G family member 1...    235   1e-68   Malus domestica [apple tree]
ref|XP_008437286.1|  PREDICTED: ABC transporter G family member 11      234   2e-68   Cucumis melo [Oriental melon]
ref|XP_010037061.1|  PREDICTED: ABC transporter G family member 1...    233   7e-68   Eucalyptus grandis [rose gum]
gb|KJB08152.1|  hypothetical protein B456_001G068300                    233   8e-68   Gossypium raimondii
gb|KHG09028.1|  ABC transporter G family member 11                      231   3e-67   Gossypium arboreum [tree cotton]
ref|XP_004495239.1|  PREDICTED: ABC transporter G family member 1...    230   7e-67   
gb|EYU22324.1|  hypothetical protein MIMGU_mgv1a002042mg                230   9e-67   Erythranthe guttata [common monkey flower]
ref|XP_010274916.1|  PREDICTED: ABC transporter G family member 11      230   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009338224.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    229   2e-66   
ref|XP_004516742.1|  PREDICTED: ABC transporter G family member 1...    228   5e-66   Cicer arietinum [garbanzo]
ref|XP_008388513.1|  PREDICTED: ABC transporter G family member 11      228   5e-66   Malus domestica [apple tree]
ref|XP_004302267.1|  PREDICTED: ABC transporter G family member 11      224   2e-64   Fragaria vesca subsp. vesca
ref|XP_006848619.1|  hypothetical protein AMTR_s00171p00031180          223   3e-64   Amborella trichopoda
ref|XP_010476947.1|  PREDICTED: ABC transporter G family member 11      221   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010459397.1|  PREDICTED: ABC transporter G family member 1...    221   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010498161.1|  PREDICTED: ABC transporter G family member 1...    220   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006306902.1|  hypothetical protein CARUB_v10008462mg             220   4e-63   Capsella rubella
gb|AAF97264.1|AC034106_7  Contains similarity to ATP dependent tr...    218   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KEH26658.1|  white-brown-complex ABC transporter family protei...    218   2e-62   Medicago truncatula
gb|AAY28856.1|  white-brown complex protein 11                          218   2e-62   Arabidopsis halleri subsp. gemmifera
ref|NP_173226.2|  ABC transporter G family member 11                    218   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890251.1|  abc transporter family protein                     216   9e-62   
emb|CDY26211.1|  BnaA06g12060D                                          216   9e-62   Brassica napus [oilseed rape]
gb|KFK42295.1|  hypothetical protein AALP_AA2G237200                    216   2e-61   Arabis alpina [alpine rockcress]
gb|EPS70875.1|  hypothetical protein M569_03882                         215   2e-61   Genlisea aurea
ref|XP_009149237.1|  PREDICTED: ABC transporter G family member 11      215   4e-61   Brassica rapa
emb|CDY19179.1|  BnaC05g13800D                                          213   8e-61   Brassica napus [oilseed rape]
ref|XP_006661900.1|  PREDICTED: ABC transporter G family member 1...    213   8e-61   
ref|XP_010918473.1|  PREDICTED: ABC transporter G family member 1...    214   1e-60   Elaeis guineensis
ref|XP_006416662.1|  hypothetical protein EUTSA_v10006960mg             213   2e-60   Eutrema salsugineum [saltwater cress]
emb|CDX96749.1|  BnaA08g22920D                                          212   3e-60   
ref|XP_003574118.1|  PREDICTED: ABC transporter G family member 1...    212   3e-60   Brachypodium distachyon [annual false brome]
emb|CDX83888.1|  BnaC08g17570D                                          212   3e-60   
ref|XP_009110383.1|  PREDICTED: ABC transporter G family member 1...    212   4e-60   Brassica rapa
ref|XP_008806677.1|  PREDICTED: ABC transporter G family member 1...    211   6e-60   
ref|XP_009400415.1|  PREDICTED: ABC transporter G family member 1...    210   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933304.1|  PREDICTED: ABC transporter G family member 1...    209   3e-59   Elaeis guineensis
dbj|BAJ88522.1|  predicted protein                                      209   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001064944.1|  Os10g0494300                                       207   3e-58   
ref|XP_010322516.1|  PREDICTED: ABC transporter G family member 1...    206   4e-58   Solanum lycopersicum
ref|XP_009401807.1|  PREDICTED: ABC transporter G family member 1...    206   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY79050.1|  hypothetical protein OsI_34160                          205   2e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_008776721.1|  PREDICTED: ABC transporter G family member 1...    203   4e-57   
ref|XP_011018196.1|  PREDICTED: ABC transporter G family member 1...    202   8e-57   Populus euphratica
gb|EEE51200.1|  hypothetical protein OsJ_32013                          202   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|KJB08154.1|  hypothetical protein B456_001G068300                    201   2e-56   Gossypium raimondii
ref|XP_006347487.1|  PREDICTED: ABC transporter G family member 1...    200   5e-56   Solanum tuberosum [potatoes]
ref|XP_004982746.1|  PREDICTED: ABC transporter G family member 1...    195   5e-54   Setaria italica
tpg|DAA36731.1|  TPA: hypothetical protein ZEAMMB73_733981              191   2e-53   
ref|XP_004976309.1|  PREDICTED: ABC transporter G family member 1...    193   3e-53   Setaria italica
ref|XP_002467016.1|  hypothetical protein SORBIDRAFT_01g018360          191   6e-53   
ref|NP_001147877.1|  LOC100281487                                       191   1e-52   Zea mays [maize]
tpg|DAA36732.1|  TPA: ABC transporter C05D10.3 in III                   192   1e-52   
ref|XP_002446827.1|  hypothetical protein SORBIDRAFT_06g023280          190   3e-52   Sorghum bicolor [broomcorn]
ref|XP_004495238.1|  PREDICTED: ABC transporter G family member 1...    176   3e-52   Cicer arietinum [garbanzo]
ref|XP_008664814.1|  PREDICTED: ABC transporter G family member 1...    188   1e-51   Zea mays [maize]
gb|EAZ31411.1|  hypothetical protein OsJ_15543                          187   2e-51   Oryza sativa Japonica Group [Japonica rice]
emb|CBG76424.1|  OO_Ba0013J05-OO_Ba0033A15.11                           187   2e-51   Oryza officinalis
ref|XP_010240161.1|  PREDICTED: ABC transporter G family member 1...    187   2e-51   
emb|CAD41191.1|  OSJNBa0074L08.3                                        187   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053375.1|  Os04g0528300                                       187   2e-51   
ref|XP_003580184.1|  PREDICTED: ABC transporter G family member 1...    187   3e-51   Brachypodium distachyon [annual false brome]
gb|EMT16398.1|  ABC transporter G family member 11                      187   5e-51   
gb|EMS54433.1|  ABC transporter G family member 11                      185   5e-51   Triticum urartu
ref|XP_006652549.1|  PREDICTED: ABC transporter G family member 1...    186   6e-51   Oryza brachyantha
dbj|BAJ91212.1|  predicted protein                                      186   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA49491.1|  TPA: hypothetical protein ZEAMMB73_694244              185   2e-50   
gb|AFW68511.1|  hypothetical protein ZEAMMB73_737572                    172   9e-49   
ref|XP_006347488.1|  PREDICTED: ABC transporter G family member 1...    176   3e-47   
ref|XP_004242154.2|  PREDICTED: ABC transporter G family member 1...    175   5e-47   
ref|NP_001147125.1|  ATP-binding cassette sub-family G member 2         173   4e-46   
gb|AFW68510.1|  ATP-binding cassette sub-family G member 2              173   4e-46   
ref|XP_002987629.1|  hypothetical protein SELMODRAFT_183315             167   4e-44   
ref|XP_002983318.1|  ATP-binding cassette transporter                   166   8e-44   
ref|XP_002970205.1|  ATP-binding cassette transporter                   164   5e-43   
ref|XP_010933306.1|  PREDICTED: ABC transporter G family member 1...    163   6e-43   
ref|XP_002978369.1|  hypothetical protein SELMODRAFT_443862             164   7e-43   
ref|XP_002968809.1|  ATP-binding cassette transporter                   159   3e-41   Selaginella moellendorffii
ref|XP_002963935.1|  ATP-binding cassette transporter                   144   4e-36   
ref|XP_002967985.1|  ATP-binding cassette transporter                   145   4e-36   
gb|ACN27163.1|  unknown                                                 120   1e-35   Zea mays [maize]
ref|XP_010647365.1|  PREDICTED: ABC transporter G family member 1...    137   2e-35   Vitis vinifera
gb|KJB08155.1|  hypothetical protein B456_001G068300                    142   2e-35   Gossypium raimondii
emb|CBI18824.3|  unnamed protein product                                136   4e-34   Vitis vinifera
ref|XP_010647257.1|  PREDICTED: ABC transporter G family member 1...    136   2e-33   Vitis vinifera
ref|XP_002267117.3|  PREDICTED: ABC transporter G family member 1...    137   2e-33   
emb|CBI25872.3|  unnamed protein product                                136   2e-33   Vitis vinifera
ref|XP_010106269.1|  ABC transporter G family member 11                 136   3e-33   
gb|KCW54565.1|  hypothetical protein EUGRSUZ_I00524                     134   7e-33   Eucalyptus grandis [rose gum]
ref|XP_003635438.1|  PREDICTED: ABC transporter G family member 1...    136   9e-33   Vitis vinifera
ref|XP_007047884.1|  White-brown complex protein 11 isoform 3           134   1e-32   
emb|CBI35723.3|  unnamed protein product                                135   2e-32   Vitis vinifera
ref|XP_006837421.1|  hypothetical protein AMTR_s00107p00013610          134   3e-32   Amborella trichopoda
ref|XP_007047881.1|  White-brown complex protein 11                     132   3e-32   
ref|XP_004288174.1|  PREDICTED: ABC transporter G family member 1...    134   5e-32   Fragaria vesca subsp. vesca
ref|XP_010652672.1|  PREDICTED: ABC transporter G family member 1...    132   5e-32   
emb|CBI33134.3|  unnamed protein product                                132   7e-32   Vitis vinifera
ref|XP_007047885.1|  White-brown complex protein 11 isoform 4           133   7e-32   
emb|CAN81791.1|  hypothetical protein VITISV_020569                     134   8e-32   Vitis vinifera
ref|XP_007047882.1|  White-brown complex protein 11 isoform 1           133   8e-32   
ref|XP_006426351.1|  hypothetical protein CICLE_v10025117mg             132   8e-32   
ref|XP_010030453.1|  PREDICTED: ABC transporter G family member 1...    132   8e-32   Eucalyptus grandis [rose gum]
ref|XP_003608431.1|  White-brown-complex ABC transporter family         132   9e-32   Medicago truncatula
gb|KCW54564.1|  hypothetical protein EUGRSUZ_I00523                     132   1e-31   Eucalyptus grandis [rose gum]
ref|XP_008385742.1|  PREDICTED: ABC transporter G family member 1...    132   1e-31   
gb|KCW54566.1|  hypothetical protein EUGRSUZ_I00526                     131   2e-31   Eucalyptus grandis [rose gum]
ref|XP_010939685.1|  PREDICTED: ABC transporter G family member 1...    132   2e-31   Elaeis guineensis
ref|XP_006466253.1|  PREDICTED: ABC transporter G family member 1...    132   2e-31   Citrus sinensis [apfelsine]
ref|XP_010321482.1|  PREDICTED: ABC transporter G family member 1...    130   2e-31   Solanum lycopersicum
ref|XP_010030452.1|  PREDICTED: ABC transporter G family member 1...    131   3e-31   Eucalyptus grandis [rose gum]
ref|XP_010267240.1|  PREDICTED: ABC transporter G family member 1...    131   3e-31   Nelumbo nucifera [Indian lotus]
gb|EPS62736.1|  hypothetical protein M569_12052                         130   4e-31   Genlisea aurea
ref|XP_010030454.1|  PREDICTED: ABC transporter G family member 1...    131   5e-31   Eucalyptus grandis [rose gum]
ref|XP_006366225.1|  PREDICTED: ABC transporter G family member 1...    131   5e-31   Solanum tuberosum [potatoes]
ref|XP_006856991.1|  hypothetical protein AMTR_s00325p00013820          122   6e-31   
ref|XP_006387838.1|  hypothetical protein POPTR_0530s002102g            127   7e-31   
ref|XP_008790946.1|  PREDICTED: ABC transporter G family member 1...    130   7e-31   Phoenix dactylifera
ref|XP_010267226.1|  PREDICTED: ABC transporter G family member 1...    130   9e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006366235.1|  PREDICTED: ABC transporter G family member 1...    129   1e-30   Solanum tuberosum [potatoes]
ref|XP_008381985.1|  PREDICTED: ABC transporter G family member 1...    130   1e-30   
ref|XP_007214812.1|  hypothetical protein PRUPE_ppa002358m1g            128   1e-30   
ref|XP_006426350.1|  hypothetical protein CICLE_v10025064mg             129   2e-30   Citrus clementina [clementine]
ref|XP_006387247.1|  hypothetical protein POPTR_1429s00210g             121   2e-30   
ref|XP_002306299.2|  hypothetical protein POPTR_0005s07420g             129   2e-30   
ref|XP_010937387.1|  PREDICTED: ABC transporter G family member 1...    129   2e-30   Elaeis guineensis
ref|XP_011031060.1|  PREDICTED: ABC transporter G family member 1...    129   3e-30   Populus euphratica
ref|XP_004288175.1|  PREDICTED: ABC transporter G family member 1...    129   3e-30   Fragaria vesca subsp. vesca
ref|XP_006827842.1|  hypothetical protein AMTR_s00008p00021210          129   3e-30   
ref|XP_007211388.1|  hypothetical protein PRUPE_ppa003183mg             127   3e-30   
gb|ABR25920.1|  cer5                                                    121   4e-30   Oryza sativa Indica Group [Indian rice]
gb|EYU23962.1|  hypothetical protein MIMGU_mgv1a002102mg                128   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_009350583.1|  PREDICTED: ABC transporter G family member 1...    128   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_009366090.1|  PREDICTED: ABC transporter G family member 1...    128   5e-30   Pyrus x bretschneideri [bai li]
ref|XP_009760682.1|  PREDICTED: ABC transporter G family member 1...    128   6e-30   Nicotiana sylvestris
gb|KCW51153.1|  hypothetical protein EUGRSUZ_J00746                     127   6e-30   Eucalyptus grandis [rose gum]
ref|XP_007207212.1|  hypothetical protein PRUPE_ppa001905mg             127   8e-30   
ref|XP_008790912.1|  PREDICTED: ABC transporter G family member 1...    127   8e-30   
ref|XP_008810494.1|  PREDICTED: ABC transporter G family member 1...    125   8e-30   Phoenix dactylifera
ref|XP_010031767.1|  PREDICTED: ABC transporter G family member 1...    127   9e-30   Eucalyptus grandis [rose gum]
ref|XP_004250920.1|  PREDICTED: ABC transporter G family member 1...    127   1e-29   Solanum lycopersicum
ref|XP_008791489.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    127   1e-29   Phoenix dactylifera
ref|XP_001782684.1|  ATP-binding cassette transporter, subfamily ...    127   1e-29   
ref|XP_009803747.1|  PREDICTED: ABC transporter G family member 1...    126   1e-29   Nicotiana sylvestris
dbj|BAL46500.1|  ABC transporter                                        127   1e-29   Diospyros kaki [Japanese persimmon]
dbj|BAJ94888.1|  predicted protein                                      127   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010269756.1|  PREDICTED: ABC transporter G family member 1...    127   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_002460384.1|  hypothetical protein SORBIDRAFT_02g027350          127   1e-29   
ref|XP_008227333.1|  PREDICTED: ABC transporter G family member 1...    126   2e-29   Prunus mume [ume]
ref|XP_002513520.1|  ATP-binding cassette transporter, putative         126   2e-29   Ricinus communis
ref|XP_009387386.1|  PREDICTED: ABC transporter G family member 1...    126   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS66360.1|  hypothetical protein M569_08416                         123   2e-29   Genlisea aurea
ref|XP_009803746.1|  PREDICTED: ABC transporter G family member 1...    126   2e-29   Nicotiana sylvestris
ref|XP_002531674.1|  ATP-binding cassette transporter, putative         126   2e-29   Ricinus communis
ref|XP_009610304.1|  PREDICTED: ABC transporter G family member 1...    125   2e-29   Nicotiana tomentosiformis
ref|XP_002525837.1|  ATP-binding cassette transporter, putative         126   2e-29   
ref|XP_006365197.1|  PREDICTED: ABC transporter G family member 1...    125   3e-29   Solanum tuberosum [potatoes]
emb|CDP09283.1|  unnamed protein product                                125   3e-29   Coffea canephora [robusta coffee]
ref|XP_002314084.1|  ABC transporter-related family protein             125   4e-29   
ref|XP_004955969.1|  PREDICTED: ABC transporter G family member 1...    125   4e-29   Setaria italica
gb|KDP40917.1|  hypothetical protein JCGZ_24916                         125   4e-29   Jatropha curcas
ref|XP_007015111.1|  ABC-2 type transporter family protein isoform 1    125   4e-29   
ref|XP_009610303.1|  PREDICTED: ABC transporter G family member 1...    125   4e-29   Nicotiana tomentosiformis
gb|KDP29717.1|  hypothetical protein JCGZ_18652                         125   4e-29   Jatropha curcas
ref|XP_010937388.1|  PREDICTED: ABC transporter G family member 1...    125   5e-29   
gb|EEC81874.1|  hypothetical protein OsI_25665                          125   5e-29   Oryza sativa Indica Group [Indian rice]
gb|EYU23963.1|  hypothetical protein MIMGU_mgv1a018782mg                125   5e-29   Erythranthe guttata [common monkey flower]
ref|XP_002270573.2|  PREDICTED: ABC transporter G family member 11      125   5e-29   Vitis vinifera
ref|XP_008375841.1|  PREDICTED: ABC transporter G family member 1...    125   6e-29   
ref|XP_002969857.1|  ATP-binding cassette transporter                   125   6e-29   
ref|XP_004957093.1|  PREDICTED: ABC transporter G family member 1...    125   6e-29   Setaria italica
ref|XP_009387395.1|  PREDICTED: ABC transporter G family member 1...    124   6e-29   
ref|XP_002985191.1|  hypothetical protein SELMODRAFT_122027             125   7e-29   
gb|KDP22115.1|  hypothetical protein JCGZ_25946                         125   7e-29   Jatropha curcas
ref|NP_001059389.1|  Os07g0288700                                       125   8e-29   
ref|XP_009374924.1|  PREDICTED: ABC transporter G family member 1...    124   8e-29   Pyrus x bretschneideri [bai li]
ref|XP_001775949.1|  ATP-binding cassette transporter, subfamily ...    124   9e-29   
ref|XP_003607356.1|  ABC transporter G family member                    124   9e-29   
gb|EEE66985.1|  hypothetical protein OsJ_23879                          122   9e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010273011.1|  PREDICTED: ABC transporter G family member 1...    124   1e-28   Nelumbo nucifera [Indian lotus]
gb|AES89553.2|  white-brown-complex ABC transporter family protein      124   1e-28   Medicago truncatula
ref|XP_011032054.1|  PREDICTED: ABC transporter G family member 1...    124   1e-28   Populus euphratica
ref|XP_008227201.1|  PREDICTED: ABC transporter G family member 1...    124   2e-28   Prunus mume [ume]
ref|XP_009393641.1|  PREDICTED: ABC transporter G family member 1...    122   2e-28   
ref|XP_006664909.1|  PREDICTED: ABC transporter G family member 1...    123   2e-28   Oryza brachyantha
emb|CAN82969.1|  hypothetical protein VITISV_013416                     123   2e-28   Vitis vinifera
emb|CBI17178.3|  unnamed protein product                                125   2e-28   Vitis vinifera
ref|XP_010680511.1|  PREDICTED: ABC transporter G family member 1...    123   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006827836.1|  hypothetical protein AMTR_s00008p00012240          118   3e-28   
ref|XP_011090129.1|  PREDICTED: ABC transporter G family member 1...    123   3e-28   Sesamum indicum [beniseed]
ref|XP_006830158.1|  hypothetical protein AMTR_s03052p00000290          119   3e-28   
gb|KJB44130.1|  hypothetical protein B456_007G236200                    122   3e-28   Gossypium raimondii
gb|ACN27668.1|  unknown                                                 120   4e-28   Zea mays [maize]
emb|CBI17179.3|  unnamed protein product                                122   4e-28   Vitis vinifera
gb|EEE50616.1|  hypothetical protein OsJ_30813                          120   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77419.1|  hypothetical protein OsI_16198                          120   6e-28   Oryza sativa Indica Group [Indian rice]
gb|KJB44129.1|  hypothetical protein B456_007G236200                    122   6e-28   Gossypium raimondii
ref|XP_002300189.2|  hypothetical protein POPTR_0001s31880g             122   6e-28   Populus trichocarpa [western balsam poplar]
gb|KJB44128.1|  hypothetical protein B456_007G236200                    122   7e-28   Gossypium raimondii
gb|EMS61063.1|  ABC transporter G family member 11                      122   7e-28   Triticum urartu
ref|XP_002274109.2|  PREDICTED: ABC transporter G family member 15      122   8e-28   Vitis vinifera
gb|AFW82087.1|  hypothetical protein ZEAMMB73_028139                    119   8e-28   
ref|XP_002298391.1|  ABC transporter-related family protein             121   8e-28   
gb|ABG65929.1|  ABC-2 type transporter family protein                   120   8e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006856990.1|  hypothetical protein AMTR_s00325p00013080          114   9e-28   
ref|XP_009405050.1|  PREDICTED: ABC transporter G family member 1...    121   9e-28   
ref|XP_010937486.1|  PREDICTED: ABC transporter G family member 1...    120   1e-27   
ref|XP_009763606.1|  PREDICTED: ABC transporter G family member 1...    121   1e-27   Nicotiana sylvestris
ref|XP_003578275.1|  PREDICTED: ABC transporter G family member 1...    121   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_011003862.1|  PREDICTED: ABC transporter G family member 1...    121   1e-27   Populus euphratica
ref|XP_002300188.2|  hypothetical protein POPTR_0001s31890g             120   1e-27   
gb|EMS51673.1|  ABC transporter G family member 15                      121   1e-27   Triticum urartu
ref|XP_008363334.1|  PREDICTED: ABC transporter G family member 1...    121   1e-27   
gb|EEE62790.1|  hypothetical protein OsJ_17593                          121   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054952.1|  Os05g0222200                                       121   1e-27   
ref|XP_010908351.1|  PREDICTED: ABC transporter G family member 1...    120   2e-27   
ref|XP_006661036.1|  PREDICTED: ABC transporter G family member 1...    119   2e-27   Oryza brachyantha
ref|XP_004504817.1|  PREDICTED: ABC transporter G family member 1...    120   2e-27   Cicer arietinum [garbanzo]
emb|CDY18337.1|  BnaC09g30870D                                          116   2e-27   Brassica napus [oilseed rape]
ref|XP_011045408.1|  PREDICTED: ABC transporter G family member 1...    120   2e-27   Populus euphratica
emb|CDP20625.1|  unnamed protein product                                119   2e-27   Coffea canephora [robusta coffee]
ref|XP_008652262.1|  PREDICTED: ABC transporter G family member 1...    120   2e-27   Zea mays [maize]
ref|XP_010102372.1|  ABC transporter G family member 15                 120   2e-27   Morus notabilis
ref|XP_008652263.1|  PREDICTED: ABC transporter G family member 1...    120   2e-27   Zea mays [maize]
ref|XP_002274038.1|  PREDICTED: ABC transporter G family member 15      120   2e-27   Vitis vinifera
tpg|DAA60273.1|  TPA: hypothetical protein ZEAMMB73_786491              120   3e-27   
ref|NP_001062608.1|  Os09g0125900                                       119   3e-27   
emb|CAN77224.1|  hypothetical protein VITISV_002210                     120   3e-27   Vitis vinifera
ref|XP_002525834.1|  ATP-binding cassette transporter, putative         118   3e-27   
ref|XP_003568727.1|  PREDICTED: ABC transporter G family member 1...    120   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_007159122.1|  hypothetical protein PHAVU_002G210500g             119   4e-27   Phaseolus vulgaris [French bean]
ref|XP_004960643.1|  PREDICTED: ABC transporter G family member 1...    120   4e-27   Setaria italica
gb|AFW82088.1|  CER5                                                    119   4e-27   
ref|NP_001147301.1|  LOC100280909                                       119   4e-27   Zea mays [maize]
ref|XP_011465373.1|  PREDICTED: ABC transporter G family member 1...    120   4e-27   Fragaria vesca subsp. vesca
gb|KHN26508.1|  ABC transporter G family member 11                      119   5e-27   Glycine soja [wild soybean]
ref|XP_011080436.1|  PREDICTED: ABC transporter G family member 1...    119   5e-27   
ref|XP_003532607.1|  PREDICTED: ABC transporter G family member 1...    119   5e-27   Glycine max [soybeans]
gb|EYU31390.1|  hypothetical protein MIMGU_mgv1a002406mg                119   5e-27   Erythranthe guttata [common monkey flower]
gb|KJB55392.1|  hypothetical protein B456_009G073800                    118   6e-27   Gossypium raimondii
ref|XP_009381814.1|  PREDICTED: ABC transporter G family member 1...    117   6e-27   
ref|XP_010269761.1|  PREDICTED: ABC transporter G family member 1...    119   6e-27   
gb|KFK39417.1|  hypothetical protein AALP_AA3G242100                    119   6e-27   
ref|XP_006593746.1|  PREDICTED: ABC transporter G family member 1...    119   7e-27   
ref|XP_003543926.1|  PREDICTED: ABC transporter G family member 1...    119   7e-27   
ref|XP_002885419.1|  abc transporter family protein                     119   9e-27   
ref|XP_002459718.1|  hypothetical protein SORBIDRAFT_02g009310          118   9e-27   
ref|XP_003608435.1|  White-brown-complex ABC transporter family         119   1e-26   
gb|KDO61202.1|  hypothetical protein CISIN_1g045930mg                   118   1e-26   
gb|EAZ43810.1|  hypothetical protein OsJ_28429                          119   1e-26   
gb|EAZ45082.1|  hypothetical protein OsJ_29720                          119   1e-26   
ref|XP_006470649.1|  PREDICTED: ABC transporter G family member 1...    118   1e-26   
gb|EEC84114.1|  hypothetical protein OsI_30441                          119   1e-26   
gb|EEC84739.1|  hypothetical protein OsI_31728                          119   1e-26   
ref|NP_001063446.1|  Os09g0472100                                       119   1e-26   
dbj|BAJ96411.1|  predicted protein                                      118   1e-26   
ref|XP_002440818.1|  hypothetical protein SORBIDRAFT_09g007330          118   1e-26   
ref|NP_001063447.1|  Os09g0472200                                       118   1e-26   
gb|EAZ09459.1|  hypothetical protein OsI_31729                          118   1e-26   
ref|XP_010466325.1|  PREDICTED: ABC transporter G family member 15      118   1e-26   
ref|XP_010488094.1|  PREDICTED: ABC transporter G family member 1...    118   1e-26   
gb|AAM13053.1|  unknown protein                                         118   1e-26   
ref|NP_188746.2|  ABC transporter G family member 15                    118   1e-26   
gb|KJB55390.1|  hypothetical protein B456_009G073800                    118   1e-26   
ref|XP_011045407.1|  PREDICTED: ABC transporter G family member 1...    118   1e-26   
ref|XP_011043109.1|  PREDICTED: ABC transporter G family member 1...    118   1e-26   
ref|XP_006297105.1|  hypothetical protein CARUB_v10013106mg             118   2e-26   
ref|XP_002270647.1|  PREDICTED: ABC transporter G family member 11      118   2e-26   
gb|KHG29858.1|  ABC transporter G family member 15                      118   2e-26   
ref|XP_011097541.1|  PREDICTED: ABC transporter G family member 1...    118   2e-26   
gb|EYU46234.1|  hypothetical protein MIMGU_mgv1a002325mg                117   2e-26   
dbj|BAJ95256.1|  predicted protein                                      117   2e-26   
ref|XP_010509664.1|  PREDICTED: ABC transporter G family member 1...    117   2e-26   
ref|XP_004291764.1|  PREDICTED: ABC transporter G family member 1...    117   2e-26   
ref|XP_006657617.1|  PREDICTED: ABC transporter G family member 1...    117   2e-26   
gb|KHN26505.1|  ABC transporter G family member 11                      117   2e-26   
gb|KHN28203.1|  ABC transporter G family member 11                      117   2e-26   
ref|XP_010690527.1|  PREDICTED: ABC transporter G family member 1...    117   3e-26   
ref|XP_006373046.1|  hypothetical protein POPTR_0017s07820g             117   3e-26   
ref|XP_006661337.1|  PREDICTED: ABC transporter G family member 1...    117   3e-26   
ref|XP_006423801.1|  hypothetical protein CICLE_v10030099mg             112   3e-26   
ref|XP_009610194.1|  PREDICTED: ABC transporter G family member 1...    117   3e-26   
ref|XP_009374925.1|  PREDICTED: ABC transporter G family member 1...    117   3e-26   
emb|CDY61513.1|  BnaAnng17530D                                          117   3e-26   
gb|KDO36457.1|  hypothetical protein CISIN_1g016275mg                   112   3e-26   
gb|KDO36064.1|  hypothetical protein CISIN_1g016271mg                   114   3e-26   
gb|AIU41649.1|  ABC transporter family protein                          117   3e-26   
gb|ABW96353.1|  CER5-like protein                                       117   4e-26   
ref|XP_006406322.1|  hypothetical protein EUTSA_v10020189mg             117   4e-26   
gb|EMS52296.1|  ABC transporter G family member 15                      116   4e-26   
ref|XP_010102371.1|  ABC transporter G family member 15                 117   4e-26   
gb|EMT30660.1|  ABC transporter G family member 15                      117   4e-26   
ref|XP_009145524.1|  PREDICTED: ABC transporter G family member 15      116   5e-26   
emb|CDY06406.1|  BnaC05g31240D                                          116   5e-26   
ref|XP_011097542.1|  PREDICTED: ABC transporter G family member 1...    116   5e-26   
ref|XP_003532610.1|  PREDICTED: ABC transporter G family member 1...    116   5e-26   
ref|XP_006665061.1|  PREDICTED: ABC transporter G family member 1...    115   5e-26   
ref|XP_011090130.1|  PREDICTED: ABC transporter G family member 1...    116   6e-26   
ref|XP_010279500.1|  PREDICTED: ABC transporter G family member 1...    116   6e-26   
ref|XP_002298392.2|  hypothetical protein POPTR_0001s26300g             116   6e-26   
ref|XP_007015108.1|  ABC-2 type transporter family protein isoform 1    116   7e-26   
ref|XP_006665060.1|  PREDICTED: ABC transporter G family member 1...    115   7e-26   
ref|XP_010937386.1|  PREDICTED: ABC transporter G family member 1...    115   7e-26   
gb|KDO36456.1|  hypothetical protein CISIN_1g016275mg                   112   7e-26   
gb|KJB35755.1|  hypothetical protein B456_006G126900                    115   8e-26   
ref|XP_006833570.1|  hypothetical protein AMTR_s00216p00025980          110   8e-26   
gb|KHN28204.1|  ABC transporter G family member 11                      115   9e-26   
ref|XP_002988377.1|  ATP-binding cassette transporter                   115   9e-26   
ref|XP_002988372.1|  ATP-binding cassette transporter                   115   9e-26   
gb|KJB44096.1|  hypothetical protein B456_007G234000                    115   9e-26   
ref|XP_002988371.1|  hypothetical protein SELMODRAFT_128045             115   9e-26   
gb|AES90633.2|  white-brown-complex ABC transporter family protein      115   9e-26   
ref|XP_003608436.1|  White-brown-complex ABC transporter family         115   9e-26   
ref|XP_010937385.1|  PREDICTED: ABC transporter G family member 1...    115   1e-25   
ref|XP_001782003.1|  ATP-binding cassette transporter, subfamily ...    115   1e-25   
ref|XP_002979726.1|  ATP-binding cassette transporter                   115   1e-25   
gb|KHN26506.1|  ABC transporter G family member 11                      115   1e-25   
ref|XP_002988380.1|  ATP-binding cassette transporter                   115   1e-25   
emb|CAN72387.1|  hypothetical protein VITISV_025427                     115   1e-25   
gb|KDO50219.1|  hypothetical protein CISIN_1g040800mg                   110   1e-25   
ref|XP_003580980.1|  PREDICTED: ABC transporter G family member 1...    115   1e-25   
gb|KHG11916.1|  ABC transporter G family member 13                      115   1e-25   
gb|KDO36455.1|  hypothetical protein CISIN_1g016275mg                   113   1e-25   
ref|XP_010648248.1|  PREDICTED: ABC transporter G family member 1...    115   1e-25   
gb|KJB44097.1|  hypothetical protein B456_007G234100                    110   2e-25   
ref|XP_001782413.1|  ATP-binding cassette transporter, subfamily ...    115   2e-25   
ref|XP_006423804.1|  hypothetical protein CICLE_v10027954mg             114   2e-25   
gb|KJB35750.1|  hypothetical protein B456_006G126900                    115   2e-25   
ref|XP_006446166.1|  hypothetical protein CICLE_v10014529mg             115   2e-25   
gb|AES90632.2|  white-brown-complex ABC transporter family protein      115   2e-25   
gb|EAZ08291.1|  hypothetical protein OsI_30543                          113   2e-25   
ref|XP_006423805.1|  hypothetical protein CICLE_v10027954mg             114   2e-25   
gb|KGN48119.1|  hypothetical protein Csa_6G434390                       114   3e-25   
ref|NP_001062680.1|  Os09g0250800                                       113   3e-25   
emb|CAN60999.1|  hypothetical protein VITISV_012972                     114   3e-25   
gb|KDP40918.1|  hypothetical protein JCGZ_24917                         114   4e-25   
ref|XP_003580981.1|  PREDICTED: ABC transporter G family member 1...    114   4e-25   
ref|XP_010673684.1|  PREDICTED: ABC transporter G family member 1...    114   4e-25   
ref|XP_006663977.1|  PREDICTED: ABC transporter G family member 1...    113   4e-25   
ref|XP_007131552.1|  hypothetical protein PHAVU_011G022900g             114   4e-25   
ref|XP_002979728.1|  ATP-binding cassette transporter                   113   4e-25   
ref|XP_006492628.1|  PREDICTED: ABC transporter G family member 1...    114   5e-25   
ref|XP_002513519.1|  ATP-binding cassette transporter, putative         114   5e-25   
ref|XP_002979735.1|  ATP-binding cassette transporter                   113   6e-25   
ref|XP_011468182.1|  PREDICTED: ABC transporter G family member 1...    114   6e-25   
ref|XP_004306292.2|  PREDICTED: ABC transporter G family member 1...    113   6e-25   
ref|XP_004140211.1|  PREDICTED: ABC transporter G family member 1...    113   6e-25   
ref|XP_010648172.1|  PREDICTED: ABC transporter G family member 1...    113   7e-25   
gb|AFC36404.1|  ABCG1                                                   113   7e-25   
ref|XP_006353283.1|  PREDICTED: ABC transporter G family member 1...    112   8e-25   
ref|XP_002323751.2|  hypothetical protein POPTR_0017s07790g             112   8e-25   
gb|AIU41648.1|  ABC transporter family protein                          112   9e-25   
ref|XP_010258617.1|  PREDICTED: ABC transporter G family member 1...    113   9e-25   
ref|XP_006423808.1|  hypothetical protein CICLE_v10027953mg             112   1e-24   
ref|XP_010312634.1|  PREDICTED: ABC transporter G family member 1...    112   1e-24   
gb|KJB32082.1|  hypothetical protein B456_005G222100                    112   1e-24   
ref|XP_006492644.1|  PREDICTED: ABC transporter G family member 1...    112   1e-24   
ref|XP_003632263.2|  PREDICTED: ABC transporter G family member 1...    112   1e-24   
ref|XP_009337870.1|  PREDICTED: ABC transporter G family member 1...    112   1e-24   
gb|KDP22114.1|  hypothetical protein JCGZ_25945                         112   1e-24   
ref|XP_008449694.1|  PREDICTED: ABC transporter G family member 1...    112   1e-24   
ref|XP_010030023.1|  PREDICTED: ABC transporter G family member 1...    112   2e-24   
ref|XP_010676592.1|  PREDICTED: ABC transporter G family member 1...    112   2e-24   
ref|XP_002314083.2|  hypothetical protein POPTR_0009s05580g             112   2e-24   
ref|XP_004289305.2|  PREDICTED: ABC transporter G family member 1...    111   2e-24   
ref|XP_007201742.1|  hypothetical protein PRUPE_ppa002207mg             112   2e-24   
ref|XP_006393051.1|  hypothetical protein EUTSA_v10011282mg             112   2e-24   
gb|EYU18458.1|  hypothetical protein MIMGU_mgv1a018793mg                111   2e-24   
ref|XP_002438349.1|  hypothetical protein SORBIDRAFT_10g013313          112   3e-24   
gb|KCW56303.1|  hypothetical protein EUGRSUZ_I02044                     107   3e-24   
ref|XP_011032053.1|  PREDICTED: ABC transporter G family member 1...    111   3e-24   
ref|XP_009395140.1|  PREDICTED: ABC transporter G family member 1...    111   3e-24   
emb|CDP09281.1|  unnamed protein product                                111   3e-24   
gb|KCW56964.1|  hypothetical protein EUGRSUZ_I02638                     111   3e-24   
ref|XP_003537732.1|  PREDICTED: ABC transporter G family member 1...    111   4e-24   
ref|XP_008358343.1|  PREDICTED: ABC transporter G family member 1...    111   4e-24   
ref|XP_003540269.1|  PREDICTED: ABC transporter G family member 1...    111   4e-24   
gb|KHN05511.1|  ABC transporter G family member 15                      111   4e-24   
ref|XP_011043123.1|  PREDICTED: ABC transporter G family member 1...    110   4e-24   
gb|KHN05510.1|  ABC transporter G family member 15                      110   4e-24   
ref|XP_007159121.1|  hypothetical protein PHAVU_002G210400g             110   5e-24   
ref|XP_009802842.1|  PREDICTED: ABC transporter G family member 1...    110   5e-24   
ref|XP_011087909.1|  PREDICTED: ABC transporter G family member 1...    110   5e-24   
ref|XP_009403077.1|  PREDICTED: ABC transporter G family member 1...    110   5e-24   
ref|XP_003537734.1|  PREDICTED: ABC transporter G family member 1...    110   6e-24   
gb|KCW45511.1|  hypothetical protein EUGRSUZ_L007632                    105   6e-24   
ref|XP_003607361.1|  ABC transporter G family member                    110   7e-24   
ref|XP_011087908.1|  PREDICTED: ABC transporter G family member 1...    110   8e-24   
gb|EMS59162.1|  ABC transporter G family member 15                      110   8e-24   
ref|XP_007131554.1|  hypothetical protein PHAVU_011G023000g             110   9e-24   
gb|AES88369.2|  white-brown-complex ABC transporter family protei...    109   1e-23   
ref|XP_003606172.1|  White-brown-complex ABC transporter family         109   1e-23   
ref|XP_010094141.1|  ABC transporter G family member 11                 110   1e-23   
ref|XP_008449695.1|  PREDICTED: ABC transporter G family member 1...    109   1e-23   
ref|XP_007042908.1|  White-brown complex protein 11                     110   1e-23   
gb|ADN33920.1|  white-brown-complex ABC transporter family protein      110   1e-23   
ref|XP_006351761.1|  PREDICTED: ABC transporter G family member 1...    109   2e-23   
emb|CDO97424.1|  unnamed protein product                                110   2e-23   
gb|EMT28798.1|  ABC transporter G family member 11                      108   2e-23   
ref|XP_004505642.1|  PREDICTED: ABC transporter G family member 1...    109   2e-23   
gb|KJB32077.1|  hypothetical protein B456_005G221600                    108   2e-23   
ref|XP_011459495.1|  PREDICTED: ABC transporter G family member 1...    108   2e-23   
ref|XP_008237167.1|  PREDICTED: ABC transporter G family member 1...    108   3e-23   
ref|XP_009784909.1|  PREDICTED: ABC transporter G family member 1...    108   3e-23   
gb|EMS63612.1|  ABC transporter G family member 15                      107   3e-23   
dbj|BAJ97265.1|  predicted protein                                      108   3e-23   
ref|XP_007131555.1|  hypothetical protein PHAVU_011G023100g             108   3e-23   
dbj|BAJ86940.1|  predicted protein                                      108   3e-23   
ref|XP_011459494.1|  PREDICTED: ABC transporter G family member 1...    108   4e-23   
gb|KJB32080.1|  hypothetical protein B456_005G221900                    108   4e-23   
gb|EYU46235.1|  hypothetical protein MIMGU_mgv1a002239mg                108   4e-23   
ref|XP_004293165.1|  PREDICTED: ABC transporter G family member 1...    108   4e-23   
gb|EMS64568.1|  ABC transporter G family member 11                      107   4e-23   
ref|XP_010094142.1|  ABC transporter G family member 11                 108   4e-23   
ref|XP_011080364.1|  PREDICTED: ABC transporter G family member 1...    108   4e-23   
emb|CDO97684.1|  unnamed protein product                                108   4e-23   
emb|CDY22844.1|  BnaA06g02330D                                          107   5e-23   
ref|XP_010029396.1|  PREDICTED: ABC transporter G family member 1...    108   5e-23   
ref|XP_009147764.1|  PREDICTED: ABC transporter G family member 13      107   6e-23   
ref|XP_004230551.1|  PREDICTED: ABC transporter G family member 1...    107   6e-23   
ref|XP_010038892.1|  PREDICTED: ABC transporter G family member 1...    107   7e-23   
ref|XP_007201741.1|  hypothetical protein PRUPE_ppa002200mg             107   8e-23   
ref|XP_010534742.1|  PREDICTED: ABC transporter G family member 1...    107   8e-23   
ref|XP_010534741.1|  PREDICTED: ABC transporter G family member 1...    107   8e-23   
ref|XP_008677842.1|  PREDICTED: ABC transporter G family member 1...    107   8e-23   
ref|XP_009611611.1|  PREDICTED: ABC transporter G family member 1...    107   8e-23   
ref|XP_009395259.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    107   9e-23   
ref|XP_009611610.1|  PREDICTED: ABC transporter G family member 1...    107   1e-22   
ref|XP_010040069.1|  PREDICTED: ABC transporter G family member 1...    105   1e-22   
gb|KHN20635.1|  ABC transporter G family member 15                      107   1e-22   
ref|XP_002894318.1|  abc transporter family protein                     107   1e-22   
ref|XP_003540615.1|  PREDICTED: ABC transporter G family member 1...    107   1e-22   
gb|KCW48001.1|  hypothetical protein EUGRSUZ_K01734                     106   1e-22   
gb|KCW48257.1|  hypothetical protein EUGRSUZ_K01986                     106   1e-22   
gb|KGN48121.1|  hypothetical protein Csa_6G434400                       106   1e-22   
ref|NP_175557.1|  ABC transporter G family member 13                    106   1e-22   
dbj|BAC43047.1|  putative ATP-dependent transmembrane transporter       106   1e-22   
ref|XP_010038956.1|  PREDICTED: ABC transporter G family member 1...    106   2e-22   
ref|XP_004962534.1|  PREDICTED: ABC transporter G family member 1...    106   2e-22   
gb|KJB30232.1|  hypothetical protein B456_005G134100                    105   2e-22   
gb|KJB30231.1|  hypothetical protein B456_005G134100                    105   2e-22   
gb|KHN26507.1|  ABC transporter G family member 11                      106   2e-22   
ref|XP_010105215.1|  ABC transporter G family member 15                 105   2e-22   
ref|XP_010461977.1|  PREDICTED: ABC transporter G family member 1...    105   3e-22   
ref|XP_010479628.1|  PREDICTED: ABC transporter G family member 13      105   3e-22   
ref|XP_004505644.1|  PREDICTED: ABC transporter G family member 1...    105   3e-22   
gb|KCW51148.1|  hypothetical protein EUGRSUZ_J00745                     105   4e-22   
emb|CDY49810.1|  BnaC06g04590D                                          105   4e-22   
ref|XP_010690532.1|  PREDICTED: ABC transporter G family member 1...    105   5e-22   
gb|EYU20481.1|  hypothetical protein MIMGU_mgv1a021384mg                101   5e-22   
gb|KCW48264.1|  hypothetical protein EUGRSUZ_K01997                     104   5e-22   
ref|XP_004975139.1|  PREDICTED: ABC transporter G family member 1...    104   6e-22   
ref|XP_010038963.1|  PREDICTED: ABC transporter G family member 1...    104   7e-22   
gb|KDO56028.1|  hypothetical protein CISIN_1g005142mg                   104   7e-22   
gb|KDP26075.1|  hypothetical protein JCGZ_21108                       99.0    8e-22   
ref|XP_008373271.1|  PREDICTED: ABC transporter G family member 1...    104   8e-22   
ref|XP_006365203.1|  PREDICTED: ABC transporter G family member 1...    104   9e-22   
ref|XP_010030024.1|  PREDICTED: ABC transporter G family member 1...    104   1e-21   
ref|XP_002451306.1|  hypothetical protein SORBIDRAFT_05g027420          104   1e-21   
ref|XP_003575559.1|  PREDICTED: ABC transporter G family member 1...    104   1e-21   
ref|XP_006304939.1|  hypothetical protein CARUB_v10011425mg             104   1e-21   



