BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049G20

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACB05671.1|  chloroplast ferredoxin                                  175   6e-52   Capsicum annuum
ref|XP_006339919.1|  PREDICTED: ferredoxin-1, chloroplastic-like        174   1e-51   Solanum tuberosum [potatoes]
emb|CAC38395.1|  ferredoxin I                                           174   2e-51   Solanum tuberosum [potatoes]
ref|NP_001234059.1|  ferredoxin-1, chloroplastic                        173   3e-51   Solanum lycopersicum
ref|XP_009796636.1|  PREDICTED: ferredoxin                              172   1e-50   Nicotiana sylvestris
ref|XP_006367399.1|  PREDICTED: ferredoxin-1, chloroplastic-like        172   1e-50   Solanum tuberosum [potatoes]
gb|AAW64931.1|  chloroplast ferredoxin I                                169   1e-49   Nicotiana tabacum [American tobacco]
ref|XP_002269617.1|  PREDICTED: ferredoxin-like                         168   3e-49   Vitis vinifera
ref|XP_009600605.1|  PREDICTED: ferredoxin                              168   3e-49   Nicotiana tomentosiformis
gb|ABB30150.1|  chloroplast Tsip1-interacting ferredoxin                168   4e-49   Nicotiana tabacum [American tobacco]
ref|XP_010101150.1|  Ferredoxin                                         168   5e-49   Morus notabilis
sp|Q9ZTS2.1|FER_CAPAN  RecName: Full=Ferredoxin, chloroplastic; A...    167   5e-49   Capsicum annuum
ref|XP_004230473.1|  PREDICTED: ferredoxin-like                         165   5e-48   Solanum lycopersicum
ref|XP_004249046.2|  PREDICTED: ferredoxin                              165   5e-48   Solanum lycopersicum
ref|XP_003525006.1|  PREDICTED: ferredoxin, chloroplastic-like          165   7e-48   Glycine max [soybeans]
ref|XP_007042270.1|  2Fe-2S ferredoxin-like superfamily protein, ...    163   3e-47   
gb|AFK35324.1|  unknown                                                 162   7e-47   Lotus japonicus
ref|XP_006349353.1|  PREDICTED: ferredoxin, chloroplastic-like          160   2e-46   Solanum tuberosum [potatoes]
ref|XP_006431821.1|  hypothetical protein CICLE_v10002793mg             160   2e-46   Citrus clementina [clementine]
ref|XP_008218558.1|  PREDICTED: ferredoxin                              160   3e-46   Prunus mume [ume]
gb|KDO50080.1|  hypothetical protein CISIN_1g032269mg                   159   7e-46   Citrus sinensis [apfelsine]
ref|NP_001235138.1|  uncharacterized protein LOC100305932               159   8e-46   Glycine max [soybeans]
ref|XP_008339498.1|  PREDICTED: ferredoxin-like                         159   9e-46   Malus domestica [apple tree]
ref|XP_010242690.1|  PREDICTED: ferredoxin-like                         159   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_007226018.1|  hypothetical protein PRUPE_ppa013058mg             159   1e-45   Prunus persica
ref|XP_006471012.1|  PREDICTED: ferredoxin-2, chloroplastic-like        158   3e-45   Citrus sinensis [apfelsine]
ref|NP_001289320.1|  ferredoxin-like                                    157   4e-45   Pyrus x bretschneideri [bai li]
gb|KDP38815.1|  hypothetical protein JCGZ_04972                         157   6e-45   Jatropha curcas
gb|KDO50081.1|  hypothetical protein CISIN_1g032230mg                   157   7e-45   Citrus sinensis [apfelsine]
ref|XP_006471013.1|  PREDICTED: ferredoxin-2, chloroplastic-like        157   9e-45   Citrus sinensis [apfelsine]
ref|XP_004299909.1|  PREDICTED: ferredoxin-1-like                       155   4e-44   Fragaria vesca subsp. vesca
ref|XP_002530673.1|  Ferredoxin-2, chloroplast precursor, putative      152   4e-43   Ricinus communis
gb|EYU26514.1|  hypothetical protein MIMGU_mgv1a015835mg                151   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_011009386.1|  PREDICTED: ferredoxin-A-like                       151   1e-42   Populus euphratica
gb|AFK49089.1|  unknown                                                 150   2e-42   Lotus japonicus
ref|XP_011028285.1|  PREDICTED: ferredoxin-like                         150   4e-42   Populus euphratica
ref|XP_006384985.1|  Ferredoxin 2 family protein                        150   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009355250.1|  PREDICTED: ferredoxin, leaf L-A-like               149   6e-42   Pyrus x bretschneideri [bai li]
ref|XP_003629958.1|  Ferredoxin I                                       148   2e-41   Medicago truncatula
gb|AFK39763.1|  unknown                                                 147   4e-41   Lotus japonicus
ref|XP_004504188.1|  PREDICTED: ferredoxin-1, chloroplastic-like        147   5e-41   Cicer arietinum [garbanzo]
sp|P09911.2|FER1_PEA  RecName: Full=Ferredoxin-1, chloroplastic; ...    147   5e-41   Pisum sativum [garden pea]
ref|XP_002304053.1|  ferredoxin I family protein                        147   5e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006302971.1|  hypothetical protein CARUB_v10021110mg             147   5e-41   Capsella rubella
ref|XP_008378879.1|  PREDICTED: ferredoxin, leaf L-A-like               147   7e-41   
gb|AAO42615.1|  ferredoxin                                              145   2e-40   Helianthus annuus
ref|XP_004485473.1|  PREDICTED: ferredoxin-1, chloroplastic-like        145   3e-40   Cicer arietinum [garbanzo]