>ref|XP_008245603.1| PREDICTED: ABC transporter G family member 11 [Prunus mume]
Length=707

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL GLVF
Sbjct  549  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLSGLVF  608

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILEN+FQID  RSKW+DLSV+  MI++YR+IFFI+IK +EDVTPWI
Sbjct  609  DNQSPDLPKIPGEYILENVFQIDTARSKWIDLSVILSMIVVYRIIFFIMIKFSEDVTPWI  668

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATG  241
            RGY+ARRRMQQKNGNQ TTV+P GLTQSPSLR+YATG
Sbjct  669  RGYMARRRMQQKNGNQNTTVSPNGLTQSPSLRTYATG  705



>gb|KDO56035.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
Length=385

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSY+SFH+WALQGQYQNDLKGL F
Sbjct  221  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSFHYWALQGQYQNDLKGLWF  280

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE++LEN+FQIDV RSKW+DLSV+F MII YR+IFF++IKI+EDVTPWI
Sbjct  281  DNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIISYRIIFFVMIKISEDVTPWI  340

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG +ARRRMQQKNG Q TTVAP  LTQSPSLR+Y    A +
Sbjct  341  RGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHAAR  381



>emb|CDP18516.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 152/165 (92%), Gaps = 4/165 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPM+YISFHFWALQGQYQNDLKGL+F
Sbjct  515  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMTYISFHFWALQGQYQNDLKGLIF  574

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PD+PKI GE+ILE +FQID NRSKWVDLSV+F MIIIYR+IFFI+IKINEDVTPWI
Sbjct  575  DNQTPDMPKISGEYILEYVFQIDTNRSKWVDLSVIFSMIIIYRIIFFIMIKINEDVTPWI  634

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY----ATGPAKK  229
            RGY+ARRRM QKNGNQ TTVAP+GLTQSPSLR+Y     +G +KK
Sbjct  635  RGYVARRRMLQKNGNQNTTVAPYGLTQSPSLRAYVMDHGSGTSKK  679



>gb|KDO56033.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
 gb|KDO56034.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
Length=546

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSY+SFH+WALQGQYQNDLKGL F
Sbjct  382  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSFHYWALQGQYQNDLKGLWF  441

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE++LEN+FQIDV RSKW+DLSV+F MII YR+IFF++IKI+EDVTPWI
Sbjct  442  DNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIISYRIIFFVMIKISEDVTPWI  501

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG +ARRRMQQKNG Q TTVAP  LTQSPSLR+Y    A +
Sbjct  502  RGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHAAR  542



>ref|XP_006441509.1| hypothetical protein CICLE_v10019080mg [Citrus clementina]
 gb|ESR54749.1| hypothetical protein CICLE_v10019080mg [Citrus clementina]
Length=706

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSY+SFHFWALQGQYQNDLKGL F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSFHFWALQGQYQNDLKGLWF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE++LEN+FQIDV RSKW+DLSV+F MII YR+IFF++IKI+EDVTPWI
Sbjct  602  DNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIIAYRIIFFVMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG +ARRRMQQKNG Q TTVAP  LTQSPSLR+Y    A +
Sbjct  662  RGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHATR  702



>gb|KDO56026.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
 gb|KDO56027.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
Length=706

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSY+SFH+WALQGQYQNDLKGL F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSFHYWALQGQYQNDLKGLWF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE++LEN+FQIDV RSKW+DLSV+F MII YR+IFF++IKI+EDVTPWI
Sbjct  602  DNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIISYRIIFFVMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG +ARRRMQQKNG Q TTVAP  LTQSPSLR+Y    A +
Sbjct  662  RGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHAAR  702



>ref|XP_006478168.1| PREDICTED: ABC transporter G family member 11-like [Citrus sinensis]
Length=706

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSY+SFH+WALQGQYQNDLKGL F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSFHYWALQGQYQNDLKGLWF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE++LEN+FQIDV RSKW+DLSV+F MII YR+IFF++IKI+EDVTPWI
Sbjct  602  DNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIISYRIIFFVMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG +ARRRMQQKNG Q TTVAP  LTQSPSLR+Y    A +
Sbjct  662  RGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHATR  702



>gb|KDO56025.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
Length=712

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSY+SFH+WALQGQYQNDLKGL F
Sbjct  548  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSFHYWALQGQYQNDLKGLWF  607

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE++LEN+FQIDV RSKW+DLSV+F MII YR+IFF++IKI+EDVTPWI
Sbjct  608  DNQSPDLPKIPGEYVLENVFQIDVRRSKWIDLSVIFSMIISYRIIFFVMIKISEDVTPWI  667

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG +ARRRMQQKNG Q TTVAP  LTQSPSLR+Y    A +
Sbjct  668  RGCLARRRMQQKNGTQNTTVAPDRLTQSPSLRNYVANHAAR  708



>gb|KJB30233.1| hypothetical protein B456_005G134100 [Gossypium raimondii]
Length=484

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  321  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  380

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ P+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  381  DNQPPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  440

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RG +ARRRMQQKNG Q T VAP  L QSPSLR+Y    A
Sbjct  441  RGLVARRRMQQKNGTQNTMVAP-SLLQSPSLRNYVANRA  478



>ref|XP_010069548.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW57935.1| hypothetical protein EUGRSUZ_H00674 [Eucalyptus grandis]
Length=717

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAG+QGIFMLVSGYFRLP DIPKP WRYPMSYISFHFWALQGQYQNDL G+VF
Sbjct  552  FLMGIIIGAGLQGIFMLVSGYFRLPKDIPKPVWRYPMSYISFHFWALQGQYQNDLSGMVF  611

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +NQSPDLP+IPGE+ILEN+FQIDVNRSKWVDLSVL  MI+IYR++F I+IK+NEDVTPW+
Sbjct  612  ENQSPDLPRIPGEYILENVFQIDVNRSKWVDLSVLLSMIVIYRILFLIMIKVNEDVTPWV  671

Query  351  RGYIARRRMQQKN-GNQTTTVAPFGLTQSPSLRSYATGPA  235
            RGY+ARRRMQQ+  GN  +++AP GLTQSPSLR+Y   PA
Sbjct  672  RGYLARRRMQQQQAGNNNSSIAPNGLTQSPSLRTYVASPA  711



>gb|KHG12988.1| ABC transporter G family member 11 [Gossypium arboreum]
Length=678

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  515  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  574

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ P+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  575  DNQPPELPKIPGEYILENVFQIDVRRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  634

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RG +ARRRMQQKNG Q T VAP  L+QSPSLR+Y    A
Sbjct  635  RGLVARRRMQQKNGTQNTMVAP-SLSQSPSLRNYVANRA  672



>ref|XP_010687272.1| PREDICTED: ABC transporter G family member 11 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 2/156 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSG+FRLP DIPKP WRYPMSYISFHFWALQGQYQNDLKGLVF
Sbjct  557  FLMGIITGAGIQGIFMLVSGFFRLPKDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLVF  616

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN++PDLPKIPGE++LEN+FQIDVNRSKWVDLSV+F MIIIYR+IFF++IKINEDVTPW+
Sbjct  617  DNRTPDLPKIPGEYVLENVFQIDVNRSKWVDLSVIFSMIIIYRIIFFVMIKINEDVTPWV  676

Query  351  RGYIARRRMQQKNGNQ--TTTVAPFGLTQSPSLRSY  250
             GYIARRR+Q KN NQ  TTTVAP  L+QSPSLR+Y
Sbjct  677  GGYIARRRIQHKNRNQNYTTTVAPDRLSQSPSLRAY  712



>gb|AAP80385.1| ABC transporter [Gossypium hirsutum]
Length=705

 Score =   254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ P+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  602  DNQPPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RG +ARRRMQQKNG Q T VAP  L+QSPSLR+Y    A
Sbjct  662  RGLVARRRMQQKNGTQNTMVAP-SLSQSPSLRNYVANRA  699



>gb|KJB30234.1| hypothetical protein B456_005G134100 [Gossypium raimondii]
Length=705

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ P+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  602  DNQPPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RG +ARRRMQQKNG Q T VAP  L QSPSLR+Y    A
Sbjct  662  RGLVARRRMQQKNGTQNTMVAP-SLLQSPSLRNYVANRA  699



>gb|KJB30235.1| hypothetical protein B456_005G134100 [Gossypium raimondii]
Length=705

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ P+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  602  DNQPPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RG +ARRRMQQKNG Q T VAP  L QSPSLR+Y    A
Sbjct  662  RGLVARRRMQQKNGTQNTMVAP-SLLQSPSLRNYVANRA  699



>gb|KJB30230.1| hypothetical protein B456_005G134100 [Gossypium raimondii]
Length=705

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  542  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ P+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  602  DNQPPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  661

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RG +ARRRMQQKNG Q T VAP  L QSPSLR+Y    A
Sbjct  662  RGLVARRRMQQKNGTQNTMVAP-SLLQSPSLRNYVANRA  699



>ref|XP_007208437.1| hypothetical protein PRUPE_ppa002298mg [Prunus persica]
 gb|EMJ09636.1| hypothetical protein PRUPE_ppa002298mg [Prunus persica]
Length=690

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFH+WALQGQYQNDL GLVF
Sbjct  532  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHYWALQGQYQNDLSGLVF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILEN+FQID  RSKW+DLSV+  MI++YR+IFFI+IK +EDVTPWI
Sbjct  592  DNQSPDLPKIPGEYILENVFQIDTTRSKWIDLSVILSMIVVYRIIFFIMIKFSEDVTPWI  651

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATG  241
            RGY+ARRRMQQKNGNQ TTVAP GLTQSPSLR+YATG
Sbjct  652  RGYMARRRMQQKNGNQNTTVAPDGLTQSPSLRTYATG  688



>ref|XP_006372283.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP50080.1| ABC transporter family protein [Populus trichocarpa]
Length=698

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  538  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  597

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+EDVTPWI
Sbjct  598  DNQSPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVIYRVIFFIMIKISEDVTPWI  657

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RGYIARRRMQQKNG Q TTVAP GLT SPSLR+Y      K
Sbjct  658  RGYIARRRMQQKNGTQNTTVAPDGLTHSPSLRNYVADHRSK  698



>gb|KDP46471.1| hypothetical protein JCGZ_08443 [Jatropha curcas]
Length=694

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  532  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLRGLMF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI++YR+IFFI+IKI+EDVTPWI
Sbjct  592  DNQTPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVVYRIIFFIMIKISEDVTPWI  651

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY-ATGPAKK  229
            RGYIARRRMQQKNG Q TTVAP GLTQSPSLR+Y A  P+ K
Sbjct  652  RGYIARRRMQQKNGTQNTTVAPDGLTQSPSLRNYVANRPSGK  693



>ref|XP_009781344.1| PREDICTED: ABC transporter G family member 11 [Nicotiana sylvestris]
Length=712

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSY+SFHFWALQGQYQNDL GLVF
Sbjct  547  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYLSFHFWALQGQYQNDLMGLVF  606

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN SPDLPKIPGEFILE IFQID+NRSKW+D+SV+F MII YR+IFFI+IKINEDVTPWI
Sbjct  607  DNSSPDLPKIPGEFILEQIFQIDLNRSKWIDVSVIFVMIITYRIIFFIMIKINEDVTPWI  666

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARR+MQQKNGNQ  T+AP+GLTQSPSLR+Y
Sbjct  667  RGYIARRKMQQKNGNQKQTIAPYGLTQSPSLRAY  700



>ref|XP_009602146.1| PREDICTED: ABC transporter G family member 11 [Nicotiana tomentosiformis]
Length=711

 Score =   244 bits (622),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSY+SFHFWALQGQYQNDL GLVF
Sbjct  547  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYLSFHFWALQGQYQNDLMGLVF  606

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN SPDLPKIPGEFILE IFQID+NRSKW+D+SV+F MII YR+IFFI+IKINEDVTPWI
Sbjct  607  DNSSPDLPKIPGEFILEQIFQIDLNRSKWIDVSVIFVMIITYRIIFFIMIKINEDVTPWI  666

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARR+MQQKNGNQ  T+AP+GLTQSPSLR+Y
Sbjct  667  RGYIARRKMQQKNGNQKQTIAPYGLTQSPSLRAY  700



>ref|XP_011046115.1| PREDICTED: ABC transporter G family member 11 isoform X2 [Populus 
euphratica]
Length=705

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  544  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  603

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+EDVTPWI
Sbjct  604  DNQSPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVIYRVIFFIMIKISEDVTPWI  663

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY-ATGPAKK  229
            RGYIARRRMQQKNG Q TTVA  GLT SPSLR+Y A  P K+
Sbjct  664  RGYIARRRMQQKNGTQNTTVASDGLTHSPSLRNYVADHPNKR  705



>ref|XP_002525670.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF36788.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=705

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLRGLLF  600

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILE IFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+EDVTPWI
Sbjct  601  DNQTPDLPKIPGEYILEYIFQIDVHRSKWVDLSVIFSMIVIYRIIFFIMIKISEDVTPWI  660

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY-ATGPAK  232
            RGY+ARRRMQQKNG Q TTVAP GLTQSPSLR+Y A  PA+
Sbjct  661  RGYVARRRMQQKNGTQNTTVAPDGLTQSPSLRAYIANRPAR  701



>ref|XP_011072099.1| PREDICTED: ABC transporter G family member 11 [Sesamum indicum]
Length=709

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 4/165 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  545  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLIF  604

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILEN+FQIDV+RSKW+DLSVLF MIIIYR+IFFI+IK+NEDVTPW+
Sbjct  605  DNQSPDLPKIPGEYILENVFQIDVHRSKWIDLSVLFSMIIIYRIIFFIMIKVNEDVTPWV  664

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY----ATGPAKK  229
            RGYIARRR+Q+K+ NQ TT+ PF LTQSPSLR+Y    A+G  ++
Sbjct  665  RGYIARRRIQRKSANQNTTITPFALTQSPSLRTYVQNRASGSGRR  709



>ref|XP_002262619.1| PREDICTED: ABC transporter G family member 11 [Vitis vinifera]
 emb|CBI26391.3| unnamed protein product [Vitis vinifera]
Length=705

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 152/164 (93%), Gaps = 3/164 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLMF  600

Query  531  DNQSPD-LPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
            DNQ+P+ LPKIPG++ILEN+FQI+V RSKW+DLSV+F MI++YR+IFFI+IKINEDVTPW
Sbjct  601  DNQTPNGLPKIPGDYILENVFQINVKRSKWIDLSVIFSMIVVYRIIFFIMIKINEDVTPW  660

Query  354  IRGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY--ATGPAKK  229
            +RGYIARRRMQQKNGNQTTT+AP GLTQSPSLRSY   TG   K
Sbjct  661  VRGYIARRRMQQKNGNQTTTIAPDGLTQSPSLRSYVATTGTGSK  704



>ref|XP_006351519.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=707

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSY+SFHFWALQGQYQNDL GL F
Sbjct  544  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYLSFHFWALQGQYQNDLMGLEF  603

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN SPDLPKI GEFILE IFQID+NRSKWVD+SV+F MII YR+IFFI+IKINEDVTPWI
Sbjct  604  DNSSPDLPKISGEFILEQIFQIDLNRSKWVDVSVIFVMIITYRIIFFIMIKINEDVTPWI  663

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYA  247
            RGYIARR+MQQKNGNQ  T+AP+GLTQSPSLR+YA
Sbjct  664  RGYIARRKMQQKNGNQKQTIAPYGLTQSPSLRAYA  698



>ref|XP_006372653.1| hypothetical protein POPTR_0017s03590g [Populus trichocarpa]
 gb|ERP50450.1| hypothetical protein POPTR_0017s03590g [Populus trichocarpa]
Length=661

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  500  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  559

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+ED+TPWI
Sbjct  560  DNQSPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVIYRIIFFIMIKISEDITPWI  619

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYAT  244
            RGYIA+RRMQQKNG Q TTVAP GL  SPSLR+Y  
Sbjct  620  RGYIAKRRMQQKNGTQNTTVAPDGLIHSPSLRNYVA  655



>ref|XP_004234313.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=710

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSY+SFHFWALQGQYQNDL GL F
Sbjct  547  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYLSFHFWALQGQYQNDLMGLEF  606

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN SPDLPKIPGEFILE IFQID+NRSKW+D+SV+F MII YR+IFFI+IKINEDVTPWI
Sbjct  607  DNSSPDLPKIPGEFILEQIFQIDLNRSKWIDVSVIFVMIITYRIIFFIMIKINEDVTPWI  666

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYA  247
            RGYIARR+MQQKNGNQ  T+AP+GLTQSPSLR+Y 
Sbjct  667  RGYIARRKMQQKNGNQKQTIAPYGLTQSPSLRAYV  701



>ref|XP_007037082.1| White-brown complex protein 11 [Theobroma cacao]
 gb|EOY21583.1| White-brown complex protein 11 [Theobroma cacao]
Length=718

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  600

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSP+LPKIPGE+ILEN+FQIDV RSKW+DLSV+F MI IYR+IFF +IKI+EDVTPWI
Sbjct  601  DNQSPELPKIPGEYILENVFQIDVGRSKWIDLSVIFSMIFIYRIIFFFMIKISEDVTPWI  660

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG IARRRMQQKNG Q TTVAP GLT+SPSLR+YA   A +
Sbjct  661  RGLIARRRMQQKNGTQNTTVAPDGLTKSPSLRAYAANRATR  701



>ref|XP_011046113.1| PREDICTED: ABC transporter G family member 11 isoform X1 [Populus 
euphratica]
Length=705

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  544  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  603

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+ED+TPWI
Sbjct  604  DNQSPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVIYRIIFFIMIKISEDITPWI  663

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYAT  244
            RGYIARRRMQQ NG Q TTVAP GL  SPSLR+Y  
Sbjct  664  RGYIARRRMQQNNGTQNTTVAPDGLIHSPSLRNYVA  699



>ref|XP_011046116.1| PREDICTED: ABC transporter G family member 11 isoform X3 [Populus 
euphratica]
Length=688

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  527  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  586

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+ED+TPWI
Sbjct  587  DNQSPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVIYRIIFFIMIKISEDITPWI  646

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYAT  244
            RGYIARRRMQQ NG Q TTVAP GL  SPSLR+Y  
Sbjct  647  RGYIARRRMQQNNGTQNTTVAPDGLIHSPSLRNYVA  682



>emb|CAN69297.1| hypothetical protein VITISV_006943 [Vitis vinifera]
Length=716

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 149/155 (96%), Gaps = 1/155 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLMF  600

Query  531  DNQSPD-LPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
            DNQ+P+ LPKIPG++ILEN+FQI+V RSKW+DLSV+F MI++YR+IFFI+IKINEDVTPW
Sbjct  601  DNQTPNGLPKIPGDYILENVFQINVKRSKWIDLSVIFSMIVVYRIIFFIMIKINEDVTPW  660

Query  354  IRGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            +RGYIARRRMQQKNGNQTTT+AP GLTQSPSLRSY
Sbjct  661  VRGYIARRRMQQKNGNQTTTIAPDGLTQSPSLRSY  695



>ref|XP_004495240.1| PREDICTED: ABC transporter G family member 11-like [Cicer arietinum]
Length=144

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  666  MLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVFDNQSPDLPKIPGEFI  487
            MLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGL+FDNQ+PDLPKIPGE+I
Sbjct  1    MLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLIFDNQTPDLPKIPGEYI  60

Query  486  LENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWIRGYIARRRMQQKNGN  307
            LE +FQIDV RSKW+DL V+  MIIIYR+IFFI+IKINEDVTPW+RGY+ARRRMQQK+G 
Sbjct  61   LEYVFQIDVKRSKWIDLIVILSMIIIYRVIFFIMIKINEDVTPWVRGYLARRRMQQKSGA  120

Query  306  QTTTVAPFGLTQSPSLRSYATG  241
            Q TT+AP  LTQSPSLR+Y + 
Sbjct  121  QNTTIAPDVLTQSPSLRAYISN  142



>gb|KGN64232.1| hypothetical protein Csa_1G044820 [Cucumis sativus]
Length=546

 Score =   235 bits (599),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL GL F
Sbjct  382  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLLGLSF  441

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSP LPK+PGE+IL+ +FQID+NRSKWVDLSVLF MI+IYRLIF I+IKINEDVTPWI
Sbjct  442  DNQSPLLPKLPGEYILKVVFQIDLNRSKWVDLSVLFGMIVIYRLIFIIMIKINEDVTPWI  501

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RGYIARRRMQQKNG   TTVAP GLTQSPSLRSY    + +
Sbjct  502  RGYIARRRMQQKNGIVNTTVAPDGLTQSPSLRSYVANHSTR  542



>ref|XP_007152500.1| hypothetical protein PHAVU_004G135400g [Phaseolus vulgaris]
 gb|ESW24494.1| hypothetical protein PHAVU_004G135400g [Phaseolus vulgaris]
Length=703

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKP WRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  544  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPVWRYPMSYISFHFWALQGQYQNDLRGLIF  603

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+P+LPKIPGE+ILE +FQIDVNRSKW++LSV+F MI+IYR+IFFI+IKINEDVTPW+
Sbjct  604  DNQTPELPKIPGEYILEKVFQIDVNRSKWINLSVIFSMIVIYRIIFFIMIKINEDVTPWV  663

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            RGY+ARRRMQQK+G Q TT+AP  LTQSPSLR+Y + P K
Sbjct  664  RGYLARRRMQQKSGAQNTTIAPDVLTQSPSLRTYVSPPTK  703



>ref|XP_003534067.1| PREDICTED: ABC transporter G family member 11-like [Glycine max]
 gb|KHM99772.1| ABC transporter G family member 11 [Glycine soja]
Length=707

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKP WRYPMSYISFHFWALQGQYQNDL+GLVF
Sbjct  548  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPVWRYPMSYISFHFWALQGQYQNDLRGLVF  607

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILE +FQIDVNRSKW++LSV+F MI+IYR+IFFI+IK+NEDVTPW+
Sbjct  608  DNQTPDLPKIPGEYILEKVFQIDVNRSKWINLSVIFSMIVIYRIIFFIMIKVNEDVTPWV  667

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            RGY+ARRRMQQK+G Q TT+AP  LTQSPSLR+Y +   K
Sbjct  668  RGYLARRRMQQKSGAQNTTIAPDVLTQSPSLRTYVSTQTK  707



>ref|XP_003548275.1| PREDICTED: ABC transporter G family member 11-like [Glycine max]
 gb|KHN24467.1| ABC transporter G family member 11 [Glycine soja]
Length=706

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKP WRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  547  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPVWRYPMSYISFHFWALQGQYQNDLRGLIF  606

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILE +FQIDVNRSKW++LSV+F MI+IYR+IFFI+IK+NEDVTPWI
Sbjct  607  DNQTPDLPKIPGEYILEKVFQIDVNRSKWINLSVIFSMIVIYRIIFFIMIKVNEDVTPWI  666

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            RGY+ARRRMQQK+G Q TT+AP  LTQSPSLR+Y +   K
Sbjct  667  RGYLARRRMQQKSGAQNTTIAPDVLTQSPSLRTYVSTQTK  706



>ref|XP_004152433.1| PREDICTED: ABC transporter G family member 11-like [Cucumis sativus]
 ref|XP_004169419.1| PREDICTED: ABC transporter G family member 11-like [Cucumis sativus]
Length=696

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL GL F
Sbjct  532  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLLGLSF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSP LPK+PGE+IL+ +FQID+NRSKWVDLSVLF MI+IYRLIF I+IKINEDVTPWI
Sbjct  592  DNQSPLLPKLPGEYILKVVFQIDLNRSKWVDLSVLFGMIVIYRLIFIIMIKINEDVTPWI  651

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RGYIARRRMQQKNG   TTVAP GLTQSPSLRSY    + +
Sbjct  652  RGYIARRRMQQKNGIVNTTVAPDGLTQSPSLRSYVANHSTR  692



>gb|KJB08156.1| hypothetical protein B456_001G068300 [Gossypium raimondii]
Length=543

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  382  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  441

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQSP+LP+IPGE+ILEN+FQI+V RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  442  KNQSPELPQIPGEYILENVFQINVRRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  501

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG IARRRMQQKNG Q TTVAP GLTQSPSLR+Y      K
Sbjct  502  RGLIARRRMQQKNGIQNTTVAPDGLTQSPSLRTYVATTRDK  542



>ref|XP_010537533.1| PREDICTED: ABC transporter G family member 11 [Tarenaya hassleriana]
Length=705

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLLF  600

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+QSP   KIPGE+ILEN+FQI+V+RSKWVDLSV+F MI IYR+IFFI+IK+NEDVTPW+
Sbjct  601  DSQSPSSFKIPGEYILENVFQINVHRSKWVDLSVIFSMIAIYRIIFFIMIKVNEDVTPWV  660

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  661  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRTY  694



>ref|XP_008370410.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
Length=709

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL GL+F
Sbjct  553  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLSGLLF  612

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILEN+FQI+  RSKW+DLSV+  MI++YR+IFFI+IK +EDVTPWI
Sbjct  613  DNQTPDLPKIPGEYILENVFQINTARSKWIDLSVILSMIVVYRIIFFIMIKFSEDVTPWI  672

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYA  247
            RGY+ARRR+QQKNGNQ TTVAP GLTQSPSLR++A
Sbjct  673  RGYMARRRIQQKNGNQNTTVAPDGLTQSPSLRNHA  707



>ref|XP_008437286.1| PREDICTED: ABC transporter G family member 11 [Cucumis melo]
 ref|XP_008437295.1| PREDICTED: ABC transporter G family member 11 [Cucumis melo]
Length=696

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL GL F
Sbjct  532  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLLGLSF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSP LPK+PGE+IL+ +FQID+NRSKWVDLSVLF MI+IYRLIF I+IKINEDVTPWI
Sbjct  592  DNQSPLLPKLPGEYILKVVFQIDLNRSKWVDLSVLFGMIVIYRLIFIIMIKINEDVTPWI  651

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYAT  244
            RGYIARRRMQQKNG   TTVAP GLTQSPSLRSY  
Sbjct  652  RGYIARRRMQQKNGIVNTTVAPDGLTQSPSLRSYVA  687



>ref|XP_010037061.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW48690.1| hypothetical protein EUGRSUZ_K02343 [Eucalyptus grandis]
Length=716

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  552  FLMGIIIGAGIQGIFMLVSGYFRLPKDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  611

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+IL N+FQIDV+RSKWVDL+VLF MI+IYR++FFI+IKINEDVTPW+
Sbjct  612  DNQSPDLPKIPGEYILVNVFQIDVSRSKWVDLTVLFSMIVIYRIVFFIMIKINEDVTPWV  671

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYAT  244
            RGYIARRRM  KNG Q TTV P  LTQSPSLR+Y T
Sbjct  672  RGYIARRRMMLKNGTQNTTVTPDVLTQSPSLRAYVT  707



>gb|KJB08152.1| hypothetical protein B456_001G068300 [Gossypium raimondii]
Length=702

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  600

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQSP+LP+IPGE+ILEN+FQI+V RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  601  KNQSPELPQIPGEYILENVFQINVRRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  660

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG IARRRMQQKNG Q TTVAP GLTQSPSLR+Y      K
Sbjct  661  RGLIARRRMQQKNGIQNTTVAPDGLTQSPSLRTYVATTRDK  701



>gb|KHG09028.1| ABC transporter G family member 11 [Gossypium arboreum]
Length=691

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  530  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  589

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQSP+LP+IPGE+ILEN+FQI+V RSKW+DLSV+F MIIIYR+IFF++IKI+EDVTPWI
Sbjct  590  KNQSPELPQIPGEYILENVFQINVRRSKWIDLSVIFSMIIIYRIIFFLMIKISEDVTPWI  649

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG IARRRMQQKNG Q TTVAP GLT SPSLR+Y      K
Sbjct  650  RGLIARRRMQQKNGIQNTTVAPDGLTHSPSLRTYVATTRDK  690



>ref|XP_004495239.1| PREDICTED: ABC transporter G family member 11-like [Cicer arietinum]
Length=694

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGL+F
Sbjct  536  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLIF  595

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILE +FQIDV RSKW+DL V+  MIIIYR+IFFI+IKINEDVTPW+
Sbjct  596  DNQTPDLPKIPGEYILEYVFQIDVKRSKWIDLIVILSMIIIYRVIFFIMIKINEDVTPWV  655

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGY+ARRRMQQK+G Q TT+AP  LTQSPSLR+Y
Sbjct  656  RGYLARRRMQQKSGAQNTTIAPDVLTQSPSLRAY  689



>gb|EYU22324.1| hypothetical protein MIMGU_mgv1a002042mg [Erythranthe guttata]
Length=723

 Score =   230 bits (587),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 150/169 (89%), Gaps = 8/169 (5%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL GL+F
Sbjct  554  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLTGLIF  613

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPK+PGE+ILEN+FQIDVNRSKWVDLSVLF MII+YR+IFF+VIK+NEDVTPW+
Sbjct  614  DNQTPDLPKVPGEYILENVFQIDVNRSKWVDLSVLFSMIIVYRIIFFMVIKVNEDVTPWV  673

Query  351  RGYIARRRMQQK----NGNQTTTVAPFGLTQSPSLRSY----ATGPAKK  229
            RGYIARRR+Q K    N NQ  TVAPF LTQSPSLR+Y    A+  AK+
Sbjct  674  RGYIARRRIQHKNNNANVNQNNTVAPFALTQSPSLRTYVQDRASATAKR  722



>ref|XP_010274916.1| PREDICTED: ABC transporter G family member 11 [Nelumbo nucifera]
 ref|XP_010274917.1| PREDICTED: ABC transporter G family member 11 [Nelumbo nucifera]
Length=704

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 145/162 (90%), Gaps = 3/162 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  544  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLLF  603

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILEN+FQIDV RSKW+DLSVLF MIIIYR+IFFI+IK+NEDVTPW+
Sbjct  604  DNQSPDLPKIPGEYILENVFQIDVKRSKWIDLSVLFSMIIIYRVIFFILIKVNEDVTPWV  663

Query  351  RGYIARRRMQQK-NGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RGYIARRR+QQK NGN      P  LTQSPSLRSY    A +
Sbjct  664  RGYIARRRLQQKTNGNPRAM--PDRLTQSPSLRSYTVNQADR  703



>ref|XP_009338224.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
11-like [Pyrus x bretschneideri]
Length=710

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL G +F
Sbjct  554  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPIWRYPMSYISFHFWALQGQYQNDLSGXLF  613

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+P+LPKIPGE+ILEN+FQI+  RSKW+DLSV+  MI++YR+IFFI+IK +EDV PWI
Sbjct  614  DNQTPNLPKIPGEYILENVFQINTARSKWIDLSVILSMIVVYRIIFFIMIKFSEDVMPWI  673

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYA  247
            RGY+ARRR+QQ NGNQ TTVAP GLTQSPSLR+YA
Sbjct  674  RGYMARRRIQQNNGNQNTTVAPDGLTQSPSLRTYA  708



>ref|XP_004516742.1| PREDICTED: ABC transporter G family member 11-like [Cicer arietinum]
Length=694

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKP WRYPMSYISFH+WALQGQYQNDLKGL+F
Sbjct  536  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPVWRYPMSYISFHYWALQGQYQNDLKGLIF  595

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILE +FQIDV RSKW+DL V+  MIIIYR+IFFI+IKINEDVTPW+
Sbjct  596  DNQTPDLPKIPGEYILEYVFQIDVKRSKWIDLIVILSMIIIYRVIFFIMIKINEDVTPWV  655

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGY+ARRRMQQK+G Q TT+AP  LTQSPSLR+Y
Sbjct  656  RGYLARRRMQQKSGAQNTTIAPDVLTQSPSLRAY  689



>ref|XP_008388513.1| PREDICTED: ABC transporter G family member 11 [Malus domestica]
Length=687

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 143/156 (92%), Gaps = 1/156 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPK  WRYPMSYISFHFWALQGQYQNDL GL+F
Sbjct  530  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKLVWRYPMSYISFHFWALQGQYQNDLSGLLF  589

Query  531  DNQSPD-LPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
            DN +PD LPKIPGE+ILEN+FQI+  RSKW+DLSV+  MI++YR+IFFI+IK +EDVTPW
Sbjct  590  DNDTPDHLPKIPGEYILENVFQINTARSKWIDLSVILSMIVVYRIIFFIMIKFSEDVTPW  649

Query  354  IRGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYA  247
            IRGY+ARRRMQQKNGNQ TTVAP GLTQSPSLR+YA
Sbjct  650  IRGYMARRRMQQKNGNQNTTVAPDGLTQSPSLRNYA  685



>ref|XP_004302267.1| PREDICTED: ABC transporter G family member 11 [Fragaria vesca 
subsp. vesca]
Length=706

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDL GL+F
Sbjct  545  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLAGLLF  604

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN++PD  KIPG++ILE +FQI+ +RSKW+DL V+F MI++YR IFFI+IK +EDV+PWI
Sbjct  605  DNETPDQIKIPGDYILEVVFQINTSRSKWIDLGVIFSMIVVYRAIFFIMIKFSEDVSPWI  664

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATG  241
            RGY+ARRR+QQKNG Q TTVAP GL+QSPSLR+YATG
Sbjct  665  RGYMARRRLQQKNGIQHTTVAPDGLSQSPSLRNYATG  701



>ref|XP_006848619.1| hypothetical protein AMTR_s00171p00031180 [Amborella trichopoda]
 gb|ERN10200.1| hypothetical protein AMTR_s00171p00031180 [Amborella trichopoda]
Length=712

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 2/158 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFH+WALQGQYQNDL+GL F
Sbjct  547  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLYF  606

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKI GE+ILE +FQI+VNRSKW+DLSVLF MIIIYR+IFFI+IKI+EDVTPW+
Sbjct  607  DNQSPDLPKISGEYILEYVFQINVNRSKWIDLSVLFSMIIIYRIIFFIMIKISEDVTPWV  666

Query  351  RGYIARRRMQQKN--GNQTTTVAPFGLTQSPSLRSYAT  244
            RG+IARRR+QQK   GN TTTV P  L QSPSL+SYAT
Sbjct  667  RGFIARRRLQQKTTKGNSTTTVNPDRLYQSPSLKSYAT  704



>ref|XP_010476947.1| PREDICTED: ABC transporter G family member 11 [Camelina sativa]
Length=703

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 146/164 (89%), Gaps = 4/164 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KI GE++LEN+FQIDVNRSKW++LSV+  MIIIYR+IFFI+IK NEDVTPWI
Sbjct  600  DSQGSAF-KISGEYVLENVFQIDVNRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWI  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY---ATGPAKK  229
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y    TG A++
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNYIATQTGGARR  702



>ref|XP_010459397.1| PREDICTED: ABC transporter G family member 11-like [Camelina 
sativa]
Length=703

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 146/164 (89%), Gaps = 4/164 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KI GE++LEN+FQIDVNRSKW++LSV+  MIIIYR+IFFI+IK NEDVTPWI
Sbjct  600  DSQGSAF-KISGEYVLENVFQIDVNRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWI  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY---ATGPAKK  229
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y    TG A++
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNYIATQTGGARR  702



>ref|XP_010498161.1| PREDICTED: ABC transporter G family member 11-like [Camelina 
sativa]
Length=703

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 4/164 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KI GE++LEN+FQIDVNRSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KISGEYVLENVFQIDVNRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY---ATGPAKK  229
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y    TG A++
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNYIATQTGGARR  702



>ref|XP_006306902.1| hypothetical protein CARUB_v10008462mg [Capsella rubella]
 gb|EOA39800.1| hypothetical protein CARUB_v10008462mg [Capsella rubella]
Length=703

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQID++RSKW+DLSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KIPGEYVLENVFQIDLHRSKWIDLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  692



>gb|AAF97264.1|AC034106_7 Contains similarity to ATP dependent transmembrane transporter 
protein (wh3) from Bombyx mori gb|AF229609 and contains an 
ABC transporter PF|00005 domain. ESTs gb|Z18062, gb|AI999375, 
gb|N96732, gb|F14058, gb|AV528782, gb|AV559526, gb|AV556190, 
gb|AV562800, gb|AV559560, gb|AV523165, gb|AV565094, gb|AV566285 
come from this gene [Arabidopsis thaliana]
Length=659

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL F
Sbjct  496  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLTF  555

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQID++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  556  DSQGSAF-KIPGEYVLENVFQIDLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  614

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  615  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  648



>gb|KEH26658.1| white-brown-complex ABC transporter family protein, putative 
[Medicago truncatula]
Length=697

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKP WRYPMSYISFH+WALQGQYQNDL+GL+F
Sbjct  537  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPVWRYPMSYISFHYWALQGQYQNDLRGLLF  596

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D ++PD+PKI GE+ILE +FQI V RSKW+DLSV+  MIIIYR+IFF++IK+NEDVTPW+
Sbjct  597  DGETPDMPKIAGEYILEYVFQITVTRSKWIDLSVILSMIIIYRIIFFVMIKVNEDVTPWV  656

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            RGY+ARRR+QQK+G Q TT+AP  LTQSPSLR+Y +  ++
Sbjct  657  RGYLARRRIQQKSGAQNTTIAPDVLTQSPSLRNYISNQSR  696



>gb|AAY28856.1| white-brown complex protein 11 [Arabidopsis halleri subsp. gemmifera]
Length=687

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  532  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQID++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  592  DSQGSAF-KIPGEYVLENVFQIDLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  650

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  651  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  684



>ref|NP_173226.2| ABC transporter G family member 11 [Arabidopsis thaliana]
 sp|Q8RXN0.1|AB11G_ARATH RecName: Full=ABC transporter G family member 11; Short=ABC transporter 
ABCG.11; Short=AtABCG11; AltName: Full=Protein CUTICULAR 
DEFECT AND ORGAN FUSION 1; AltName: Full=Protein DESPERADO; 
AltName: Full=Protein PERMEABLE LEAVES 1; AltName: Full=White-brown 
complex homolog protein 11; Short=AtWBC11 [Arabidopsis 
thaliana]
 gb|AAL87274.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAN12898.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AEE29642.1| ABC transporter G family member 11 [Arabidopsis thaliana]
Length=703

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLTF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQID++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KIPGEYVLENVFQIDLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  692



>ref|XP_002890251.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66510.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   216 bits (551),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQID++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KIPGEYVLENVFQIDLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP  LTQSPSLR+Y
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDALTQSPSLRNY  692



>emb|CDY26211.1| BnaA06g12060D [Brassica napus]
Length=676

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  513  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLMF  572

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  573  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  631

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  632  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  665



>gb|KFK42295.1| hypothetical protein AALP_AA2G237200 [Arabis alpina]
Length=704

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLYF  600

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  601  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  659

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG+Q TTVAP GLTQSPSLR+Y
Sbjct  660  RGYIARRRMKQKNGSQNTTVAPDGLTQSPSLRNY  693



>gb|EPS70875.1| hypothetical protein M569_03882, partial [Genlisea aurea]
Length=675

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKPFWRYPMSYISFH+WALQGQYQNDLKGL+F
Sbjct  521  FLMGIIIGAGIQGIFMLVSGYFRLPKDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLMF  580

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             N  PDLP IPGE+ILE +FQIDVNRSKW DL VL  MI+IYR+IFF++IKINED+TPW+
Sbjct  581  QNNPPDLPPIPGEYILEFVFQIDVNRSKWADLGVLLSMIVIYRIIFFLMIKINEDLTPWV  640

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARR +Q+KN N  TTVAPF L +SPSL++Y
Sbjct  641  RGYIARRIIQRKNANPNTTVAPFTLARSPSLKAY  674



>ref|XP_009149237.1| PREDICTED: ABC transporter G family member 11 [Brassica rapa]
Length=703

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+G++F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGVMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  692



>emb|CDY19179.1| BnaC05g13800D [Brassica napus]
Length=676

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPK FWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  513  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKLFWRYPMSYISFHFWALQGQYQNDLRGLMF  572

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+V+RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  573  DSQGSAF-KIPGEYVLENVFQINVHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  631

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  632  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  665



>ref|XP_006661900.1| PREDICTED: ABC transporter G family member 11-like [Oryza brachyantha]
Length=617

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 3/154 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGLVF
Sbjct  455  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLVF  514

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGE+ILEN+FQIDVNRSKW+DL+VLF MI+IYRL+FF +IK++EDVTPW+
Sbjct  515  DNQDDELPKIPGEYILENVFQIDVNRSKWLDLAVLFSMIVIYRLLFFAMIKVSEDVTPWV  574

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRR+QQ  G +   +A    ++SPSLR+Y
Sbjct  575  RGYIARRRVQQGKGGRRAELAA---SRSPSLRAY  605



>ref|XP_010918473.1| PREDICTED: ABC transporter G family member 11-like [Elaeis guineensis]
Length=710

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFH+WALQGQYQNDL+GL+F
Sbjct  546  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLIF  605

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILEN+FQIDVNRSKW DL VLF MI +YR++FFI+IK++EDVTPWI
Sbjct  606  DNQSPDLPKIPGEYILENVFQIDVNRSKWWDLLVLFSMIAMYRILFFIMIKVSEDVTPWI  665

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGY+ARRR+Q K  +     A     ++PSLR+Y
Sbjct  666  RGYVARRRLQHKKNSNKHASADLA-NRTPSLRAY  698



>ref|XP_006416662.1| hypothetical protein EUTSA_v10006960mg [Eutrema salsugineum]
 gb|AGC11818.1| putative ABC transporter G family member 11 [Eutrema halophilum]
 gb|ESQ35015.1| hypothetical protein EUTSA_v10006960mg [Eutrema salsugineum]
Length=703

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPK FWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKIFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  659  RGYIARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  692



>emb|CDX96749.1| BnaA08g22920D [Brassica napus]
Length=677

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPK FWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  513  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKLFWRYPMSYISFHFWALQGQYQNDLRGLMF  572

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  573  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  631

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGY+ARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  632  RGYVARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  665



>ref|XP_003574118.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=708

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+FMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL GL+F
Sbjct  544  FLMGIITGAGIQGVFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLVGLMF  603

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQS  LPKIPGE++LEN+FQIDV RSKW+DLSVLF MI++YRL+FF +IK++EDVTPW+
Sbjct  604  DNQSELLPKIPGEYVLENVFQIDVGRSKWLDLSVLFAMIVVYRLLFFAMIKVSEDVTPWL  663

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            R YIARRR+Q++ G      A   + +SPSLR Y
Sbjct  664  RRYIARRRVQRRRGRARDAAAELQVGRSPSLRGY  697



>emb|CDX83888.1| BnaC08g17570D [Brassica napus]
Length=679

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPK FWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  515  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKLFWRYPMSYISFHFWALQGQYQNDLRGLMF  574

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  575  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  633

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGY+ARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  634  RGYVARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  667



>ref|XP_009110383.1| PREDICTED: ABC transporter G family member 11-like [Brassica 
rapa]
Length=704

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPK FWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  540  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKIFWRYPMSYISFHFWALQGQYQNDLRGLMF  599

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+Q     KIPGE++LEN+FQI+++RSKW++LSV+  MIIIYR+IFFI+IK NEDVTPW+
Sbjct  600  DSQGSAF-KIPGEYVLENVFQINLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWV  658

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGY+ARRRM+QKNG Q TTVAP GLTQSPSLR+Y
Sbjct  659  RGYVARRRMKQKNGTQNTTVAPDGLTQSPSLRNY  692



>ref|XP_008806677.1| PREDICTED: ABC transporter G family member 11-like [Phoenix dactylifera]
 ref|XP_008806678.1| PREDICTED: ABC transporter G family member 11-like [Phoenix dactylifera]
Length=710

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDL+GL+F
Sbjct  546  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLLF  605

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKI GEFILEN+FQIDVNRSKW+DL VL  MI IYR++FFI+IK++ED+TPWI
Sbjct  606  DNQSPDLPKISGEFILENVFQIDVNRSKWLDLLVLLSMIAIYRILFFIMIKVSEDMTPWI  665

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRR+Q K  ++    A     ++PSLR+Y
Sbjct  666  RGYIARRRLQHKKNSKKHGSADLA-NRTPSLRAY  698



>ref|XP_009400415.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=706

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 5/154 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFH+WALQGQYQNDLKGL+F
Sbjct  546  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLIF  605

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE+ILEN+FQIDVNRSKW DL+ LF MI+IYR+IF ++IKI+EDVTPW 
Sbjct  606  DNQTPDLPKIPGEYILENVFQIDVNRSKWWDLAALFSMIVIYRIIFLMMIKISEDVTPWA  665

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRR+QQK  +           ++PSLR Y
Sbjct  666  RGYIARRRLQQKKSSSVDLA-----NRTPSLRGY  694



>ref|XP_010933304.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Elaeis guineensis]
Length=712

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL+GLVF
Sbjct  547  FLMGIIVGAGIQGIFMLVSGFFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLVF  606

Query  531  DNQS-PDL-PKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTP  358
            DNQ  P+L PKI GE  LE  FQIDVNRSKW DL VLF M++IYRL+FFI+IK+NEDVTP
Sbjct  607  DNQELPELPPKITGELALEQFFQIDVNRSKWWDLLVLFSMVVIYRLLFFIMIKVNEDVTP  666

Query  357  WIRGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            WIRGYIARR ++ K  ++    A   + ++PSLR Y
Sbjct  667  WIRGYIARRSLRHKKNSRQHASADH-VNRTPSLRVY  701



>dbj|BAJ88522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   209 bits (533),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL GLVF
Sbjct  555  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLVGLVF  614

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGE+ILEN+FQIDV+RSKW+DLSVLF MI+IYRL+FF +IK++EDVTPW+
Sbjct  615  DNQDDELPKIPGEYILENVFQIDVSRSKWLDLSVLFGMIVIYRLLFFAMIKVSEDVTPWV  674

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RGY+ARRR+Q K        A   + ++PSLR Y    A
Sbjct  675  RGYVARRRVQHKRRE-----AELAMVRTPSLRGYVIDAA  708



>ref|NP_001064944.1| Os10g0494300 [Oryza sativa Japonica Group]
 gb|AAM92819.1| putative ABC transporter [Oryza sativa Japonica Group]
 gb|AAP54419.1| ABC-2 type transporter family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26858.1| Os10g0494300 [Oryza sativa Japonica Group]
Length=723

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGLVF
Sbjct  561  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLVF  620

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGE+ILEN+FQIDV+RSKW+DL+VLF MI IYRL+FF +IK++EDVTPW+
Sbjct  621  DNQDDELPKIPGEYILENVFQIDVSRSKWLDLAVLFSMIFIYRLLFFAMIKVSEDVTPWV  680

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RGY+ARRR+Q K        A     +SPSLR+Y    A
Sbjct  681  RGYVARRRVQGKGARGRG--ADLSAARSPSLRAYVVDAA  717



>ref|XP_010322516.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=676

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGI+ GAGI GI M+VSG+FRLP+DIPKP WRYP+SY++F FWA+QGQY+N LKGL+F
Sbjct  531  FLMGIVIGAGILGISMVVSGFFRLPHDIPKPVWRYPVSYLTFDFWAIQGQYKNHLKGLIF  590

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKI GE+ L+  FQI VNRSKWVDLSV+F MIIIYRLIFFI+IKINEDVTPW+
Sbjct  591  DNQSPDLPKITGEYALKETFQIHVNRSKWVDLSVIFSMIIIYRLIFFIMIKINEDVTPWL  650

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLT  274
            RGYIARR+MQQ   NQ  T+  + L 
Sbjct  651  RGYIARRKMQQNGANQNKTMTQYALA  676



>ref|XP_009401807.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=711

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKPFWRYPM+YISF +W+LQGQYQNDLKGL+F
Sbjct  546  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMTYISFDYWSLQGQYQNDLKGLLF  605

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+PDLPKIPGE++LEN+FQIDV+RSKW DLSVL+ M+IIYR+IFFI+IKINEDVTPWI
Sbjct  606  DNQTPDLPKIPGEYVLENVFQIDVSRSKWWDLSVLYSMVIIYRIIFFIMIKINEDVTPWI  665

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSY  250
            RGYIARRRMQQK   +    +     ++PSLR Y
Sbjct  666  RGYIARRRMQQKTSFEWQHSSADLTNRTPSLRGY  699



>gb|EAY79050.1| hypothetical protein OsI_34160 [Oryza sativa Indica Group]
Length=726

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGLVF
Sbjct  561  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLVF  620

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGE+ILEN+FQIDV+RSKW+DL+VLF MI IYRL+FF +IK++EDVTPW+
Sbjct  621  DNQDDELPKIPGEYILENVFQIDVSRSKWLDLAVLFSMIFIYRLLFFAMIKVSEDVTPWV  680

Query  351  RGYIARRRMQQK-NGNQTTTVAPFGLTQSPSLRSYATGPA  235
            RGY+ARRR+Q K         A     +SPSLR+Y    A
Sbjct  681  RGYVARRRVQGKGARGARGRGADLAAARSPSLRAYVVDAA  720



>ref|XP_008776721.1| PREDICTED: ABC transporter G family member 11-like [Phoenix dactylifera]
Length=689

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 139/162 (86%), Gaps = 3/162 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLPNDIPKPFWRYPMSY+SFH+WA+QGQYQNDL+GLVF
Sbjct  526  FLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYVSFHYWAMQGQYQNDLRGLVF  585

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ+P+LPKIPGEFILEN+FQI+VNRSKW DL VLF M++IYRL+FFI+IK+NEDVTPWI
Sbjct  586  DNQTPNLPKIPGEFILENVFQINVNRSKWWDLLVLFSMVVIYRLLFFIMIKVNEDVTPWI  645

Query  351  RGYIARRRM-QQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RGY ARR +  +KN NQ  +V    + ++PSLR Y     K 
Sbjct  646  RGYAARRWLRHKKNSNQPASVDH--VNRTPSLRVYVVEAEKS  685



>ref|XP_011018196.1| PREDICTED: ABC transporter G family member 11-like, partial [Populus 
euphratica]
Length=679

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  550  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  609

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKIPGE+ILENIFQIDV+RSKWVDLSV+F MI+IYR+IFFI+IKI+EDVTPWI
Sbjct  610  DNQSPDLPKIPGEYILENIFQIDVHRSKWVDLSVIFSMIVIYRVIFFIMIKISEDVTPWI  669

Query  351  RGYIARRR  328
            RGYIARRR
Sbjct  670  RGYIARRR  677



>gb|EEE51200.1| hypothetical protein OsJ_32013 [Oryza sativa Japonica Group]
Length=689

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGLVF
Sbjct  527  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLVF  586

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGE+ILEN+FQIDV+RSKW+DL+VLF MI IYRL+FF +IK++EDVTPW+
Sbjct  587  DNQDDELPKIPGEYILENVFQIDVSRSKWLDLAVLFSMIFIYRLLFFAMIKVSEDVTPWV  646

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
             GY+ARRR+Q K        A     +SPSLR+Y    A
Sbjct  647  PGYVARRRVQGKGARGPG--ADLSAARSPSLRAYVVDAA  683



>gb|KJB08154.1| hypothetical protein B456_001G068300 [Gossypium raimondii]
Length=674

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 120/161 (75%), Gaps = 28/161 (17%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  600

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQSP+LP+IPGE+ILEN+FQI++                            +EDVTPWI
Sbjct  601  KNQSPELPQIPGEYILENVFQINI----------------------------SEDVTPWI  632

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            RG IARRRMQQKNG Q TTVAP GLTQSPSLR+Y      K
Sbjct  633  RGLIARRRMQQKNGIQNTTVAPDGLTQSPSLRTYVATTRDK  673



>ref|XP_006347487.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=666

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGI+ GAGI GI M+VSG+FRLP+DIPKP WRYP+SY++F FWA+QGQY+N LKGLVF
Sbjct  530  FLMGIVIGAGILGISMVVSGFFRLPHDIPKPVWRYPVSYLTFDFWAIQGQYKNHLKGLVF  589

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSPDLPKI GE+ L+  FQI V RSKWVDLSV+F MIIIYR+IFFI+IKINEDVTPW+
Sbjct  590  DNQSPDLPKITGEYALKQTFQIHVERSKWVDLSVIFSMIIIYRVIFFIMIKINEDVTPWL  649

Query  351  RGYIARRRMQQKNGNQ  304
            RGYIARR+MQQ   NQ
Sbjct  650  RGYIARRKMQQNGANQ  665



>ref|XP_004982746.1| PREDICTED: ABC transporter G family member 11-like [Setaria italica]
Length=717

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 5/160 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGLVF
Sbjct  557  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLVF  616

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGE+ILEN+FQIDVNRSKW+DL+VLF MI+IYRL+FF++IKI+EDVTPW+
Sbjct  617  DNQDDELPKIPGEYILENVFQIDVNRSKWLDLAVLFSMIVIYRLLFFVMIKISEDVTPWV  676

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            RGYIARRR+Q +   +    A     +SPSLR Y    A 
Sbjct  677  RGYIARRRVQNRRQRKVELAA-----RSPSLRGYVVDVAS  711



>tpg|DAA36731.1| TPA: hypothetical protein ZEAMMB73_733981 [Zea mays]
Length=539

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 7/158 (4%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKPFWRYPM YISFH+WALQGQ QND+KGLVF
Sbjct  382  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPFWRYPMQYISFHYWALQGQCQNDMKGLVF  441

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IKINED  PWI
Sbjct  442  DNQYPDQPKIPGDFILKYIFQINVDRSKWIDLSVIFSMIFIYRILFFLMIKINEDALPWI  501

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RG+IAR+RMQ+K    T       + ++PSLR Y   P
Sbjct  502  RGHIARKRMQKKGPTPT-------MGKTPSLRGYVVDP  532



>ref|XP_004976309.1| PREDICTED: ABC transporter G family member 11-like [Setaria italica]
Length=724

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 7/158 (4%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKPFWRYPM YISFH+WALQGQ QND+KGLVF
Sbjct  567  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPFWRYPMQYISFHYWALQGQCQNDMKGLVF  626

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IKINEDV PWI
Sbjct  627  DNQYPDQPKIPGDFILKYIFQINVDRSKWIDLSVIFSMIFIYRILFFLMIKINEDVLPWI  686

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RG++AR+RMQ K  + T     FG  ++PSLR Y   P
Sbjct  687  RGHVARKRMQNKGPSAT-----FG--KTPSLRGYVVDP  717



>ref|XP_002467016.1| hypothetical protein SORBIDRAFT_01g018360 [Sorghum bicolor]
 gb|EER94014.1| hypothetical protein SORBIDRAFT_01g018360 [Sorghum bicolor]
Length=615

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDLKGL+F
Sbjct  455  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLKGLLF  514

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LPKIPGEFILEN+FQIDVNRSKW+DL+VLF MI+IYRL+FF++IKI+EDVTPW+
Sbjct  515  DNQDDELPKIPGEFILENVFQIDVNRSKWLDLAVLFSMIVIYRLLFFVMIKISEDVTPWV  574

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            R YIA+RR+Q +   +         T++PSLR Y    A 
Sbjct  575  RRYIAQRRVQNRRQRKVELA-----TRTPSLRGYVVDVAS  609



>ref|NP_001147877.1| LOC100281487 [Zea mays]
 gb|ACG28976.1| ABC transporter C05D10.3 in chromosome III [Zea mays]
 gb|ACN36200.1| unknown [Zea mays]
Length=721

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 7/158 (4%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKPFWRYPM YISFH+WALQGQ QND+KGLVF
Sbjct  564  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPFWRYPMQYISFHYWALQGQCQNDMKGLVF  623

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IKINED  PWI
Sbjct  624  DNQYPDQPKIPGDFILKYIFQINVDRSKWIDLSVIFSMIFIYRILFFLMIKINEDALPWI  683

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RG+IAR+RMQ+K    T       + ++PSLR Y   P
Sbjct  684  RGHIARKRMQKKGPTPT-------MGKTPSLRGYVVDP  714



>tpg|DAA36732.1| TPA: ABC transporter C05D10.3 in III [Zea mays]
Length=782

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 7/158 (4%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKPFWRYPM YISFH+WALQGQ QND+KGLVF
Sbjct  625  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPFWRYPMQYISFHYWALQGQCQNDMKGLVF  684

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IKINED  PWI
Sbjct  685  DNQYPDQPKIPGDFILKYIFQINVDRSKWIDLSVIFSMIFIYRILFFLMIKINEDALPWI  744

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RG+IAR+RMQ+K    T       + ++PSLR Y   P
Sbjct  745  RGHIARKRMQKKGPTPT-------MGKTPSLRGYVVDP  775



>ref|XP_002446827.1| hypothetical protein SORBIDRAFT_06g023280 [Sorghum bicolor]
 gb|EES11155.1| hypothetical protein SORBIDRAFT_06g023280 [Sorghum bicolor]
Length=724

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 7/158 (4%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKPFWRYPM YISFH+WALQGQ QND+KGLVF
Sbjct  567  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPFWRYPMQYISFHYWALQGQCQNDMKGLVF  626

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+R+KW+DLSV+F MI IYR++FF++IKINEDV PWI
Sbjct  627  DNQYPDQPKIPGDFILKYIFQINVDRNKWIDLSVIFSMIFIYRILFFLMIKINEDVLPWI  686

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RG+IAR+RMQ+K  + +     FG  ++PSLR Y   P
Sbjct  687  RGHIARKRMQKKGPSPS-----FG--KTPSLRGYVVDP  717



>ref|XP_004495238.1| PREDICTED: ABC transporter G family member 11-like [Cicer arietinum]
Length=123

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -1

Query  603  MSYISFHFWALQGQYQNDLKGLVFDNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLF  424
            MSYISFH+WALQGQYQNDLKGL+FDNQ+PDLPKIPGE+ILE +FQIDV RSKW+DL V+ 
Sbjct  1    MSYISFHYWALQGQYQNDLKGLIFDNQTPDLPKIPGEYILEYVFQIDVKRSKWIDLIVIL  60

Query  423  CMiiiyrliffivikINEDVTPWIRGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYAT  244
             MIIIYR+IFFI+IKINEDVTPW+RGY+ARRRMQQK+G Q TT+AP  LTQSPSLR+Y +
Sbjct  61   SMIIIYRIIFFIMIKINEDVTPWVRGYLARRRMQQKSGAQNTTIAPDVLTQSPSLRAYIS  120

Query  243  G  241
             
Sbjct  121  N  121



>ref|XP_008664814.1| PREDICTED: ABC transporter G family member 11-like [Zea mays]
Length=718

 Score =   188 bits (478),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 2/120 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WAL+GQYQNDLKGL+F
Sbjct  556  FLMGIIVGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALRGQYQNDLKGLLF  615

Query  531  DNQSPD-LP-KIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTP  358
            D Q  D LP KIPGEFILEN+FQ+D  RSKW+DL+VL CM+++YRL+FF +IK  EDVTP
Sbjct  616  DGQQDDVLPSKIPGEFILENVFQMDAGRSKWLDLAVLLCMVVVYRLLFFAMIKAAEDVTP  675



>gb|EAZ31411.1| hypothetical protein OsJ_15543 [Oryza sativa Japonica Group]
Length=680

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKP WRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  526  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPVWRYPMQYISFHYWALQGQCQNDMDGLVF  585

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IK+NED  PWI
Sbjct  586  DNQYPDQPKIPGDFILKYIFQINVHRSKWIDLSVIFSMIFIYRILFFLMIKVNEDALPWI  645

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P G  ++PSLR Y   P
Sbjct  646  RGYIARKRLQKKE--------PLG--KTPSLRGYVVDP  673



>emb|CBG76424.1| OO_Ba0013J05-OO_Ba0033A15.11 [Oryza officinalis]
Length=692

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKP WRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  538  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPVWRYPMQYISFHYWALQGQCQNDMDGLVF  597

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IK+NED  PWI
Sbjct  598  DNQYPDQPKIPGDFILKYIFQINVHRSKWIDLSVIFSMIFIYRILFFLMIKVNEDALPWI  657

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P G  ++PSLR Y   P
Sbjct  658  RGYIARKRLQKKE--------PLG--KTPSLRGYVVDP  685



>ref|XP_010240161.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Brachypodium distachyon]
Length=599

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPK FWRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  444  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLVF  503

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+VNRSKW+DLSV+F MI IYRL+FFI+IK+NEDV PW+
Sbjct  504  DNQYPDQPKIPGDFILKYIFQINVNRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVLPWV  563

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P  + ++PSLR Y   P
Sbjct  564  RGYIARKRLQKK--------VP-AIGKTPSLRGYVVDP  592



>emb|CAD41191.1| OSJNBa0074L08.3 [Oryza sativa Japonica Group]
 emb|CAH67912.1| OSIGBa0115K01-H0319F09.18 [Oryza sativa Indica Group]
 gb|EAY94924.1| hypothetical protein OsI_16727 [Oryza sativa Indica Group]
Length=692

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKP WRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  538  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPVWRYPMQYISFHYWALQGQCQNDMDGLVF  597

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IK+NED  PWI
Sbjct  598  DNQYPDQPKIPGDFILKYIFQINVHRSKWIDLSVIFSMIFIYRILFFLMIKVNEDALPWI  657

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P G  ++PSLR Y   P
Sbjct  658  RGYIARKRLQKKE--------PLG--KTPSLRGYVVDP  685



>ref|NP_001053375.1| Os04g0528300 [Oryza sativa Japonica Group]
 dbj|BAF15289.1| Os04g0528300 [Oryza sativa Japonica Group]
Length=711

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKP WRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  557  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPVWRYPMQYISFHYWALQGQCQNDMDGLVF  616

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IK+NED  PWI
Sbjct  617  DNQYPDQPKIPGDFILKYIFQINVHRSKWIDLSVIFSMIFIYRILFFLMIKVNEDALPWI  676

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P G  ++PSLR Y   P
Sbjct  677  RGYIARKRLQKKE--------PLG--KTPSLRGYVVDP  704



>ref|XP_003580184.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Brachypodium distachyon]
Length=715

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPK FWRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  560  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLVF  619

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+VNRSKW+DLSV+F MI IYRL+FFI+IK+NEDV PW+
Sbjct  620  DNQYPDQPKIPGDFILKYIFQINVNRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVLPWV  679

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K       V   G  ++PSLR Y   P
Sbjct  680  RGYIARKRLQKK-------VPAIG--KTPSLRGYVVDP  708



>gb|EMT16398.1| ABC transporter G family member 11 [Aegilops tauschii]
Length=727

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPK FWRYPM YISFH+WALQGQ QND+ GL+F
Sbjct  572  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLLF  631

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPGEFIL+ IFQI+V+RSKW+DLSV+F MI IYRL+FFI+IK+NEDV PWI
Sbjct  632  DNQYPDQPKIPGEFILKYIFQINVHRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVMPWI  691

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K       V   G  ++PSLR Y   P
Sbjct  692  RGYIARKRLQKK-------VPAIG--KTPSLRGYVVDP  720



>gb|EMS54433.1| ABC transporter G family member 11 [Triticum urartu]
Length=537

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPK FWRYPM YISFH+WALQGQ QND+ GL+F
Sbjct  382  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKIFWRYPMQYISFHYWALQGQCQNDMDGLLF  441

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYRL+FFI+IK+NEDV PWI
Sbjct  442  DNQYPDQPKIPGDFILKYIFQINVHRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVMPWI  501

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P  + ++PSLR Y   P
Sbjct  502  RGYIARKRLQKK--------VP-AIGKTPSLRGYVVDP  530



>ref|XP_006652549.1| PREDICTED: ABC transporter G family member 11-like [Oryza brachyantha]
Length=710

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 9/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPKP WRYPM YISFH+WALQGQ QND+ GLVF
Sbjct  555  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKPVWRYPMQYISFHYWALQGQCQNDMDGLVF  614

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF++IK+NED  PWI
Sbjct  615  DNQYPDQPKIPGDFILKYIFQINVHRSKWIDLSVIFSMIFIYRILFFLMIKVNEDALPWI  674

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K         P G  ++PSLR Y   P
Sbjct  675  RGYIARKRLQKKE-------PPVG--KTPSLRGYVVDP  703



>dbj|BAJ91212.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=717

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP DIPK FWRYPM YISFH+WALQGQ QND+ GL+F
Sbjct  562  FLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLLF  621

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FFI+IK+NEDV PWI
Sbjct  622  DNQYPDQPKIPGQFILKYIFQINVHRSKWIDLSVIFSMIFIYRMLFFIMIKVNEDVMPWI  681

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            RGYIAR+R+Q+K       V   G  ++PSLR Y   P
Sbjct  682  RGYIARKRLQKK-------VPAIG--KTPSLRGYVVDP  710



>tpg|DAA49491.1| TPA: hypothetical protein ZEAMMB73_694244 [Zea mays]
Length=710

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 2/120 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WAL+GQYQNDLKGL+F
Sbjct  548  FLMGIIVGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALRGQYQNDLKGLLF  607

Query  531  DNQSPDL--PKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTP  358
            D Q  D+   KIPGEFILEN+FQ+D  RSKW+DL+VL CM+++YRL+FF +IK  EDVTP
Sbjct  608  DGQQDDVLPSKIPGEFILENVFQMDAGRSKWLDLAVLLCMVVVYRLLFFAMIKAAEDVTP  667



>gb|AFW68511.1| hypothetical protein ZEAMMB73_737572 [Zea mays]
Length=254

 Score =   172 bits (436),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 133/160 (83%), Gaps = 5/160 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL+GL+F
Sbjct  94   FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLLF  153

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LP+IPGEFILE +FQIDV RSKW+DL+VLF MI+IYRL+FF++IK +EDVTPW+
Sbjct  154  DNQDDELPRIPGEFILETVFQIDVARSKWLDLAVLFSMIVIYRLLFFLMIKASEDVTPWL  213

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAK  232
            R Y+ARRR++ +   +    A     ++PSLR Y    A 
Sbjct  214  RRYVARRRVRNRRHRKPDLPA-----RTPSLRGYVVDAAS  248



>ref|XP_006347488.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=662

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGI GI MLVSG+FRLP DIPKP WRYP+SY++F FWA+QGQY+NDLKGL+F
Sbjct  526  FLMGIIIGAGILGISMLVSGFFRLPYDIPKPVWRYPVSYLTFDFWAVQGQYKNDLKGLIF  585

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQSP  PKI GE+ L++IFQIDVNRSKWVDLS +F +IIIYR+IFFI+IKINEDVTPW+
Sbjct  586  DNQSPHPPKITGEYALKHIFQIDVNRSKWVDLSAIFSLIIIYRVIFFIMIKINEDVTPWL  645

Query  351  RGYIARRRMQQKNGNQ  304
            R YI+RR+MQQ   NQ
Sbjct  646  RVYISRRKMQQNGANQ  661



>ref|XP_004242154.2| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=663

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGI GI MLVSG+FRLP DIPKP WRYP+SY++F FWA+QGQY+NDLKGL+F
Sbjct  527  FLMGIIIGAGILGISMLVSGFFRLPYDIPKPVWRYPVSYLTFDFWAVQGQYKNDLKGLIF  586

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN SP  PKI GE+ L+ IFQIDVNRSKWVDLS +F +IIIYR+IFF +IKINEDVTPW+
Sbjct  587  DNHSPHPPKITGEYALKQIFQIDVNRSKWVDLSAIFSLIIIYRVIFFFMIKINEDVTPWL  646

Query  351  RGYIARRRMQQKNGNQ  304
            RGYIARR+MQ    NQ
Sbjct  647  RGYIARRKMQHSGPNQ  662



>ref|NP_001147125.1| ATP-binding cassette sub-family G member 2 [Zea mays]
 gb|ACG25567.1| ATP-binding cassette sub-family G member 2 [Zea mays]
Length=708

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL+GL+F
Sbjct  548  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLLF  607

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LP+IPGEFILE +FQIDV RSKW+DL+VLF MI+IYRL+FF++IK +EDVTPW+
Sbjct  608  DNQDDELPRIPGEFILETVFQIDVARSKWLDLAVLFSMIVIYRLLFFLMIKASEDVTPWL  667



>gb|AFW68510.1| ATP-binding cassette sub-family G member 2 [Zea mays]
Length=710

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL+GL+F
Sbjct  550  FLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLLF  609

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DNQ  +LP+IPGEFILE +FQIDV RSKW+DL+VLF MI+IYRL+FF++IK +EDVTPW+
Sbjct  610  DNQDDELPRIPGEFILETVFQIDVARSKWLDLAVLFSMIVIYRLLFFLMIKASEDVTPWL  669



>ref|XP_002987629.1| hypothetical protein SELMODRAFT_183315 [Selaginella moellendorffii]
 gb|EFJ11204.1| hypothetical protein SELMODRAFT_183315 [Selaginella moellendorffii]
Length=681

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 118/154 (77%), Gaps = 6/154 (4%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIF+LV+G+FRLPND+PK +W+YPMSYI FH +ALQG Y+ND  GL F
Sbjct  521  FLMGIITGAGIQGIFLLVAGFFRLPNDLPKAYWKYPMSYIGFHMYALQGTYENDFLGLEF  580

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN+ P LPKIPG+FIL +++QI V RSKW +L V+F MII+YR+IFFI IK  E+V PW+
Sbjct  581  DNKFPGLPKIPGKFILTDVYQITVARSKWWNLGVIFLMIIVYRVIFFITIKYVENVQPWV  640

Query  351  RGYIARR----RMQQKNGNQTTTVAPFGLTQSPS  262
               +A+     R ++K+    +TV P  + QSPS
Sbjct  641  SAMMAKHSAKLRRKKKSTTLPSTVRP--VLQSPS  672



>ref|XP_002983318.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ15660.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=673

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIF+LV+G+FRLPND+PK +W+YPMSYI FH +ALQG Y+ND  GL F
Sbjct  521  FLMGIITGAGIQGIFLLVAGFFRLPNDLPKAYWKYPMSYIGFHMYALQGTYENDFLGLEF  580

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            DN+ P LPKIPG+FIL +++QI V RSKW +L V+F MII+YR+IFFI IK  E+V PW+
Sbjct  581  DNKFPGLPKIPGKFILTDVYQITVARSKWWNLGVIFLMIIVYRVIFFITIKYVENVQPWV  640

Query  351  RGYIARRRMQQKNGNQTTTV  292
               +A+   + +   ++TT+
Sbjct  641  SAMMAKHSAKLRRKKKSTTL  660



>ref|XP_002970205.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ28335.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=681

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 124/167 (74%), Gaps = 10/167 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIF+LV+G+FRLP D+PK FW++P+SYI FH ++LQG ++ND  GL F
Sbjct  517  FLMGIITGAGIQGIFLLVAGFFRLPGDLPKAFWKFPLSYIGFHMYSLQGNFENDFLGLNF  576

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +N+ P LPKIPG+FIL+++++I V RSKW +L+V+F MII+YR +FF+ IK +E V PW+
Sbjct  577  ENKFPGLPKIPGKFILQDVYEIPVGRSKWWNLAVVFLMIIVYRFLFFLAIKYSESVQPWL  636

Query  351  RGYIARRR--------MQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            +G +A+RR        + +KN     T+ P  + QSP LR  AT  +
Sbjct  637  QGIMAKRRARFLSSNHLTRKNSALQNTIRPV-VQQSP-LREPATATS  681



>ref|XP_010933306.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Elaeis guineensis]
Length=637

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 2/91 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSG+FRLP+DIPKPFWRYPMSYISFH+WALQGQYQNDL+GLVF
Sbjct  547  FLMGIIVGAGIQGIFMLVSGFFRLPHDIPKPFWRYPMSYISFHYWALQGQYQNDLRGLVF  606

Query  531  DNQS-PDL-PKIPGEFILENIFQIDVNRSKW  445
            DNQ  P+L PKI GE  LE  FQIDVNRSKW
Sbjct  607  DNQELPELPPKITGELALEQFFQIDVNRSKW  637



>ref|XP_002978369.1| hypothetical protein SELMODRAFT_443862 [Selaginella moellendorffii]
 gb|EFJ20355.1| hypothetical protein SELMODRAFT_443862 [Selaginella moellendorffii]
Length=709

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 124/167 (74%), Gaps = 10/167 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIF+LV+G+FRLP D+PK FW++P+SYI FH ++LQG ++ND  GL F
Sbjct  545  FLMGIITGAGIQGIFLLVAGFFRLPGDLPKAFWKFPLSYIGFHMYSLQGNFENDFLGLNF  604

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +N+ P LPKIPG+FIL+++++I V RSKW +L+V+F MII+YR +FF+ IK +E V PW+
Sbjct  605  ENKFPGLPKIPGKFILQDVYEIPVGRSKWWNLAVVFLMIIVYRFLFFLAIKYSESVQPWL  664

Query  351  RGYIARRR--------MQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
            +G +A+RR        + +KN     T+ P  + QSP LR  AT  +
Sbjct  665  QGIMAKRRARFLSSNHLTRKNSALQNTIRPV-VQQSP-LREPATATS  709



>ref|XP_002968809.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29925.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=700

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 118/162 (73%), Gaps = 5/162 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+F+LV+G+FRLP+D+PK FW+YPMSYI FH ++LQG Y+ND +GL F
Sbjct  538  FLMGIITGAGIQGVFLLVAGFFRLPDDLPKFFWKYPMSYIGFHMYSLQGMYENDFRGLEF  597

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             N+ P LP IPGEF+LE+++QI++ RSKW +L ++F MI+ YRL+FF+VIK  E+V P +
Sbjct  598  GNKVPGLPTIPGEFVLEDVYQINMARSKWWNLGIIFLMILAYRLLFFLVIKFAENVRPGL  657

Query  351  RGYIARRR---MQQKNGNQTTTVAPFGLTQSPSLRSYATGPA  235
               IA+ +   + + N    T + P  +T SP  +     PA
Sbjct  658  SRVIAKSKANLLLRNNSALQTAIRP--VTHSPPPKELKVAPA  697



>ref|XP_002963935.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ34268.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=651

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 102/142 (72%), Gaps = 13/142 (9%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG FMLV+G+FRLPN+IPK FW+YP+SY+SFH ++LQG YQND  G+ F
Sbjct  507  FLMGIITGAGIQGFFMLVAGFFRLPNEIPKVFWKYPVSYLSFHMFSLQGMYQNDFLGVDF  566

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDV----  364
             N+ P LP IPG  IL   +Q+++ RSKW +L+V+F MI+IYRL FF +IK  ED+    
Sbjct  567  SNKFPALPTIPGRLILSEFYQVNMRRSKWANLAVVFSMIVIYRLFFFAMIKAGEDLRALR  626

Query  363  -----TP----WIRGYIARRRM  325
                 TP    W+R   +R RM
Sbjct  627  HTGDWTPPRSVWVRPLSSRTRM  648



>ref|XP_002967985.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ31332.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=691

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG FMLV+G+FRLPN+IPK FW+YP+SY+SFH ++LQG YQND  G+ F
Sbjct  524  FLMGIITGAGIQGFFMLVAGFFRLPNEIPKVFWKYPVSYLSFHMFSLQGMYQNDFLGVDF  583

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             N+ P LP IPG  IL   +Q+++ RSKW +L+V+F MI+IYRL FF +IK  ED+ P  
Sbjct  584  SNKFPALPTIPGRLILSEFYQVNMRRSKWANLAVVFSMIVIYRLFFFAMIKAGEDLWPRA  643

Query  351  RGYIARR  331
            R     R
Sbjct  644  RRLTTSR  650



>gb|ACN27163.1| unknown [Zea mays]
Length=231

 Score =   120 bits (300),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 7/111 (6%)
 Frame = -1

Query  570  QGQYQNDLKGLVFDNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliff  391
            QGQ QND+KGLVFDNQ PD PKIPG+FIL+ IFQI+V+RSKW+DLSV+F MI IYR++FF
Sbjct  121  QGQCQNDMKGLVFDNQYPDQPKIPGDFILKYIFQINVDRSKWIDLSVIFSMIFIYRILFF  180

Query  390  ivikINEDVTPWIRGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGP  238
            ++IKINED  PWIRG+IAR+RMQ+K    T       + ++PSLR Y   P
Sbjct  181  LMIKINEDALPWIRGHIARKRMQKKGPTPT-------MGKTPSLRGYVVDP  224


 Score = 57.4 bits (137),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  709  PDGHHHRGRNSGYIYASLXILQTP**HPKAFLALPNVLHQLPLLGFTGTV  560
            P G+HHRGR+SG I+A L +LQT   HP+A L +P+ +HQLPLLG  G +
Sbjct  50   PHGYHHRGRDSGNIHAGLWLLQTSIRHPEALLEIPHAVHQLPLLGTAGKL  99



>ref|XP_010647365.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=243

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  94   FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  153

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL+N++Q++   SKWVD+++LF M+++YRL+F  +IK  E V P 
Sbjct  154  PNNQAGGPPTITGEEILQNVWQVETGYSKWVDVAILFGMVVLYRLLFLGIIKTVEKVKPM  213

Query  354  IRGYIARRRMQQKNGNQTTTVAPF  283
            I+G +     + K   +    +PF
Sbjct  214  IKGLMVASPEKSKQIIENPPSSPF  237



>gb|KJB08155.1| hypothetical protein B456_001G068300 [Gossypium raimondii]
Length=623

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAGIQGIFMLVSGYFRLPNDIPKP WRYPMSYISFHFWALQGQYQNDLKGL+F
Sbjct  541  FLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQGQYQNDLKGLLF  600

Query  531  DNQSPDLPKIPGEFILENIFQID  463
             NQSP+LP+IPGE+ILEN+FQI+
Sbjct  601  KNQSPELPQIPGEYILENVFQIN  623



>emb|CBI18824.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  94   FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  153

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL+N++Q++   SKWVD+++LF M+++YRL+F  +IK  E V P 
Sbjct  154  PNNQAGGPPTITGEEILQNVWQVETGYSKWVDVAILFGMVVLYRLLFLGIIKTVEKVKPM  213

Query  354  IRGYIARRRMQQKNGNQTTTVAPF  283
            I+G +     + K   +    +PF
Sbjct  214  IKGLMVASPEKSKQIIENPPSSPF  237



>ref|XP_010647257.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=534

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+P PFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  390  FLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  449

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I GE IL+N++Q+++  SKW+DL++LF M+++YRL+F  +IK  E V P 
Sbjct  450  PNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFMGIIKTVEKVKPM  509

Query  354  IRG  346
            IRG
Sbjct  510  IRG  512



>ref|XP_002267117.3| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=634

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+P PFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  490  FLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  549

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I GE IL+N++Q+++  SKW+DL++LF M+++YRL+F  +IK  E V P 
Sbjct  550  PNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFLGIIKTVEKVKPM  609

Query  354  IRGYIA  337
            IRG  A
Sbjct  610  IRGLFA  615



>emb|CBI25872.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  443  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  502

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL+N++Q++   SKWVD+++LF M+++YRL+F  +IK  E V P 
Sbjct  503  PNNQAGGPPTITGEEILQNVWQVETGYSKWVDVAILFGMVVLYRLLFLGIIKTVEKVKPM  562

Query  354  IRGYIARRRMQQK  316
            I+G +     + K
Sbjct  563  IKGLMVASPEKSK  575



>ref|XP_010106269.1| ABC transporter G family member 11 [Morus notabilis]
 gb|EXC09686.1| ABC transporter G family member 11 [Morus notabilis]
Length=671

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GLVF
Sbjct  531  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFEGLVF  590

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N Q+     I GE IL +++Q+++  SKWVD+++LF M+++YRL+F  ++K  E V P 
Sbjct  591  PNEQAGGRALITGEEILRSVWQVEMGYSKWVDVAILFGMVVVYRLMFLGILKAVEKVKPI  650

Query  354  IRGYIARRRMQQKNGNQ  304
            IRG+   R    K+ N+
Sbjct  651  IRGFSVVRSKHSKHINE  667



>gb|KCW54565.1| hypothetical protein EUGRSUZ_I00524 [Eucalyptus grandis]
Length=527

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  GYFRLP+D+PKPFWRYPM YISFH +A QG ++N+ +GL+F
Sbjct  386  FLMGIITGAGIQGVMMLNGGYFRLPDDLPKPFWRYPMYYISFHKYANQGFFKNEFEGLMF  445

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQ    P I GE IL N +Q+++  SKWVDL++L  M+++YRL+F  +IK  E + P +
Sbjct  446  PNQMAGSPTIGGEEILRNYWQVEMGYSKWVDLAILLGMVVVYRLMFLGIIKAAEKMKPLV  505

Query  351  RGYIAR  334
            + + A+
Sbjct  506  KNFRAK  511



>ref|XP_003635438.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=741

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  592  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  651

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL+N++Q++   SKWVD+++LF M+++YRL+F  +IK  E V P 
Sbjct  652  PNNQAGGPPTITGEEILQNVWQVETGYSKWVDVAILFGMVVLYRLLFLGIIKTVEKVKPM  711

Query  354  IRGYIARRRMQQK  316
            I+G +     + K
Sbjct  712  IKGLMVASPEKSK  724



>ref|XP_007047884.1| White-brown complex protein 11 isoform 3 [Theobroma cacao]
 gb|EOX92041.1| White-brown complex protein 11 isoform 3 [Theobroma cacao]
Length=535

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  390  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  449

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ IL N +Q+++  SKW+D+++LF M++IYRLIF+ +IK  E V P 
Sbjct  450  PNNQAGGPPTITGDEILRNFWQVEMGYSKWIDIAILFGMVVIYRLIFWGIIKTVEKVKPL  509

Query  354  IRGYIARRRMQQKNGNQTT  298
            I+ Y+A + +     +Q +
Sbjct  510  IKAYMAGKSVAPTQSSQIS  528



>emb|CBI35723.3| unnamed protein product [Vitis vinifera]
Length=891

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+P PFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  747  FLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  806

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I GE IL+N++Q+++  SKW+DL++LF M+++YRL+F  +IK  E V P 
Sbjct  807  PNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFLGIIKTVEKVKPM  866

Query  354  IRGYIA  337
            IRG  A
Sbjct  867  IRGLFA  872



>ref|XP_006837421.1| hypothetical protein AMTR_s00107p00013610 [Amborella trichopoda]
 gb|ERN00275.1| hypothetical protein AMTR_s00107p00013610 [Amborella trichopoda]
Length=688

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ +G+FRL  D+PKPFWRYP+SY+S+  W LQGQ +ND+ G++F
Sbjct  520  FLMGIITGAGIMGILMMTAGFFRLLPDLPKPFWRYPISYLSYGSWGLQGQLKNDMIGMLF  579

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ GE IL N+  + +  SKW+DL++++ ++I YRL FF+V+K NE V+P +
Sbjct  580  DPMLPGDPKLRGEDILRNMLGVGLGHSKWLDLAIIYVILISYRLTFFLVLKFNEKVSPAL  639

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLR  256
            R   A+R ++      + T  P     +PS R
Sbjct  640  RSLHAKRSLEYLKRRPSFTRKP-SFRSTPSFR  670



>ref|XP_007047881.1| White-brown complex protein 11 [Theobroma cacao]
 gb|EOX92038.1| White-brown complex protein 11 [Theobroma cacao]
Length=535

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  390  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  449

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ IL N +Q+++  SKW+D+++LF M++IYRL+F+ +IK  E V P 
Sbjct  450  PNNQAGRPPTITGDEILRNFWQVEMGYSKWIDIAILFGMVVIYRLMFWGIIKTVEKVKPL  509

Query  354  IRGYIARRRMQQKNGNQTT  298
            I+ Y+A + +     +Q +
Sbjct  510  IKAYMAVKSVTPTQSSQIS  528



>ref|XP_004288174.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=711

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ + L F
Sbjct  576  FLMGIITGAGIQGVMMLTGGFFRLPDDLPKPFWRYPMYYIAFHKYAFQGFYKNEFEELTF  635

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             N     P I GE IL++I+Q+++  SKW+DL++LF M+I+YR +F  +IK +E V P I
Sbjct  636  PNDQGGAPTITGEDILKSIWQVEMGYSKWIDLAILFGMVIVYRFMFLGIIKFSEKVVPMI  695

Query  351  RGYI  340
            +  +
Sbjct  696  KAVL  699



>ref|XP_010652672.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=592

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  443  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  502

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +NQ+   P I GE IL+N++Q++   SKWVD+++LF M
Sbjct  503  PNNQAGGPPTISGEEILQNVWQVETGYSKWVDVAILFGM  541



>emb|CBI33134.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  480  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  539

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +NQ+   P I GE IL+N++Q++   SKWVD+++LF M
Sbjct  540  PNNQAGGPPTISGEEILQNVWQVETGYSKWVDVAILFGM  578



>ref|XP_007047885.1| White-brown complex protein 11 isoform 4 [Theobroma cacao]
 gb|EOX92042.1| White-brown complex protein 11 isoform 4 [Theobroma cacao]
Length=715

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  570  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  629

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ IL N +Q+++  SKW+D+++LF M++IYRLIF+ +IK  E V P 
Sbjct  630  PNNQAGGPPTITGDEILRNFWQVEMGYSKWIDIAILFGMVVIYRLIFWGIIKTVEKVKPL  689

Query  354  IRGYIARRRMQQKNGNQTT  298
            I+ Y+A + +     +Q +
Sbjct  690  IKAYMAGKSVAPTQSSQIS  708



>emb|CAN81791.1| hypothetical protein VITISV_020569 [Vitis vinifera]
Length=857

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+P PFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  713  FLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  772

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I GE IL+N++Q+++  SKW+DL++LF M+++YRL+F  +IK  E V P 
Sbjct  773  PNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFXGIIKTVEKVKPM  832

Query  354  IRG  346
            IRG
Sbjct  833  IRG  835



>ref|XP_007047882.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
 ref|XP_007047883.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
 gb|EOX92039.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
 gb|EOX92040.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
Length=715

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  570  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  629

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ IL N +Q+++  SKW+D+++LF M++IYRLIF+ +IK  E V P 
Sbjct  630  PNNQAGGPPTITGDEILRNFWQVEMGYSKWIDIAILFGMVVIYRLIFWGIIKTVEKVKPL  689

Query  354  IRGYIARRRMQQKNGNQTT  298
            I+ Y+A + +     +Q +
Sbjct  690  IKAYMAGKSVAPTQSSQIS  708



>ref|XP_006426351.1| hypothetical protein CICLE_v10025117mg [Citrus clementina]
 gb|ESR39591.1| hypothetical protein CICLE_v10025117mg [Citrus clementina]
Length=647

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML  G+FRLPND+PKP W+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  504  FLMGIITGAGIQGIMMLNGGFFRLPNDLPKPVWKYPMYYIAFHRYAFQGFYKNEFEGLTF  563

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ +L NI+Q+D+  +KWVDL++LF M+  YR +F+++IK  E++ P 
Sbjct  564  PNNQAGGPPTITGKEVLTNIWQVDMGHTKWVDLAILFGMLFFYRFLFWVIIKTTENLKPI  623

Query  354  IRGY  343
            IR +
Sbjct  624  IRSF  627



>ref|XP_010030453.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
Length=646

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YISFH +A QG ++N+ +GL+F
Sbjct  505  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYISFHKYANQGFFKNEFEGLIF  564

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQ    P I GE IL N +Q+++  SKWVDL+ L  M+++YRL+F  +IK  E + P +
Sbjct  565  PNQMGGSPTISGEEILRNYWQVEMGYSKWVDLATLLGMVVVYRLMFLGIIKAVEKMKPMV  624

Query  351  RGYIARRRMQQKNGNQTTTVAP  286
            + + A+     K+  +  +  P
Sbjct  625  KIFRAKSPRHPKHVMENPSSKP  646



>ref|XP_003608431.1| White-brown-complex ABC transporter family [Medicago truncatula]
 gb|AES90628.1| white-brown-complex ABC transporter family protein, putative 
[Medicago truncatula]
Length=665

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 2/145 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML  G+FRLPND+P PFWRYPM YISFH +A QG Y+N+ +GL F
Sbjct  516  FLMGIITGAGIQGIMMLAGGFFRLPNDLPNPFWRYPMFYISFHRYAFQGSYKNEFEGLKF  575

Query  531  --DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTP  358
              D     L  I GE IL N F +D++ SKWVDL VL  MI++YR++F I+IK  E + P
Sbjct  576  ERDEIGGSLNYISGEEILRNKFHVDMSYSKWVDLGVLLGMIVLYRVVFLIIIKTTEKLKP  635

Query  357  WIRGYIARRRMQQKNGNQTTTVAPF  283
             +  +++    Q +   +  T  P 
Sbjct  636  IVMSFMSVSPRQTRQILENPTATPL  660



>gb|KCW54564.1| hypothetical protein EUGRSUZ_I00523, partial [Eucalyptus grandis]
Length=665

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 0/142 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YISFH +A QG ++N+ +GL+F
Sbjct  524  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYISFHKYANQGFFKNEFEGLIF  583

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQ    P I GE IL N +Q+++  SKWVDL+ L  M+++YRL+F  +IK  E + P +
Sbjct  584  PNQMGGSPTISGEEILRNYWQVEMGYSKWVDLATLLGMVVVYRLMFLGIIKAVEKMKPMV  643

Query  351  RGYIARRRMQQKNGNQTTTVAP  286
            + + A+     K+  +  +  P
Sbjct  644  KIFRAKSPRHPKHVMENPSSKP  665



>ref|XP_008385742.1| PREDICTED: ABC transporter G family member 15-like [Malus domestica]
Length=681

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ SG+FRL  D+PKPFWRYP+SYI +  WALQG Y+NDL GL F
Sbjct  516  FLMGIITGAGIMGILMMTSGFFRLLPDLPKPFWRYPISYIGYGSWALQGSYKNDLIGLEF  575

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +  +P  PK+ GE+I+ +IF I ++ SKW DL+ +F ++IIYR++FF+++K  E   P  
Sbjct  576  EPMTPGEPKLTGEYIIRHIFGIPIDHSKWWDLAAVFAILIIYRVLFFLILKFKESALPVF  635

Query  351  RGYIARRRMQQ  319
            +   A+R + +
Sbjct  636  QSLYAKRTLHR  646



>gb|KCW54566.1| hypothetical protein EUGRSUZ_I00526 [Eucalyptus grandis]
Length=622

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PK FWRYPM YISFH +A QG ++N+ +GL+F
Sbjct  481  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKAFWRYPMYYISFHKYANQGFFKNEFEGLIF  540

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQ    P I GE IL N +Q+++  SKWVDL++L  M+++YRL+F  +IK  E + P +
Sbjct  541  PNQMEGSPTISGEEILRNYWQVEMGYSKWVDLAILLGMVVVYRLMFLGIIKAAEKMKPLV  600

Query  351  RGYIARRRMQQKN  313
            + + A+     K+
Sbjct  601  KNFRAKSPRHPKH  613



>ref|XP_010939685.1| PREDICTED: ABC transporter G family member 11-like [Elaeis guineensis]
Length=745

 Score =   132 bits (332),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+  GL F
Sbjct  591  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHTYANQGFYKNEFLGLTF  650

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N Q+   P I GE IL +I+Q++++ SKWV+L++LF M+I+YR++F +++KI E V P 
Sbjct  651  PNDQAGGPPTISGEEILRDIWQVEMSYSKWVNLAILFGMVILYRILFLVIVKITEKVKPM  710

Query  354  IRGYIAR  334
            I+  + +
Sbjct  711  IKALLVK  717



>ref|XP_006466253.1| PREDICTED: ABC transporter G family member 11-like [Citrus sinensis]
Length=675

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML  G+FRLPND+PKP W+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  544  FLMGIITGAGIQGIMMLNGGFFRLPNDLPKPVWKYPMYYIAFHRYAFQGFYKNEFEGLTF  603

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ +L NI+Q+D+  +KW DL++LF M+  YR +F+++IK  E++ P 
Sbjct  604  PNNQAGGPPTITGKEVLTNIWQVDMGHTKWADLAILFGMLFFYRFLFWVIIKTTENLKPI  663

Query  354  IRGY  343
            IR +
Sbjct  664  IRSF  667



>ref|XP_010321482.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=530

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFW+YPM YI+FH +A QG Y+N+  GL F
Sbjct  391  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWKYPMYYIAFHKYANQGFYKNEFLGLNF  450

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+    P  I GE IL+N++Q+ +  SKWVD++++F M+I+YRL+F  +IK  E V P 
Sbjct  451  PNEQIRGPAMISGEEILKNVWQVQMGYSKWVDVAIIFGMVILYRLMFLGIIKTVEKVKPM  510

Query  354  IRGYIARRRMQQKNGNQTTT  295
            IR ++A       +   T +
Sbjct  511  IRAFMAHSSKNPTHAEDTDS  530



>ref|XP_010030452.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW54562.1| hypothetical protein EUGRSUZ_I00521 [Eucalyptus grandis]
Length=709

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGI+TGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YISFH +A QG ++N+ +GL+F
Sbjct  568  FLMGIVTGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYISFHKYANQGFFKNEFEGLMF  627

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQ    P I GE IL N +Q+++  SKWVDL++L  M++IYRL+F  +IK  E + P +
Sbjct  628  PNQMAGSPTIGGEEILRNYWQVEMGYSKWVDLAILLGMVVIYRLMFLGIIKAAEKMKPLV  687

Query  351  RGYIAR  334
            + + A+
Sbjct  688  KNFRAK  693



>ref|XP_010267240.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=743

 Score =   131 bits (330),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP W+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  602  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWKYPMYYIAFHKYANQGFYKNEFEGLTF  661

Query  531  DNQSPDLP-KIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P  I GE IL N +Q+++  SKWVDL++LF M+I+YRL+F+ +IK  E + P 
Sbjct  662  PNNLAGGPATISGEEILRNTWQVEMGYSKWVDLAILFGMVILYRLMFWAIIKTVEKLKPI  721

Query  354  IRGYIA  337
            IR ++A
Sbjct  722  IRAFLA  727



>gb|EPS62736.1| hypothetical protein M569_12052, partial [Genlisea aurea]
Length=613

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ +G+FRL  D+PKPFWRYP+SYI +  W+LQG Y+ND+ G+VF
Sbjct  445  FLMGIITGAGVLGIMMMTAGFFRLLPDLPKPFWRYPISYIGYGSWSLQGAYKNDMLGMVF  504

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PKI GE +L  +F++ ++ SKW DL +LFC+I+ YR++FF+++K  E   P+ 
Sbjct  505  DPLVPGDPKIRGEDVLRQMFKLSLDHSKWWDLFILFCLILCYRVLFFVILKTREKTGPYF  564

Query  351  RGYIARRRMQQ  319
            +   ++R + +
Sbjct  565  QSLYSKRVLHR  575



>ref|XP_010030454.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
Length=713

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PK FWRYPM YISFH +A QG ++N+ +GL+F
Sbjct  572  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKAFWRYPMYYISFHKYANQGFFKNEFEGLIF  631

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             NQ    P I GE IL N +Q+++  SKWVDL++L  M+++YRL+F  +IK  E + P +
Sbjct  632  PNQMEGSPTISGEEILRNYWQVEMGYSKWVDLAILLGMVVVYRLMFLGIIKAAEKMKPLV  691

Query  351  RGYIARRRMQQKN  313
            + + A+     K+
Sbjct  692  KNFRAKSPRHPKH  704



>ref|XP_006366225.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=733

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFW+YPM YI+FH +A QG Y+N+  GL F
Sbjct  594  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWKYPMYYIAFHKYANQGFYKNEFLGLNF  653

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+    P  I GE IL N++Q+ +  SKWVD+++LF M+I+YRL+F  +IK  E + P 
Sbjct  654  PNEQIRGPAIISGEEILRNVWQVQMGYSKWVDVAILFGMVILYRLMFLGIIKTVEKIKPM  713

Query  354  IRGYIAR  334
            IR ++AR
Sbjct  714  IRAFMAR  720



>ref|XP_006856991.1| hypothetical protein AMTR_s00325p00013820 [Amborella trichopoda]
 gb|ERN18458.1| hypothetical protein AMTR_s00325p00013820 [Amborella trichopoda]
Length=157

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+Q I +L  G+FRLPND+PKP W+YPM YISFH +A QG Y+N+ +GL F
Sbjct  18   FLMGIITGAGVQVIMILNGGFFRLPNDLPKPVWKYPMFYISFHKYANQGLYKNEFEGLAF  77

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P  I GE IL   +Q+++  SKWVDL +L  M++ YRL+F  ++K++E   P 
Sbjct  78   PNGLVGGPATIIGESILRETWQMEMGYSKWVDLGILMGMVVFYRLMFLGILKLSEKARPV  137

Query  354  IRGYIARRRMQ  322
            +RG++ R R Q
Sbjct  138  VRGFLVRHRKQ  148



>ref|XP_006387838.1| hypothetical protein POPTR_0530s002102g, partial [Populus trichocarpa]
 gb|ERP46752.1| hypothetical protein POPTR_0530s002102g, partial [Populus trichocarpa]
Length=350

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  209  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFEGLTF  268

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +N +   P I GE IL+N +Q+++  SKW+D+++L  M+I+YRL+F  +IK+ E V P 
Sbjct  269  PNNLAGGPPTITGEEILKNTWQVEMGYSKWIDIAILLGMVILYRLMFLGIIKLVEKVKPI  328

Query  354  IRGYIA  337
            IR   A
Sbjct  329  IRAAFA  334



>ref|XP_008790946.1| PREDICTED: ABC transporter G family member 15-like [Phoenix dactylifera]
Length=697

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGIITGAG+ GI M+ +GYFRL  D+PK FWRYP+S IS+  WALQG Y+NDL GL F
Sbjct  532  YLMGIITGAGVIGIMMMTAGYFRLLRDLPKLFWRYPVSIISYGSWALQGNYKNDLIGLEF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ GE+IL+N   I +  SKWVDL+ +F +++ YRL+FF+++K+ E  TP +
Sbjct  592  DPLIPGDPKLSGEYILKNFLGISLEHSKWVDLTAVFVILVCYRLLFFLILKLKERATPLL  651

Query  351  RGYIARRRMQQ  319
            R   AR  M+ 
Sbjct  652  RIIYARITMKH  662



>ref|XP_010267226.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=749

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  608  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  667

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P  I GE IL N +Q+++  SKWVDL++LF M+++YR +F+ +IK  E V P 
Sbjct  668  PNNLAGGPATITGEEILRNTWQVEMGYSKWVDLAILFGMVVLYRFMFWAIIKTAEKVKPI  727

Query  354  IRGYIA  337
            IR ++A
Sbjct  728  IRAFLA  733



>ref|XP_006366235.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=660

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFW+YPM YI+FH +  QG Y+N+  GL F
Sbjct  521  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWKYPMYYIAFHKYVNQGFYKNEFLGLNF  580

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+    P  I GE IL N++Q+ +  SKWVD+++LF M+I+YR +F  +IK  E V P 
Sbjct  581  PNEQIRGPAIISGEEILRNVWQVQMGYSKWVDVAILFGMVILYRFMFLGMIKTVEKVKPI  640

Query  354  IRGYIAR  334
            IR ++AR
Sbjct  641  IRAFMAR  647



>ref|XP_008381985.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
Length=740

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A +G Y+N+ +GL F
Sbjct  596  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANEGFYKNEFEGLTF  655

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+     I GE IL +++Q+ +  SKWVDL++LF M+I+YRL+F  +IK  E V P 
Sbjct  656  PNNQAEGYSTINGEEILRSVWQVQMGYSKWVDLAILFGMVIVYRLMFLGIIKFTEKVVPI  715

Query  354  IRGYI  340
            I+  I
Sbjct  716  IKALI  720



>ref|XP_007214812.1| hypothetical protein PRUPE_ppa002358m1g, partial [Prunus persica]
 gb|EMJ16011.1| hypothetical protein PRUPE_ppa002358m1g, partial [Prunus persica]
Length=579

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ SG+FRL  D+PKPFWRYP+SY+S+  W +QG Y+ND  GL F
Sbjct  414  FLMGIITGAGIMGILMMTSGFFRLLPDLPKPFWRYPVSYLSYGSWGIQGAYKNDFLGLEF  473

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ G+FI++++F I ++ SKW DL+ +  ++++YR++FF+++K  E+ +P  
Sbjct  474  DPMIPGDPKLTGDFIIQHMFGIPIDHSKWWDLAAIVAILVLYRVLFFVILKFKENASPLF  533

Query  351  RGYIARRRMQQ  319
            +   A+R +Q+
Sbjct  534  QTLYAKRTLQK  544



>ref|XP_006426350.1| hypothetical protein CICLE_v10025064mg [Citrus clementina]
 gb|ESR39590.1| hypothetical protein CICLE_v10025064mg [Citrus clementina]
Length=678

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML  G+FRLPND+PKP W+YPM YI+FH +  QG Y+N+ +GL F
Sbjct  544  FLMGIITGAGIQGIMMLNGGFFRLPNDLPKPVWKYPMYYIAFHRYTFQGFYKNEFEGLTF  603

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +NQ+   P I G+ +L NI+Q+D+  +KWVDL++LF M
Sbjct  604  PNNQAGGPPTITGKEVLTNIWQVDMGHTKWVDLAILFGM  642



>ref|XP_006387247.1| hypothetical protein POPTR_1429s00210g [Populus trichocarpa]
 gb|ERP46161.1| hypothetical protein POPTR_1429s00210g [Populus trichocarpa]
Length=168

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ   +L  G+FRLPND+P+PFW+YPM YI+FH +A QG ++N+ +GL F
Sbjct  18   FLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTF  77

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
              NQ+     IPGE IL + +Q+++  SKWVDL++L  M+++YR++F ++IK  E + P 
Sbjct  78   PSNQAGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEKIKPI  137

Query  354  IRGYIARRRMQ  322
            I   ++ R  Q
Sbjct  138  ITAIVSVRPKQ  148



>ref|XP_002306299.2| hypothetical protein POPTR_0005s07420g [Populus trichocarpa]
 gb|EEE93295.2| hypothetical protein POPTR_0005s07420g [Populus trichocarpa]
Length=729

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  595  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  654

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +N +   P I GE IL+N +Q+++  SKW+D+++L  M+I+YRL+F  +IK+ E V P 
Sbjct  655  PNNLAGGPPTITGEEILKNTWQVEMGYSKWIDIAILLGMVILYRLMFLGIIKLVEKVKPI  714

Query  354  IRGYIARRRMQQKN  313
            IR   A    Q K+
Sbjct  715  IRAAFAGAPRQSKH  728



>ref|XP_010937387.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Elaeis guineensis]
Length=735

 Score =   129 bits (324),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 67/127 (53%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+  GL F
Sbjct  591  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLGLTF  650

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL + +Q+++  SKW+DL++LF M+I+YR++F +++KI E V P 
Sbjct  651  PNNQAGGPPTITGEEILRDTWQVEMGYSKWIDLAILFGMVILYRVLFLLIVKITEKVKPM  710

Query  354  IRGYIAR  334
            +   + +
Sbjct  711  MNALLVK  717



>ref|XP_011031060.1| PREDICTED: ABC transporter G family member 11-like [Populus euphratica]
Length=729

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  595  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTF  654

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +N +   P I GE IL+N +Q+++  SKW+D+++L  M+I+YRL+F  +IK+ E V P 
Sbjct  655  PNNLAGGPPTITGEEILKNTWQVEMGYSKWIDIAILLGMVILYRLMFLGIIKLVEKVKPI  714

Query  354  IRGYIARRRMQQKN  313
            IR   A    Q K+
Sbjct  715  IRAAFAVAPRQSKH  728



>ref|XP_004288175.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=715

 Score =   129 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 66/125 (53%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG+ITG+GI G+ +L  G+FR PND+PKPFWRYPM YI FH +  QG Y+N+ +GL F
Sbjct  591  FLMGVITGSGILGVMLLNGGFFRKPNDMPKPFWRYPMYYIGFHNYVNQGLYKNEFEGLTF  650

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I GE IL++++Q+++  SKWVD ++LF M+I+YRL+FF +IK NE ++P 
Sbjct  651  PNNQVGGPPTITGEEILKSMWQMEMGHSKWVDFAILFGMVIVYRLMFFGIIKTNEKLSPI  710

Query  354  IRGYI  340
            I+ ++
Sbjct  711  IKAFL  715



>ref|XP_006827842.1| hypothetical protein AMTR_s00008p00021210 [Amborella trichopoda]
 gb|ERM95258.1| hypothetical protein AMTR_s00008p00021210 [Amborella trichopoda]
Length=721

 Score =   129 bits (323),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 69/131 (53%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ I +L  G+FRLPND+PKPFW+YPM YISFH +A QG Y+N+ +GL F
Sbjct  582  FLMGIITGAGIQAIMILNGGFFRLPNDLPKPFWKYPMYYISFHKYANQGLYKNEFEGLTF  641

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N        I GE IL   +Q+++  SKWVDL +L  M++ YRL+F  +IK++E   P 
Sbjct  642  PNGYVGGRATITGESILRETWQMEMGYSKWVDLGILMGMVVFYRLMFLGIIKLSEKARPV  701

Query  354  IRGYIARRRMQ  322
            +R ++ R R Q
Sbjct  702  VRSFLVRHRKQ  712



>ref|XP_007211388.1| hypothetical protein PRUPE_ppa003183mg [Prunus persica]
 gb|EMJ12587.1| hypothetical protein PRUPE_ppa003183mg [Prunus persica]
Length=595

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 111/178 (62%), Gaps = 23/178 (13%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMG+I GAG  GI M+ +G+FRLP DIPKP WRYP+SY+++  WALQG+Y+N L G  F
Sbjct  431  YLMGVIVGAGYLGIMMMTAGFFRLPPDIPKPVWRYPISYLNYGAWALQGEYKNALVGREF  490

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D++ P+ PK+ G++IL  I  I+++ SKW DL+ +  +++ +R+IFFI++K+ E  +P+ 
Sbjct  491  DSREPNGPKLKGDYILTTIAGINLDHSKWWDLAAVVAILVSFRIIFFIILKLKERASPYF  550

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK*IKTRIINHRLQPVKPL  178
            R Y A+  ++              L + PS R  +  P+K          R QP+ PL
Sbjct  551  RTYYAKHTLKH-------------LKKRPSFRKESPFPSK----------RHQPLHPL  585



>gb|ABR25920.1| cer5 [Oryza sativa Indica Group]
Length=181

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 96/141 (68%), Gaps = 3/141 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG+I GAG+ GI ML SG+FRL  ++PK FWRYP+SYI +  W L+G Y+NDL GL F
Sbjct  12   FLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWRYPVSYIVYGSWGLKGAYKNDLIGLEF  71

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GE+I+  +  + +N SKW+DLS++F ++  YRLIFF+V+K  E   P+I
Sbjct  72   EPMMPGQPKLTGEYIITKMMGLSLNHSKWLDLSMIFVLLFAYRLIFFLVLKAKEAAAPYI  131

Query  351  RGYIAR---RRMQQKNGNQTT  298
            R    R   +R++++   + T
Sbjct  132  RVAYTRFTIKRLERRASFRKT  152



>gb|EYU23962.1| hypothetical protein MIMGU_mgv1a002102mg [Erythranthe guttata]
Length=714

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM YI+FH +A QG ++N+ +GL F
Sbjct  584  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYADQGFFKNEFEGLTF  643

Query  531  DNQ-SPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+ +     I GE IL N++Q+++  SKW+D+++LF M+++YR +F  +IK  E   P 
Sbjct  644  PNELAGGAATITGEEILRNVWQVEMGYSKWIDVAILFGMVVLYRFMFLGIIKAKEKFRPM  703

Query  354  IRGYIA  337
            IR ++A
Sbjct  704  IRAFLA  709



>ref|XP_009350583.1| PREDICTED: ABC transporter G family member 15-like [Pyrus x bretschneideri]
 ref|XP_009350584.1| PREDICTED: ABC transporter G family member 15-like [Pyrus x bretschneideri]
Length=681

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ +G+FRL  D+PKPFWRYP+SY+++  WALQG Y+NDL GL F
Sbjct  516  FLMGIITGAGIMGILMMTAGFFRLLPDLPKPFWRYPISYLAYGSWALQGAYKNDLIGLEF  575

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GE+I+ +IF I ++ SKW DL+ +  ++ +YR++FF+++K  E   P  
Sbjct  576  EPMIPGEPKLTGEYIIRHIFGIPIDHSKWWDLAAVLAILTMYRVLFFLILKFKESALPVF  635

Query  351  RGYIARRRMQQ  319
            +   A+R + +
Sbjct  636  QSLYAKRTLHR  646



>ref|XP_009366090.1| PREDICTED: ABC transporter G family member 15-like [Pyrus x bretschneideri]
Length=681

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ +G+FRL  D+PKPFWRYP+SY+++  WALQG Y+NDL GL F
Sbjct  516  FLMGIITGAGIMGILMMTAGFFRLLPDLPKPFWRYPISYLAYGSWALQGAYKNDLIGLEF  575

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GE+I+ +IF I ++ SKW DL+ +  ++ +YR++FF+++K  E   P  
Sbjct  576  EPMIPGEPKLTGEYIIRHIFGIPIDHSKWWDLAAVLAILTMYRVLFFLILKFKESALPVF  635

Query  351  RGYIARRRMQQ  319
            +   A+R + +
Sbjct  636  QSLYAKRTLHR  646



>ref|XP_009760682.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
sylvestris]
Length=741

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+P PFW+YPM YI+FH +A QG Y+N+  GL F
Sbjct  597  FLMGIITGAGIQGVMMLNGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFLGLTF  656

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+    P  I G+ IL NI+Q+ +  SKWVD++++F M+I+YR +F  +IKI E V P 
Sbjct  657  PNEQIGGPATITGDEILRNIWQVQMGYSKWVDVAIVFGMVILYRFMFLGIIKIVEKVKPM  716

Query  354  IRGYIAR  334
            IR ++AR
Sbjct  717  IRAFMAR  723



>gb|KCW51153.1| hypothetical protein EUGRSUZ_J00746 [Eucalyptus grandis]
Length=649

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAG   I M+ SGYFR   D+P+ FWRYP+SYI++  WALQG Y+NDL GL F
Sbjct  484  FLMGIILGAGYMAIVMMTSGYFRSLPDLPRAFWRYPLSYINYGAWALQGAYKNDLIGLEF  543

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+  PD PK+ GE +L NI  I  N SKW DL+ L  ++I YRL+FF ++K  E  +P +
Sbjct  544  DSPVPDGPKLKGELVLTNILGIKHNYSKWWDLAALLTILICYRLLFFAILKFKERASPIV  603

Query  351  RGYIARRRMQQ  319
            R   A+R ++Q
Sbjct  604  RSLHAKRTLRQ  614



>ref|XP_007207212.1| hypothetical protein PRUPE_ppa001905mg [Prunus persica]
 gb|EMJ08411.1| hypothetical protein PRUPE_ppa001905mg [Prunus persica]
Length=744

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A +G Y+N+ +GL F
Sbjct  612  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANEGFYKNEFEGLTF  671

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P  I GE IL +I+Q+ +  SKWVDL++LF M+I+YRL+F  +IK  E   P 
Sbjct  672  PNDQAARPSTITGEEILRSIWQVQMGYSKWVDLAILFGMVIVYRLMFLGIIKTTEKFVPI  731

Query  354  IRGYI  340
            I+  +
Sbjct  732  IKALL  736



>ref|XP_008790912.1| PREDICTED: ABC transporter G family member 11-like [Phoenix dactylifera]
Length=708

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP WRYPM Y++FH +A QG Y+N+  GL F
Sbjct  559  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYVAFHTYANQGFYKNEFLGLTF  618

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N Q+   P I GE IL +I+Q++++ SKWV+L++LF M+I+YR++F +++KI E V P 
Sbjct  619  PNDQAGGPPTISGEEILRDIWQVEMSYSKWVNLAILFGMVILYRVLFLVIVKITEKVKPM  678

Query  354  IRGYIAR  334
            I+  + +
Sbjct  679  IKALLVK  685



>ref|XP_008810494.1| PREDICTED: ABC transporter G family member 11-like [Phoenix dactylifera]
Length=388

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ +L  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+  GL F
Sbjct  253  FLMGIITGAGIQGVMILNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLGLTF  312

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL   +Q+++  SKW+DL+VLF M+I+YR++F +++KI E V P 
Sbjct  313  PNNQAGGPPTITGEEILRGFWQVEMGYSKWIDLAVLFGMVILYRVLFLVIVKITEKVKPM  372

Query  354  IRGYIARRRMQQ  319
            ++  +   ++  
Sbjct  373  MKALLVMEQLSS  384



>ref|XP_010031767.1| PREDICTED: ABC transporter G family member 15-like [Eucalyptus 
grandis]
 gb|KCW51152.1| hypothetical protein EUGRSUZ_J00746 [Eucalyptus grandis]
Length=689

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAG   I M+ SGYFR   D+P+ FWRYP+SYI++  WALQG Y+NDL GL F
Sbjct  524  FLMGIILGAGYMAIVMMTSGYFRSLPDLPRAFWRYPLSYINYGAWALQGAYKNDLIGLEF  583

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D+  PD PK+ GE +L NI  I  N SKW DL+ L  ++I YRL+FF ++K  E  +P +
Sbjct  584  DSPVPDGPKLKGELVLTNILGIKHNYSKWWDLAALLTILICYRLLFFAILKFKERASPIV  643

Query  351  RGYIARRRMQQ  319
            R   A+R ++Q
Sbjct  644  RSLHAKRTLRQ  654



>ref|XP_004250920.1| PREDICTED: ABC transporter G family member 15-like [Solanum lycopersicum]
Length=682

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ +G+FRL  D+PKP WRYP+S+I +  W LQG Y+ND+ GLVF
Sbjct  516  FLMGIITGAGVLGIMMMTAGFFRLLPDLPKPIWRYPISFIGYGAWGLQGSYKNDMIGLVF  575

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ GE ++ N+F++ ++ SKW DL  L+ +I++YR++FFI++K+ E  TP+ 
Sbjct  576  DPLIPGGEKLKGEDVITNMFKLSLDHSKWWDLLALYSLIVMYRVLFFIILKLKERATPFF  635

Query  351  RGYIARRRMQQ  319
            R   A+R M Q
Sbjct  636  RSMYAKRTMHQ  646



>ref|XP_008791489.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
11-like [Phoenix dactylifera]
Length=706

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+  GL F
Sbjct  562  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLGLTF  621

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL   +Q+++  SKW+DL+VLF M+I+YR++F +++KI E V P 
Sbjct  622  PNNQAGGPPTITGEEILRGTWQVEMGYSKWIDLAVLFGMVILYRVLFLVIVKITEKVKPM  681

Query  354  IRGYIARRRMQQKN  313
            ++  + +   Q  +
Sbjct  682  MKALLVKPPKQSTH  695



>ref|XP_001782684.1| ATP-binding cassette transporter, subfamily G, member 28, group 
WBC protein PpABCG28 [Physcomitrella patens]
 gb|EDQ52515.1| ATP-binding cassette transporter, subfamily G, member 28, group 
WBC protein PpABCG28 [Physcomitrella patens]
Length=686

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 4/140 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLV+G+FRL +D+PKP WRYP+SYI F  +ALQG Y+N+  G  F
Sbjct  516  FLMGIITGAGIQGIFMLVAGFFRLIDDLPKPVWRYPLSYIGFDMYALQGMYKNEFTGYTF  575

Query  531  DNQSPD----LPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDV  364
            DN   D     P IPG +++  ++ +   R KW DL +LF MI +YRLIFFI IK++E +
Sbjct  576  DNFVLDGKSIGPPIPGWYVIRELYGMKTTRGKWDDLYILFGMIFVYRLIFFICIKLHEHL  635

Query  363  TPWIRGYIARRRMQQKNGNQ  304
             P++R  + + R  +K  N+
Sbjct  636  GPYLRLKLTQYRTNRKLSNK  655



>ref|XP_009803747.1| PREDICTED: ABC transporter G family member 15-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009803748.1| PREDICTED: ABC transporter G family member 15-like isoform X2 
[Nicotiana sylvestris]
Length=597

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ +G+FRL  D+PKP WRYP+S++ +  W LQG Y+ND+ GLVF
Sbjct  431  FLMGIITGAGVLGIMMMTAGFFRLLPDLPKPIWRYPISFLGYGAWGLQGAYKNDMIGLVF  490

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ GE ++ N+F++ ++ SKW DL  L+ +I++YRL+FFI++K+ E  TP+ 
Sbjct  491  DPLIPGGEKLKGEDVITNMFKLSLDHSKWWDLLALYALILMYRLLFFIILKLKERATPFF  550

Query  351  RGYIARRRMQQ  319
            R   A+R M Q
Sbjct  551  RSMYAKRTMHQ  561



>dbj|BAL46500.1| ABC transporter [Diospyros kaki]
Length=738

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+P+PFWRYPM YISFH +A QG Y+N+ +GL+F
Sbjct  605  FLMGIITGAGIQGVLMLNGGFFRLPNDLPEPFWRYPMYYISFHKYAYQGFYKNEFEGLIF  664

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P  I GE IL N +Q+ +  SKWVDL++L  M+++YR +F  ++K  E V P 
Sbjct  665  PNNEVRQPATITGEEILRNTWQVGMGYSKWVDLAILLGMVVLYRFMFLGIVKFIEKVKPI  724

Query  354  IR  349
            +R
Sbjct  725  LR  726



>dbj|BAJ94888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=734

 Score =   127 bits (319),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 66/127 (52%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+P P WRYPM Y++FH +A QG Y+N+  GL F
Sbjct  589  FLMGIITGAGIQGVMMLNGGFFRLPHDLPNPVWRYPMYYVAFHKYANQGFYKNEFLGLTF  648

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ      I G+ IL + +Q+++  SKWVDL+VLF M+I+YR++F  ++K+ E V P 
Sbjct  649  PNNQVGGATTITGDEILRDYWQVEMGYSKWVDLAVLFGMVILYRVLFLAIMKLTEKVKPM  708

Query  354  IRGYIAR  334
            ++G  +R
Sbjct  709  VKGLGSR  715



>ref|XP_010269756.1| PREDICTED: ABC transporter G family member 15-like [Nelumbo nucifera]
Length=705

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL+G+ITGAGI  I M+ SG+FRL  D+PKPFWRYP+SY++F  WALQG Y+NDL GL F
Sbjct  542  FLLGVITGAGIIAILMMTSGFFRLLRDLPKPFWRYPISYVNFCSWALQGAYKNDLIGLEF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
               SP  PK+ GE I++ +  I ++ SKW DLS++  ++I YR++F I++K NE  TP +
Sbjct  602  YPSSPGEPKLKGEDIIQKMLGIQLDHSKWWDLSIVILILIAYRILFLIILKFNEKATPLL  661

Query  351  RGYIARRRMQQ  319
            R   A+  +  
Sbjct  662  RSLYAKGTLHH  672



>ref|XP_002460384.1| hypothetical protein SORBIDRAFT_02g027350 [Sorghum bicolor]
 gb|EER96905.1| hypothetical protein SORBIDRAFT_02g027350 [Sorghum bicolor]
Length=729

 Score =   127 bits (318),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKP WRYPM Y++FH +A QG Y+N+  GL F
Sbjct  587  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPVWRYPMYYVAFHKYANQGLYKNEFLGLTF  646

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+     + G  IL + +Q+++  SKWVDL +L  M+++YR++F  ++K+ E V P 
Sbjct  647  PNNQAGGAATVSGGQILTDFWQVEMGYSKWVDLGILCGMVVLYRVLFLAIVKLTEKVKPM  706

Query  354  IRGYIAR  334
            I+G+  R
Sbjct  707  IKGFRFR  713



>ref|XP_008227333.1| PREDICTED: ABC transporter G family member 12-like [Prunus mume]
Length=693

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (62%), Gaps = 23/178 (13%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMG+I GAG  GI M+ +G+FRLP DIPKP WRYP+SY+++  WALQG+Y+N L G  F
Sbjct  528  YLMGVIVGAGYLGIMMMTAGFFRLPPDIPKPVWRYPISYLNYGAWALQGEYKNTLVGREF  587

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D++ P+ PK+ GE+IL  I  I+++ SKW DL+ +  +++ +R+IFFI++K+ E  +P+ 
Sbjct  588  DSREPNGPKLKGEYILTTIAGINLDHSKWWDLAAVVAILVSFRIIFFIILKLKERASPYF  647

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK*IKTRIINHRLQPVKPL  178
              Y A+  ++              L + PS R  A  P+K          R QP+ PL
Sbjct  648  WTYYAKHTLKH-------------LKKRPSFRKEAPFPSK----------RHQPLHPL  682



>ref|XP_002513520.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF48923.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=707

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG++TGAGI GI M+ SG+FRL  D+PKPFWRYP+SYI++  W LQG Y+ND  GL F
Sbjct  542  FLMGLVTGAGIIGIMMMTSGFFRLLPDLPKPFWRYPVSYINYGAWGLQGAYKNDFLGLEF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GEFI+ ++F + ++ SKW DLS++F +++ YR++FFIV+K  E  +P  
Sbjct  602  EPLVPGDPKLSGEFIVTHVFGVPLDHSKWWDLSIIFLILVCYRILFFIVLKFKERASPIF  661

Query  351  RGYIARRRMQQ  319
            +   ++R +Q+
Sbjct  662  KNLYSKRTLQK  672



>ref|XP_009387386.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=709

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKP WRYPM YI+FH +A QG Y+N+  GL+F
Sbjct  576  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPVWRYPMYYIAFHKYANQGFYKNEFLGLIF  635

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I G+ IL   +Q+++  SKW+DL++LF M+I+YRL+F  ++K  E + P 
Sbjct  636  PNNQAGGPPTITGDEILRETWQVEMGYSKWIDLAILFGMVILYRLMFLGIVKTVEKLKPI  695

Query  354  IRGYIAR  334
             +  +AR
Sbjct  696  FKSLMAR  702



>gb|EPS66360.1| hypothetical protein M569_08416, partial [Genlisea aurea]
Length=345

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG++TGAG+ GI M+ +G+FRL  D+PKPFWRYP+SYI +  W+LQG Y+ND+ G+VF
Sbjct  175  FLMGMVTGAGVLGIMMMTAGFFRLLPDLPKPFWRYPVSYIGYGAWSLQGAYKNDMLGMVF  234

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PKI GE ++ ++F++ ++ SKW DL  L+ +I+ YRL+FF V+K  E + P+ 
Sbjct  235  DPLIPGDPKIKGEDVIVHMFKLSLDHSKWWDLCALYSLIVCYRLLFFFVLKSRERIGPYF  294

Query  351  RGYIARRRMQQ  319
            +    +R M +
Sbjct  295  QSLYTKRVMHR  305



>ref|XP_009803746.1| PREDICTED: ABC transporter G family member 15-like isoform X1 
[Nicotiana sylvestris]
Length=685

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ +G+FRL  D+PKP WRYP+S++ +  W LQG Y+ND+ GLVF
Sbjct  519  FLMGIITGAGVLGIMMMTAGFFRLLPDLPKPIWRYPISFLGYGAWGLQGAYKNDMIGLVF  578

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ GE ++ N+F++ ++ SKW DL  L+ +I++YRL+FFI++K+ E  TP+ 
Sbjct  579  DPLIPGGEKLKGEDVITNMFKLSLDHSKWWDLLALYALILMYRLLFFIILKLKERATPFF  638

Query  351  RGYIARRRMQQ  319
            R   A+R M Q
Sbjct  639  RSMYAKRTMHQ  649



>ref|XP_002531674.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF30718.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=712

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+P PFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  582  FLMGIITGAGIQGVMMLNGGFFRLPDDLPDPFWRYPMYYIAFHKYANQGFYKNEFEGLTF  641

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL   +Q+++  SKWVDL+VLF M+++YRL+F  +IK+ E V P 
Sbjct  642  PNNQAGGPPTITGEEILTGFWQVEMGYSKWVDLAVLFGMVVLYRLMFLGIIKVVEKVKPI  701

Query  354  IR  349
            I+
Sbjct  702  IK  703



>ref|XP_009610304.1| PREDICTED: ABC transporter G family member 15 isoform X2 [Nicotiana 
tomentosiformis]
Length=597

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ G+ M+ +G+FRL  D+PKP WRYP+S++ +  W LQG Y+ND+ GLVF
Sbjct  431  FLMGIITGAGVLGLMMMTAGFFRLLPDLPKPIWRYPISFLGYGAWGLQGAYKNDMIGLVF  490

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ GE ++ N+F++ ++ SKW DL  L+ +I++YRL+FFI++K+ E  TP+ 
Sbjct  491  DPLIPGGEKLKGEDVITNMFKLSLDHSKWWDLLALYALILMYRLLFFIILKLKERATPFF  550

Query  351  RGYIARRRMQQ  319
            R   A+R M Q
Sbjct  551  RSMYAKRTMHQ  561



>ref|XP_002525837.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF36531.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=701

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ + +L  G+FRLP D+P PFW+YPM YI+FH +A QG ++N+ +GL F
Sbjct  552  FLMGIITGAGIQSLMILAGGFFRLPRDLPAPFWKYPMHYIAFHRYAYQGMFKNEFEGLTF  611

Query  531  DNQSPDLP-KIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P ++ GE IL NI+Q+D++ SKWVDL++L  M+++YRL+F  +I I E V P 
Sbjct  612  PNNQIGGPSEVSGEEILRNIWQVDLSYSKWVDLAILLGMVVVYRLLFLGIISIKEKVKPM  671

Query  354  IRGYIA  337
            I   I+
Sbjct  672  ITALIS  677



>ref|XP_006365197.1| PREDICTED: ABC transporter G family member 15-like [Solanum tuberosum]
Length=682

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ +G+FRL  D+PKP WRYP+S+I +  W LQG Y+ND+ GL F
Sbjct  516  FLMGIITGAGVLGIMMMTAGFFRLLPDLPKPIWRYPISFIGYGAWGLQGSYKNDMIGLEF  575

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ GE+++ N+F++ ++ SKW DL  L+ +I++YRL+FFI++K+ E  TP+ 
Sbjct  576  DPLIPGGEKLTGEYVITNMFKLSLDHSKWWDLLALYSLIVMYRLLFFIILKLKERATPFF  635

Query  351  RGYIARRRMQQ  319
            R   A+R M +
Sbjct  636  RSMYAKRTMHK  646



>emb|CDP09283.1| unnamed protein product [Coffea canephora]
Length=689

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 104/161 (65%), Gaps = 13/161 (8%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGII GAG+ GI M+ +G+FRL  D+PK FWRYP+S +S+  W+LQG Y+NDL G+VF
Sbjct  524  FLMGIIAGAGVLGIMMMTAGFFRLLPDLPKVFWRYPVSLMSYGSWSLQGGYKNDLVGVVF  583

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ GE +L+N+F + ++ SKW DL  L+C+ + YR++FF+++K+ E  TP+ 
Sbjct  584  DGLWPGDPKLNGEDVLKNMFGLSLDHSKWWDLFALYCLFLTYRVLFFVILKLKERTTPFF  643

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            R   A+R +               L + PS R   + P+++
Sbjct  644  RSLYAKRTIHY-------------LKRRPSFRRKPSFPSRR  671



>ref|XP_002314084.1| ABC transporter-related family protein [Populus trichocarpa]
 gb|EEE88039.1| ABC transporter-related family protein [Populus trichocarpa]
Length=707

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG+ITGAGI GI M+ SG+FRL  D+PKPFWRYP+SYI++  W +QG Y+ND  GL F
Sbjct  542  FLMGLITGAGIIGIMMMTSGFFRLLPDLPKPFWRYPVSYINYGAWGIQGAYKNDFLGLEF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PKIPGEF++  +F I ++ SKW DLS ++ +++ YR++FFIV+K+ E   P++
Sbjct  602  DPLIPGDPKIPGEFVITRMFGIPLDYSKWWDLSAIYLILVCYRILFFIVLKLKERAVPFV  661

Query  351  RGYIARRRMQ  322
                ++R + 
Sbjct  662  EDLYSKRTLH  671



>ref|XP_004955969.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Setaria italica]
Length=697

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL+GIITG+GIQG+ ML +G+FRLP+D+PKP W+YP  YIS+H +A QG Y+N+  GL F
Sbjct  571  FLLGIITGSGIQGLLMLNAGFFRLPSDLPKPIWKYPTYYISYHKYATQGLYKNEFLGLAF  630

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +N   +   I GE+IL+   Q+++  SKWVDL++LF M++IYR++F ++IK+ E V P I
Sbjct  631  ENLGGEGLTISGEYILKTYLQVEMGYSKWVDLAILFAMVLIYRVLFLVIIKVGEAVRPMI  690

Query  351  R  349
            +
Sbjct  691  K  691



>gb|KDP40917.1| hypothetical protein JCGZ_24916 [Jatropha curcas]
Length=662

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+QG+ ML  G+FRLPND+P PFW+YPM YI+FH +A QG ++N+ +GL F
Sbjct  514  FLMGIITGAGLQGLMMLAGGFFRLPNDLPIPFWKYPMYYIAFHRYAYQGLFKNEFEGLKF  573

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     PK I GE IL + +Q++++ SKWVDL++LF M+++YR++F ++IKI E V P 
Sbjct  574  ANYISGGPKMISGEEILRDDWQVELSYSKWVDLAILFGMVVLYRVLFLVIIKIKEKVKPL  633

Query  354  IRGYIA  337
            I  +++
Sbjct  634  ISDFMS  639



>ref|XP_007015111.1| ABC-2 type transporter family protein isoform 1 [Theobroma cacao]
 gb|EOY32730.1| ABC-2 type transporter family protein isoform 1 [Theobroma cacao]
Length=685

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 13/161 (8%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGI+TGAGI GI M+ SG+FRL  D+PK FWRYP+SYISF  WALQG Y+ND  GL F
Sbjct  520  YLMGIVTGAGIIGIIMMTSGFFRLLPDLPKIFWRYPISYISFSSWALQGAYKNDFIGLEF  579

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ GE I+   F + V+RSKW DLS +  +++ YRL+FF ++KI E  +P +
Sbjct  580  DPLLPGDPKLTGEEIITKYFGVPVDRSKWWDLSAVVLILVCYRLLFFSILKIKERASPLV  639

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
            +   A+R +Q              L++ PS R   +  +K+
Sbjct  640  QEIYAKRTLQH-------------LSKRPSFRKTPSFASKR  667



>ref|XP_009610303.1| PREDICTED: ABC transporter G family member 15 isoform X1 [Nicotiana 
tomentosiformis]
Length=685

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ G+ M+ +G+FRL  D+PKP WRYP+S++ +  W LQG Y+ND+ GLVF
Sbjct  519  FLMGIITGAGVLGLMMMTAGFFRLLPDLPKPIWRYPISFLGYGAWGLQGAYKNDMIGLVF  578

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ GE ++ N+F++ ++ SKW DL  L+ +I++YRL+FFI++K+ E  TP+ 
Sbjct  579  DPLIPGGEKLKGEDVITNMFKLSLDHSKWWDLLALYALILMYRLLFFIILKLKERATPFF  638

Query  351  RGYIARRRMQQ  319
            R   A+R M Q
Sbjct  639  RSMYAKRTMHQ  649



>gb|KDP29717.1| hypothetical protein JCGZ_18652 [Jatropha curcas]
Length=690

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP D+PKPFWRYPM YI+FH +A +G Y+N+ +GL F
Sbjct  562  FLMGIITGAGIQGVMMLNGGFFRLPEDLPKPFWRYPMYYIAFHKYANEGFYKNEFEGLTF  621

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N     P  + GE IL + +Q+++  SKW+DL++LF M+I+YRL+F  +IK+ E + P 
Sbjct  622  PNDKVGGPATVSGEEILTSFWQVEMGYSKWIDLTILFGMVILYRLMFLGIIKLVEKLKPI  681

Query  354  IRGYIARR  331
            I+ +++ R
Sbjct  682  IKAFVSAR  689



>ref|XP_010937388.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Elaeis guineensis]
Length=704

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+  GL F
Sbjct  560  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLGLTF  619

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ+   P I GE IL + +Q+++  SKW+DL++LF M+I+YR++F +++KI E V P 
Sbjct  620  PNNQAGGPPTITGEEILRDTWQVEMGYSKWIDLAILFGMVILYRVLFLLIVKITEKVKPM  679

Query  354  IRGYIARRRMQQKN  313
            +   + +   Q  +
Sbjct  680  MNALLVKPPKQSTH  693



>gb|EEC81874.1| hypothetical protein OsI_25665 [Oryza sativa Indica Group]
Length=753

 Score =   125 bits (314),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 68/135 (50%), Positives = 100/135 (74%), Gaps = 4/135 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL+GIITG+G+QG+ ML +G+FRLP+D+PKP W+YP  +IS+H +A QG Y+N+L GLVF
Sbjct  601  FLLGIITGSGVQGVLMLNAGFFRLPSDLPKPVWKYPTYFISYHKYATQGLYKNELLGLVF  660

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            ++       I GE+IL+N  Q++++ SKWVDL++L  MIIIYR++F ++IKI+E V P +
Sbjct  661  EDIGGGGLTISGEYILKNYLQVELSYSKWVDLAILVAMIIIYRVLFLVIIKISEIVKPRM  720

Query  351  RGYI----ARRRMQQ  319
              ++    A R  QQ
Sbjct  721  LHFLCASKATRNQQQ  735



>gb|EYU23963.1| hypothetical protein MIMGU_mgv1a018782mg [Erythranthe guttata]
Length=687

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFWRYPM  I+FH +A QG ++N+ +GL F
Sbjct  557  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYNIAFHKYADQGFFKNEFEGLTF  616

Query  531  DNQ-SPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+ +     I GE IL N++Q+++  SKW+D+++LF M+++YR +F  +IK  E   P 
Sbjct  617  PNELAGGAATITGEEILRNVWQVEMGYSKWIDVAILFGMVVLYRFMFLGIIKAKEKFRPM  676

Query  354  IRGYIA  337
            IR ++A
Sbjct  677  IRAFLA  682



>ref|XP_002270573.2| PREDICTED: ABC transporter G family member 11 [Vitis vinifera]
Length=687

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 99/142 (70%), Gaps = 3/142 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D PKPFWRYP+ Y+SF+ +A QG Y+N+ +GL F
Sbjct  535  FLMGIITGAGIQGLLMLSGGFFRLPDDFPKPFWRYPLYYLSFNKYAYQGLYKNEFQGLKF  594

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N ++   P I GE IL   +Q+++  SKW+DL++L  M ++YRL+F I IK  E V P 
Sbjct  595  PNDEAGGPPIISGEEILRKRWQVEMVYSKWIDLAILLGMAVLYRLLFLITIKTTEKVIPL  654

Query  354  IRGYIAR--RRMQQKNGNQTTT  295
            ++  ++R  +R +Q   N + T
Sbjct  655  VKALVSRPSKRSKQVMANLSAT  676



>ref|XP_008375841.1| PREDICTED: ABC transporter G family member 15-like [Malus domestica]
Length=684

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ SG+FRL  D+PKPFWRYP+SY+S+  WA+QG Y+ND  GL F
Sbjct  519  FLMGIITGAGIMGILMMTSGFFRLLPDLPKPFWRYPISYLSYGSWAIQGSYKNDFIGLEF  578

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  P + GE+I++++F I ++ SKW DL  +  ++++YR++FF+++K  E+ +P  
Sbjct  579  EPMIPGEPNLTGEYIVQHMFGIPIDHSKWWDLVAIVAILVMYRVLFFLILKFKENASPLF  638

Query  351  RGYIARRRMQQ  319
            +   A+R +  
Sbjct  639  QSLYAKRTLHH  649



>ref|XP_002969857.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ28981.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=695

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGII GA +Q + ML  G+FRL +D+PKP WRYP+SY+SFH + LQG YQND  G+ F
Sbjct  551  YLMGIIVGAAVQAVLMLTGGFFRLLSDLPKPVWRYPISYLSFHSYVLQGMYQNDFLGIQF  610

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D++ P LPKI G  IL N   +D++R+KW +L VL  M++ YRL+FF++IK++EDV P +
Sbjct  611  DSKYPFLPKINGRDILIN-NDVDMSRTKWDNLGVLVAMVVGYRLLFFVMIKLSEDVVPHL  669

Query  351  RGYIARRRMQQKNG  310
            R   A+   ++   
Sbjct  670  RALRAKHNAKKATA  683



>ref|XP_004957093.1| PREDICTED: ABC transporter G family member 11-like [Setaria italica]
Length=728

 Score =   125 bits (313),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM Y++FH +A QG Y+N+  GL F
Sbjct  584  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYVAFHKYANQGFYKNEFLGLTF  643

Query  531  -DNQSP--DLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVT  361
              NQ+       I G  IL + +Q+++  SKWVDL++L  M+++YRL+F  ++K+ E+V 
Sbjct  644  PSNQAAAGAGATISGREILRDYWQVEMGYSKWVDLAILCGMVVLYRLLFLAIVKLAENVK  703

Query  360  PWIRGY  343
            P I+G+
Sbjct  704  PMIKGF  709



>ref|XP_009387395.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKP WRYPM +I+FH +A QG Y+N+  GL+F
Sbjct  443  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPVWRYPMYHIAFHKYANQGFYKNEFLGLIF  502

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +NQ+   P I G+ IL   +Q+++  SKWVDL++LF M
Sbjct  503  PNNQAGGPPTITGDEILRETWQVEMGYSKWVDLAILFGM  541



>ref|XP_002985191.1| hypothetical protein SELMODRAFT_122027 [Selaginella moellendorffii]
 gb|EFJ13685.1| hypothetical protein SELMODRAFT_122027 [Selaginella moellendorffii]
Length=695

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGII GA +Q + ML  G+FRL +D+PKP WRYP+SY+SFH + LQG YQND  G+ F
Sbjct  551  YLMGIIVGAAVQAVLMLTGGFFRLLSDLPKPVWRYPISYLSFHSYVLQGMYQNDFLGIQF  610

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D++ P LPKI G  IL N   +D++R+KW +L VL  M++ YRL+FF++IK++EDV P +
Sbjct  611  DSKYPFLPKINGRDILIN-NDVDMSRTKWDNLGVLVAMVVGYRLLFFVMIKLSEDVVPHL  669

Query  351  RGYIARRRMQQKNG  310
            R   A+   ++   
Sbjct  670  RALRAKHNAKKATA  683



>gb|KDP22115.1| hypothetical protein JCGZ_25946 [Jatropha curcas]
Length=708

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 110/180 (61%), Gaps = 22/180 (12%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL G++TGAGI GI M+ SG+FRL  D+PKPFWRYP+SYI++  W LQG Y+ND  GL F
Sbjct  542  FLTGLVTGAGIIGIMMMTSGFFRLLPDLPKPFWRYPVSYINYGAWGLQGAYKNDFLGLEF  601

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D      PK+ GEFI+ NIF + ++ SKW DLSV+F +++ YR++FF+V+K  E  +P +
Sbjct  602  DALEGG-PKLTGEFIVTNIFGVPLDHSKWWDLSVIFLILLCYRILFFVVLKFKERASPIV  660

Query  351  RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK*IKTRIINHRLQPVKPLHT  172
            +   ++R +Q+             L + PS R   +  +        I+ R QP+  L +
Sbjct  661  KDIYSKRTLQK-------------LERRPSFRKLTSITS--------ISKRHQPLHSLSS  699



>ref|NP_001059389.1| Os07g0288700 [Oryza sativa Japonica Group]
 dbj|BAC79956.1| putative ABC transporter family protein [Oryza sativa Japonica 
Group]
 dbj|BAC84399.1| putative ABC transporter family protein [Oryza sativa Japonica 
Group]
 dbj|BAF21303.1| Os07g0288700 [Oryza sativa Japonica Group]
 dbj|BAG94477.1| unnamed protein product [Oryza sativa Japonica Group]
Length=729

 Score =   125 bits (313),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL+GIITG+G+QG+ ML +G+FRLP+D+PKP W+YP  +IS+H +A QG Y+N+L GLVF
Sbjct  601  FLLGIITGSGVQGVLMLNAGFFRLPSDLPKPVWKYPTYFISYHKYATQGLYKNELLGLVF  660

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
            ++       I GE+IL+N  Q++++ SKWVDL++L  M
Sbjct  661  EDIGGGGLTISGEYILKNYLQVELSYSKWVDLAILVAM  698



>ref|XP_009374924.1| PREDICTED: ABC transporter G family member 15-like [Pyrus x bretschneideri]
Length=686

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ SG+FRL  D+PKPFWRYP+SY+S+  WA+QG Y+ND  GL F
Sbjct  521  FLMGIITGAGIMGILMMTSGFFRLLPDLPKPFWRYPISYLSYGSWAIQGSYKNDFIGLEF  580

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  P + GE+I++++F I ++ SKW DL  +  ++++YR++FF+++K  E+ +P  
Sbjct  581  EPMIPGEPNLTGEYIIQHMFGIPIDHSKWWDLVAIVAILVMYRVLFFLILKFKENASPVF  640

Query  351  RGYIARRRMQQ  319
            +   A+R +  
Sbjct  641  QSLYAKRTLHH  651



>ref|XP_001775949.1| ATP-binding cassette transporter, subfamily G, member 7, group 
WBC protein PpABCG7 [Physcomitrella patens]
 gb|EDQ59314.1| ATP-binding cassette transporter, subfamily G, member 7, group 
WBC protein PpABCG7 [Physcomitrella patens]
Length=695

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGIFMLV+G+FRL +D+PKP WRYP+SYI F  +ALQG Y N+  GL F
Sbjct  518  FLMGIITGAGIQGIFMLVAGFFRLIDDLPKPVWRYPLSYIGFDMYALQGMYLNEFIGLTF  577

Query  531  DNQSPD----LPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDV  364
            +N   D     P IPG +++  ++ I  + +KW D++VLF MII+YR+IFFI IK+ E++
Sbjct  578  ENYVLDGKKIGPPIPGWYVIREMYGIRTSMTKWEDIAVLFGMIIVYRIIFFICIKLRENL  637

Query  363  TPWIRGYIARRRMQQK  316
             P++R  + + R  +K
Sbjct  638  GPYMRFKVTQYRTNRK  653



>ref|XP_003607356.1| ABC transporter G family member [Medicago truncatula]
Length=662

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGI+TGAGI GI M+ SG+FRL +D+PK  WRYP+SYIS+  WA QG Y+NDL GL F
Sbjct  496  FLMGIVTGAGIIGIMMMSSGFFRLLSDLPKVVWRYPISYISYGAWATQGSYKNDLLGLEF  555

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ GE+++ ++F ++++ SKW DL  LF ++I YR++FFI++K  E   P  
Sbjct  556  DPLLPGDPKLTGEYVITHMFGVELSHSKWWDLGALFIILICYRILFFIILKFKERALPLF  615

Query  351  RGYIARRRMQQ  319
            +   A+R + Q
Sbjct  616  QALYAKRTLHQ  626



>gb|EEE66985.1| hypothetical protein OsJ_23879 [Oryza sativa Japonica Group]
Length=479

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL+GIITG+G+QG+ ML +G+FRLP+D+PKP W+YP  +IS+H +A QG Y+N+L GLVF
Sbjct  351  FLLGIITGSGVQGVLMLNAGFFRLPSDLPKPVWKYPTYFISYHKYATQGLYKNELLGLVF  410

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            ++       I GE+IL+N  Q++++ SKWVDL++L  MIIIYRL+F ++IKI+E V P +
Sbjct  411  EDIGGGGLTISGEYILKNYLQVELSYSKWVDLAILVAMIIIYRLLFLVIIKISEIVKPRM  470

Query  351  RGYIARRRM  325
              ++   ++
Sbjct  471  LHFLCASKV  479



>ref|XP_010273011.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=749

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKPFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  608  FLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  667

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +N +   P I G+ IL + +Q+++  SKWVDL++L  M+I+YR +F+ +IK  E + P 
Sbjct  668  PNNLAGGPPTITGDEILRDTWQVEMGYSKWVDLAILLGMVILYRFMFWAIIKTVEKMKPM  727

Query  354  IRGYIA  337
            IR ++A
Sbjct  728  IRAFLA  733



>gb|AES89553.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=668

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGI+TGAGI GI M+ SG+FRL +D+PK  WRYP+SYIS+  WA QG Y+NDL GL F
Sbjct  502  FLMGIVTGAGIIGIMMMSSGFFRLLSDLPKVVWRYPISYISYGAWATQGSYKNDLLGLEF  561

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PK+ GE+++ ++F ++++ SKW DL  LF ++I YR++FFI++K  E   P  
Sbjct  562  DPLLPGDPKLTGEYVITHMFGVELSHSKWWDLGALFIILICYRILFFIILKFKERALPLF  621

Query  351  RGYIARRRMQQ  319
            +   A+R + Q
Sbjct  622  QALYAKRTLHQ  632



>ref|XP_011032054.1| PREDICTED: ABC transporter G family member 15-like [Populus euphratica]
Length=699

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL G++TGAGI GI M+ SG+FRL  D+PKPFWRYP+SYI++  W +QG Y+ND  GL F
Sbjct  534  FLTGLVTGAGIIGIMMMTSGFFRLLPDLPKPFWRYPVSYINYGAWGIQGAYKNDFLGLEF  593

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PKIPGEF++  +F I ++ SKW DLS ++ +++ YR++FFIV+K+ E   P++
Sbjct  594  DPLVPGDPKIPGEFVVTQMFGIPLDYSKWWDLSAIYLILVCYRILFFIVLKLKERALPFV  653

Query  351  RGYIARRRMQ  322
                ++R +Q
Sbjct  654  EDLYSKRTLQ  663



>ref|XP_008227201.1| PREDICTED: ABC transporter G family member 15-like [Prunus mume]
 ref|XP_008227202.1| PREDICTED: ABC transporter G family member 15-like [Prunus mume]
Length=682

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGI GI M+ SG+FRL  D+PKPFWRYP+SY+S+  W +QG Y+ND  GL F
Sbjct  517  FLMGIITGAGIMGILMMTSGFFRLLPDLPKPFWRYPVSYLSYGSWGIQGAYKNDFLGLEF  576

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P   K+ G+F+++++F I ++ SKW DL+ +  +++ YR++FF+++K  E+  P  
Sbjct  577  DPMIPGDQKLTGDFVIQHMFGIPIDHSKWWDLAAIVAILVSYRVLFFVILKFKENALPLF  636

Query  351  RGYIARRRMQQ  319
            +   A+R +Q+
Sbjct  637  QTLYAKRTLQK  647



>ref|XP_009393641.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGII+GAGIQG+ ML  G+FRLP D+PKP W+YPM YISFH +A QG Y+N+  GL F
Sbjct  444  YLMGIISGAGIQGLMMLSGGFFRLPGDLPKPVWKYPMYYISFHKYANQGYYKNEFAGLTF  503

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
              NQ+     I GE ++++ +Q++V  SKWVDL++LF M+IIYRL+F +V+K+ E V P 
Sbjct  504  PSNQAGGAATITGEEVVKDYWQMEVGYSKWVDLAILFAMVIIYRLLFLVVVKMTEKVKPL  563

Query  354  I  352
            +
Sbjct  564  L  564



>ref|XP_006664909.1| PREDICTED: ABC transporter G family member 12-like [Oryza brachyantha]
Length=702

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 3/141 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG+I GAG+ GI ML SG+FRL  ++PK FWRYP+SYI +  W L+G Y+NDL GL F
Sbjct  533  FLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWRYPVSYIVYGSWGLKGAYKNDLIGLEF  592

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GE+I+  +  + +N SKW+DL+++F ++  YRLIFF+V+K  E  +P+I
Sbjct  593  EPMMPGQPKLTGEYIITKMMGLSLNHSKWLDLAMIFVLLFAYRLIFFLVLKAKEAASPYI  652

Query  351  RGYIAR---RRMQQKNGNQTT  298
            R   AR   RR++++   + T
Sbjct  653  RVAYARFTIRRLERRASFRKT  673



>emb|CAN82969.1| hypothetical protein VITISV_013416 [Vitis vinifera]
Length=658

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 98/142 (69%), Gaps = 3/142 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+  L  G+FRLP+D PKPFWRYP+ Y+SF+ +A QG Y+N+ +GL F
Sbjct  506  FLMGIITGAGIQGLLXLSGGFFRLPDDFPKPFWRYPLYYLSFNKYAYQGLYKNEFQGLKF  565

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N ++   P I GE IL   +Q+++  SKW+DL++L  M ++YRL+F I IK  E V P 
Sbjct  566  PNDEAGGPPIISGEEILRKRWQVEMVYSKWIDLAILLGMAVLYRLLFLITIKTTEKVIPL  625

Query  354  IRGYIAR--RRMQQKNGNQTTT  295
            ++  ++R  +R +Q   N + T
Sbjct  626  VKALVSRPSKRSKQVMANLSAT  647



>emb|CBI17178.3| unnamed protein product [Vitis vinifera]
Length=2144

 Score =   125 bits (313),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 69/161 (43%), Positives = 99/161 (61%), Gaps = 13/161 (8%)
 Frame = -1

Query  711   FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
             FL+G++TGAGI GI M+ SG+FRL  DIPKP WRYP+SYI++  WALQG Y+N+L GL F
Sbjct  1979  FLLGMVTGAGIIGIMMMTSGFFRLLPDIPKPVWRYPISYINYGAWALQGAYKNELIGLEF  2038

Query  531   DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
             D   P  PK+ GE IL  I  + ++ SKW DL+ +  ++I YR++FF ++K+ E  +P  
Sbjct  2039  DPPFPGEPKLKGEHILTTILGVRMDHSKWWDLTAVVIILISYRVLFFTILKLRERTSPLF  2098

Query  351   RGYIARRRMQQKNGNQTTTVAPFGLTQSPSLRSYATGPAKK  229
             R    +R +               L + PS R   + P+K+
Sbjct  2099  RRLYTKRTLHH-------------LEKRPSFRKKPSFPSKR  2126


 Score =   112 bits (279),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            ++MGI+ G G  GI ML SGY+R  +DIPKPF RYP+SYISF  WA+QG Y+N L GL F
Sbjct  672  YMMGIVVGVGFSGIMMLASGYYRSLDDIPKPFLRYPISYISFMAWAVQGVYKNLLLGLEF  731

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
            D   P  PK+ GE +L  +  I ++ SKW DL+ +  +
Sbjct  732  DPIIPGTPKLKGEVVLRTMLGIPLSHSKWWDLTAILVI  769


 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = -1

Query  711   FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
             + MGI+ G G  G+ ML SGY+R  +D+PKPF RYP+SYISF  W  +G Y++ L GL F
Sbjct  1333  YKMGILVGCGFIGVMMLASGYYRKQDDMPKPFLRYPISYISFMAWTFKGLYKSLLMGLEF  1392

Query  531   DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             D   P  PK+ GEF+L  +  I ++ SKW DL+ +  +
Sbjct  1393  DPLIPGDPKLKGEFLLRTMLGISLSHSKWWDLAAVLAI  1430



>ref|XP_010680511.1| PREDICTED: ABC transporter G family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 93/125 (74%), Gaps = 7/125 (6%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFWRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  574  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFEGLRF  633

Query  531  DNQSPDL----PKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDV  364
             N   DL      I GE +L++ +Q+++  SKWVDL++L  M+++YRL+F  +IK+ E +
Sbjct  634  PN---DLVGGGATISGEEVLKSFWQVEMGYSKWVDLAILIGMVVVYRLMFLGIIKLAEKI  690

Query  363  TPWIR  349
             P IR
Sbjct  691  KPMIR  695



>ref|XP_006827836.1| hypothetical protein AMTR_s00008p00012240 [Amborella trichopoda]
 gb|ERM95252.1| hypothetical protein AMTR_s00008p00012240 [Amborella trichopoda]
Length=235

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            F MGIITGAG+Q I +L  G+FRLPND+PKP W+YPM YISFH +A QG Y+N+ + L F
Sbjct  96   FFMGIITGAGVQAIMILNGGFFRLPNDLPKPVWKYPMFYISFHKYANQGLYKNEFEVLAF  155

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N   + P  I GE  L   +Q+++  SKWVDL +L  M++ YRL+F  ++K++E   P 
Sbjct  156  PNGLVEGPATITGESNLRETWQMEMGYSKWVDLGILMGMVVFYRLMFLGILKLSEKARPV  215

Query  354  IRGYIARRRMQ  322
            +RG++ R R Q
Sbjct  216  VRGFLVRHRKQ  226



>ref|XP_011090129.1| PREDICTED: ABC transporter G family member 15-like isoform X1 
[Sesamum indicum]
Length=697

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ +G+FRL  D+PKP WRYP+S+I +  WALQG Y+ND+ G+VF
Sbjct  532  FLMGIITGAGVLGIMMMTAGFFRLLPDLPKPVWRYPISFIGYGAWALQGSYKNDMIGVVF  591

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            D   P  PKI GE ++ N+F I + RSKW DL  ++ +I  YRL+F I++K+ E    + 
Sbjct  592  DPLVPGDPKIKGEDVIRNMFGISLKRSKWWDLFAVYALIFSYRLLFLIILKLKERTAQYF  651

Query  351  RGYIARRRMQQ  319
            +   A+R +Q+
Sbjct  652  QSIYAKRALQR  662



>ref|XP_006830158.1| hypothetical protein AMTR_s03052p00000290 [Amborella trichopoda]
 gb|ERM97574.1| hypothetical protein AMTR_s03052p00000290 [Amborella trichopoda]
Length=309

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLPND+PKPFW+YPM YI+FH +A QG Y+N+ +GL F
Sbjct  189  FLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWKYPMYYIAFHKYANQGFYKNEFEGLTF  248

Query  531  DNQ-SPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             N      P I GE I    +Q+++  SKWVDL++L  M
Sbjct  249  PNGLVGGSPTITGEKIFSETWQVEMGYSKWVDLAILLGM  287



>gb|KJB44130.1| hypothetical protein B456_007G236200 [Gossypium raimondii]
Length=558

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGIITGAGIQGI +L  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  420  YLMGIITGAGIQGIMILNGGFFRLPDDLPKPIWRYPMYYIAFHKYANQGFYKNEFEGLSF  479

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I G+ +L + +Q+++  SKW+DL +LF M+++YRL+F+ +I   E + P 
Sbjct  480  PNNQVGGPPTITGDEVLRSFWQVEMGYSKWIDLVILFGMVVVYRLMFWGIIITVEKIKPL  539

Query  354  IRGYIA  337
            I+ Y+A
Sbjct  540  IKDYMA  545



>gb|ACN27668.1| unknown [Zea mays]
Length=394

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG+I GAG+ GI ML SG+FRL  ++PK FWRYP+SYI +  W L+G Y+NDL GL F
Sbjct  226  FLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWRYPVSYIVYGSWGLKGGYKNDLIGLEF  285

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GE+I+  +  + +N SKW+DL+++F ++  YRL FF+V+K+ E   P+I
Sbjct  286  EPMMPGQPKLTGEYIITEMMGLSLNHSKWLDLAMIFVLLFAYRLTFFVVLKVKEAAAPYI  345

Query  351  RGYIAR---RRMQQKNG-NQTTTVAPFGLTQSP  265
            R    R   +R++++    +T  +A      +P
Sbjct  346  RVAYTRFTVKRLERRASFRKTLAMASMSKRHNP  378



>emb|CBI17179.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ SG+FRL +D+PKPFWRYP+SYIS+  W LQG Y+NDL GL F
Sbjct  457  FLMGIITGAGLIGIMMMTSGFFRLLSDLPKPFWRYPVSYISYGAWGLQGAYKNDLIGLEF  516

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +      PK+ G  I+ N+  I ++ SKW DL+ LF ++I YRLIFF+++K  E   P+ 
Sbjct  517  EPLISGDPKLKGSEIITNMLGIQLDHSKWWDLTALFIILISYRLIFFLILKFKERAWPYF  576

Query  351  RGYIARRRMQQKN  313
            +   + R +QQ N
Sbjct  577  QTLHSNRTLQQLN  589



>gb|EEE50616.1| hypothetical protein OsJ_30813 [Oryza sativa Japonica Group]
Length=503

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML SG+F++PN++PK  W+YPM YISFH +ALQG Y+N+  GLVF
Sbjct  362  FLMGIITGAGIQGIMMLTSGFFQIPNNLPKIVWKYPMYYISFHKYALQGFYKNEFSGLVF  421

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +       + GE ++  +FQ++   S+WVDL+VL  M
Sbjct  422  QSNLGGQETVSGEKVIVELFQVETGHSRWVDLAVLCGM  459



>gb|EEC77419.1| hypothetical protein OsI_16198 [Oryza sativa Indica Group]
Length=476

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML SG+F++PN++PK  W+YPM YISFH +ALQG Y+N+  GLVF
Sbjct  335  FLMGIITGAGIQGIMMLTSGFFQIPNNLPKIVWKYPMYYISFHKYALQGFYKNEFSGLVF  394

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +       + GE ++  +FQ++   S+WVDL+VL  M
Sbjct  395  QSNLEGQETVSGEKVIVELFQVETGHSRWVDLAVLCGM  432



>gb|KJB44129.1| hypothetical protein B456_007G236200 [Gossypium raimondii]
Length=663

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGIITGAGIQGI +L  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  525  YLMGIITGAGIQGIMILNGGFFRLPDDLPKPIWRYPMYYIAFHKYANQGFYKNEFEGLSF  584

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I G+ +L + +Q+++  SKW+DL +LF M+++YRL+F+ +I   E + P 
Sbjct  585  PNNQVGGPPTITGDEVLRSFWQVEMGYSKWIDLVILFGMVVVYRLMFWGIIITVEKIKPL  644

Query  354  IRGYIA  337
            I+ Y+A
Sbjct  645  IKDYMA  650



>ref|XP_002300189.2| hypothetical protein POPTR_0001s31880g [Populus trichocarpa]
 gb|EEE84994.2| hypothetical protein POPTR_0001s31880g [Populus trichocarpa]
Length=691

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ   +L  G+FRLPND+P+PFW+YPM YI+FH +A QG ++N+ +GL F
Sbjct  541  FLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTF  600

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
              NQ+     IPGE IL + +Q+++  SKWVDL++L  M+++YR++F ++IK  E + P 
Sbjct  601  PSNQAGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEKIKPI  660

Query  354  IRGYIARRRMQ  322
            I   ++ R  Q
Sbjct  661  ITAIVSVRPKQ  671



>gb|KJB44128.1| hypothetical protein B456_007G236200 [Gossypium raimondii]
Length=673

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGIITGAGIQGI +L  G+FRLP+D+PKP WRYPM YI+FH +A QG Y+N+ +GL F
Sbjct  525  YLMGIITGAGIQGIMILNGGFFRLPDDLPKPIWRYPMYYIAFHKYANQGFYKNEFEGLSF  584

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ    P I G+ +L + +Q+++  SKW+DL +LF M+++YRL+F+ +I   E + P 
Sbjct  585  PNNQVGGPPTITGDEVLRSFWQVEMGYSKWIDLVILFGMVVVYRLMFWGIIITVEKIKPL  644

Query  354  IRGYIA  337
            I+ Y+A
Sbjct  645  IKDYMA  650



>gb|EMS61063.1| ABC transporter G family member 11 [Triticum urartu]
Length=697

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP+D+PKP WRYPM Y++FH +A QG Y+N+  GL F
Sbjct  552  FLMGIITGAGIQGVMMLNGGFFRLPHDLPKPVWRYPMYYVAFHKYANQGFYKNEFLGLTF  611

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             +NQ      I G+ IL   +Q+++  +KWVDL+VLF M+I+YR++F  ++K+ E V P 
Sbjct  612  PNNQVGGAATITGDEILREYWQVEMGYNKWVDLAVLFGMVILYRVLFLAIMKLTEKVKPM  671

Query  354  IRG  346
            + G
Sbjct  672  VNG  674



>ref|XP_002274109.2| PREDICTED: ABC transporter G family member 15 [Vitis vinifera]
Length=691

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAG+ GI M+ SG+FRL +D+PKPFWRYP+SYIS+  W LQG Y+NDL GL F
Sbjct  526  FLMGIITGAGLIGIMMMTSGFFRLLSDLPKPFWRYPVSYISYGAWGLQGAYKNDLIGLEF  585

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +      PK+ G  I+ N+  I ++ SKW DL+ LF ++I YRLIFF+++K  E   P+ 
Sbjct  586  EPLISGDPKLKGSEIITNMLGIQLDHSKWWDLTALFIILISYRLIFFLILKFKERAWPYF  645

Query  351  RGYIARRRMQQKN  313
            +   + R +QQ N
Sbjct  646  QTLHSNRTLQQLN  658



>gb|AFW82087.1| hypothetical protein ZEAMMB73_028139 [Zea mays]
Length=447

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMG+I GAG+ GI ML SG+FRL  ++PK FWRYP+SYI +  W L+G Y+NDL GL F
Sbjct  279  FLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWRYPVSYIVYGSWGLKGGYKNDLIGLEF  338

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PK+ GE+I+  +  + +N SKW+DL+++F ++  YRL FF+V+K+ E   P+I
Sbjct  339  EPMMPGQPKLTGEYIITEMMGLSLNHSKWLDLAMIFVLLFAYRLTFFVVLKVKEAAAPYI  398

Query  351  RGYIAR---RRMQQKNG-NQTTTVAPFGLTQSP  265
            R    R   +R++++    +T  +A      +P
Sbjct  399  RVAYTRFTVKRLERRASFRKTLAMASMSKRHNP  431



>ref|XP_002298391.1| ABC transporter-related family protein [Populus trichocarpa]
 gb|EEE83196.1| ABC transporter-related family protein [Populus trichocarpa]
Length=675

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FL G+ITGAGI GI M+ SG+FRL  D+PKPFWRYP+SYI+F  W +QG Y+ND  GL F
Sbjct  510  FLTGLITGAGIIGIMMMTSGFFRLLPDLPKPFWRYPVSYINFGAWGIQGAYKNDFLGLEF  569

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWI  352
            +   P  PKI GEF++  +F + ++ SKW DLS ++ +++ YR++FF+V+K+ E   P++
Sbjct  570  EPLVPGEPKISGEFVVTRMFGVPLDHSKWWDLSAIYLILVCYRILFFVVLKLKERALPFV  629

Query  351  RGYIARRRMQ  322
            +   ++R ++
Sbjct  630  KDLYSKRTLR  639



>gb|ABG65929.1| ABC-2 type transporter family protein [Oryza sativa Japonica 
Group]
Length=506

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQGI ML SG+F++PN++PK  W+YPM YISFH +ALQG Y+N+  GLVF
Sbjct  365  FLMGIITGAGIQGIMMLTSGFFQIPNNLPKIVWKYPMYYISFHKYALQGFYKNEFSGLVF  424

Query  531  DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCM  418
             +       + GE ++  +FQ++   S+WVDL+VL  M
Sbjct  425  QSNLGGQETVSGEKVIVELFQVETGHSRWVDLAVLCGM  462



>ref|XP_006856990.1| hypothetical protein AMTR_s00325p00013080 [Amborella trichopoda]
 gb|ERN18457.1| hypothetical protein AMTR_s00325p00013080 [Amborella trichopoda]
Length=138

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -1

Query  705  MGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVFDN  526
            MGIIT AG+Q I +L  G+FRLPND+PKP W+YPM YISFH +A QG Y+N+ +GL F N
Sbjct  1    MGIITCAGVQVIMILNGGFFRLPNDLPKPVWKYPMFYISFHKYANQGLYKNEYEGLAFPN  60

Query  525  QSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPWIR  349
                 P  I GE IL   +Q+++  SKWVDL +L  M++ YRL+F  ++K++E   P ++
Sbjct  61   GLVGGPATIIGESILRETWQMEMGYSKWVDLGILMGMVVFYRLMFLGILKLSEKARPVVK  120

Query  348  GYIARRRMQ  322
            G++ R R Q
Sbjct  121  GFLVRHRKQ  129



>ref|XP_009405050.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=628

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITG GIQGI ML  G+FRLP D+PKP WRYPM Y++FH +A QG Y+N+  GL F
Sbjct  482  FLMGIITGTGIQGIMMLNGGFFRLPQDLPKPVWRYPMHYMAFHKYANQGFYKNEFLGLTF  541

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
              N +   P I GE IL+ ++Q+++  SKWVDL++L  M+++YRL+F   +KI E V P 
Sbjct  542  PGNVAGGSPIITGEEILKGVWQVEMGYSKWVDLAILLAMVMLYRLMFLGAVKIAEKVKPK  601

Query  354  IRG-YIARRRM  325
            I   Y++ + M
Sbjct  602  INALYVSGKSM  612



>ref|XP_010937486.1| PREDICTED: ABC transporter G family member 11-like [Elaeis guineensis]
Length=603

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            +LMGIITGAGIQ   +L +G+FRLPND+PKP WRYP+ +I+FH +A Q  Y+N+  GL F
Sbjct  443  YLMGIITGAGIQATMILSAGFFRLPNDLPKPVWRYPLYHIAFHKYANQAYYKNEFIGLTF  502

Query  531  DN-QSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N Q+     + GE +L++ +Q++V  SKWVDL++LF M+I+YR++F +++K +E V P 
Sbjct  503  PNIQAGGAATVTGEEVLKDFWQMEVGYSKWVDLAILFGMVILYRVLFLVIVKASEKVKPM  562

Query  354  IRGYIAR  334
            +R  + R
Sbjct  563  VRAVLNR  569



>ref|XP_009763606.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
sylvestris]
Length=632

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ + +L  G+FRLP+D+PKPFW+YP+ Y++FH +A +G ++N+L+GL  
Sbjct  488  FLMGIITGAGIQALMILSGGFFRLPSDLPKPFWKYPLHYVAFHTYAFEGLFKNELEGLKI  547

Query  531  DNQSPDLPK-IPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
             N+     + I GE IL++ +Q++++ SKWVDL++L  M++ YRL+F + +K  E V P 
Sbjct  548  HNEDKGKRQIINGEVILKDEWQMNMDYSKWVDLAILLWMVVFYRLLFLLFVKAGEKVKPA  607

Query  354  IRGYIARRRMQQKN  313
            IR +I+     Q N
Sbjct  608  IRAFISSTSPNQIN  621



>ref|XP_003578275.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=748

 Score =   121 bits (304),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 66/137 (48%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQG+ ML  G+FRLP D+P+P WRYPM Y++FH +A QG Y+N+  GL F
Sbjct  601  FLMGIITGAGIQGVMMLNGGFFRLPRDLPRPVWRYPMYYVAFHKYANQGFYKNEFMGLTF  660

Query  531  DNQSPDLPKIPGEF-------ILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikIN  373
               +      PG         IL + +Q+++  SKWVDL+VLF M+IIYR++F +++K+ 
Sbjct  661  PRANAAAQAGPGASATVTGGEILRDYWQVEMGYSKWVDLAVLFGMVIIYRVLFLVIVKLT  720

Query  372  EDVTPWIRGYIARRRMQ  322
            E V P ++G+  R   Q
Sbjct  721  EKVKPMVKGFRFRSTQQ  737



>ref|XP_011003862.1| PREDICTED: ABC transporter G family member 11-like [Populus euphratica]
Length=691

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ   +L  G+FRLPND+P+PFW+YPM YI+FH +A QG ++N+ +GL F
Sbjct  541  FLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGLFKNEFEGLTF  600

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
              NQ+ +   IPGE IL + +Q+++  SKWVDL++L  M+++YR++F ++IK  E + P 
Sbjct  601  PSNQAGEPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEKIKPI  660

Query  354  IRGYIA  337
            I   ++
Sbjct  661  ITAIVS  666



>ref|XP_002300188.2| hypothetical protein POPTR_0001s31890g [Populus trichocarpa]
 gb|EEE84993.2| hypothetical protein POPTR_0001s31890g [Populus trichocarpa]
Length=611

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -1

Query  711  FLMGIITGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLKGLVF  532
            FLMGIITGAGIQ   +L  G+FRLPND+P+PFW+YPM YI+FH +A QG ++N+ +GL F
Sbjct  461  FLMGIITGAGIQAFMILGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTF  520

Query  531  -DNQSPDLPKIPGEFILENIFQIDVNRSKWVDLSVLFCMiiiyrliffivikINEDVTPW  355
              NQ+     IPGE IL + +Q+++  SKWVDL++L  M+++YR++F ++IK +E + P 
Sbjct  521  PSNQTGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTSEKIKPI  580

Query  354  IRGYIA  337
            I   ++
Sbjct  581  IAAIVS  586



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380