ref|NP_176291.1|  ferredoxin-2                                          145   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540157.1|  PREDICTED: ferredoxin-1, chloroplastic-like        145   3e-40   Glycine max [soybeans]
ref|NP_001237037.1|  uncharacterized protein LOC100500372               145   4e-40   Glycine max [soybeans]
ref|XP_003592975.1|  Ferredoxin I                                       145   4e-40   Medicago truncatula
ref|XP_004146260.1|  PREDICTED: ferredoxin-1, chloroplastic-like        145   4e-40   Cucumis sativus [cucumbers]
gb|AEI83424.1|  chloroplast ferredoxin I                                145   4e-40   Camellia sinensis [black tea]
gb|KHN45465.1|  Ferredoxin-1, chloroplastic                             144   6e-40   Glycine soja [wild soybean]
emb|CDY20591.1|  BnaC08g14670D                                          144   6e-40   Brassica napus [oilseed rape]
ref|XP_006417400.1|  hypothetical protein EUTSA_v10009020mg             144   6e-40   Eutrema salsugineum [saltwater cress]
gb|AAQ21119.1|  ferredoxin I                                            144   8e-40   Trifolium pratense [peavine clover]
ref|XP_003540156.2|  PREDICTED: ferredoxin-1, chloroplastic-like        144   1e-39   
ref|XP_002888117.1|  fed A                                              143   1e-39   Arabidopsis lyrata subsp. lyrata
gb|EPS71399.1|  ferredoxin-1, chloroplastic                             143   2e-39   Genlisea aurea
ref|XP_010030127.1|  PREDICTED: ferredoxin-like                         142   3e-39   Eucalyptus grandis [rose gum]
emb|CDY20975.1|  BnaA08g25500D                                          142   3e-39   Brassica napus [oilseed rape]
ref|XP_008456053.1|  PREDICTED: ferredoxin-like                         142   3e-39   Cucumis melo [Oriental melon]
ref|XP_010547432.1|  PREDICTED: ferredoxin, leaf L-A                    142   3e-39   Tarenaya hassleriana [spider flower]
sp|P04669.1|FER_SILPR  RecName: Full=Ferredoxin, chloroplastic; F...    142   4e-39   Silene latifolia subsp. alba [white campion]
ref|XP_009399171.1|  PREDICTED: ferredoxin, leaf L-A-like               142   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK40743.1|  hypothetical protein AALP_AA2G035400                    140   3e-38   Arabis alpina [alpine rockcress]
ref|XP_007148535.1|  hypothetical protein PHAVU_006G216800g             140   3e-38   Phaseolus vulgaris [French bean]
ref|XP_007148533.1|  hypothetical protein PHAVU_006G216600g             140   3e-38   Phaseolus vulgaris [French bean]
emb|CDO97577.1|  unnamed protein product                                140   4e-38   Coffea canephora [robusta coffee]
emb|CDY03773.1|  BnaC01g28900D                                          139   7e-38   
ref|XP_010430084.1|  PREDICTED: ferredoxin-2, chloroplastic             139   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009104198.1|  PREDICTED: ferredoxin, leaf L-A                    138   2e-37   Brassica rapa
ref|XP_011092335.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin-like    138   2e-37   Sesamum indicum [beniseed]
ref|XP_009144404.1|  PREDICTED: ferredoxin-1, chloroplastic             137   3e-37   Brassica rapa
ref|XP_010533959.1|  PREDICTED: ferredoxin, leaf L-A-like               137   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_008799183.1|  PREDICTED: ferredoxin-like                         137   4e-37   Phoenix dactylifera
sp|O04683.1|FER1_MESCR  RecName: Full=Ferredoxin-1, chloroplastic...    137   4e-37   Mesembryanthemum crystallinum
emb|CDY54581.1|  BnaCnng27360D                                          136   7e-37   Brassica napus [oilseed rape]
ref|XP_009113156.1|  PREDICTED: ferredoxin, leaf L-A                    136   1e-36   Brassica rapa
ref|XP_010418043.1|  PREDICTED: ferredoxin, leaf L-A                    136   1e-36   Camelina sativa [gold-of-pleasure]
emb|CDY44833.1|  BnaCnng11890D                                          136   1e-36   Brassica napus [oilseed rape]
gb|AIX10940.1|  putative chloroplast ferredoxin                         135   1e-36   Gardenia jasminoides
ref|XP_009420963.1|  PREDICTED: ferredoxin-like                         135   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006392090.1|  hypothetical protein EUTSA_v10023742mg             135   2e-36   Eutrema salsugineum [saltwater cress]
emb|CDY54579.1|  BnaCnng27340D                                          134   4e-36   Brassica napus [oilseed rape]
gb|ACN40369.1|  unknown                                                 134   5e-36   Picea sitchensis
sp|P81372.1|FERA_ALOMA  RecName: Full=Ferredoxin-A; Short=Fd A          132   6e-36   Alocasia macrorrhizos [ape]
pdb|1PFD|A  Chain A, The Solution Structure Of High Plant Parsley...    132   7e-36   Petroselinum crispum
prf||2210387B  ferredoxin:ISOTYPE=II                                    132   7e-36
ref|XP_010690121.1|  PREDICTED: ferredoxin-1, chloroplastic-like        134   9e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB47457.1|  hypothetical protein B456_008G027600                    133   1e-35   Gossypium raimondii
gb|ABR17063.1|  unknown                                                 133   1e-35   Picea sitchensis
gb|ABK23878.1|  unknown                                                 133   2e-35   Picea sitchensis
gb|KJB32457.1|  hypothetical protein B456_005G241900                    132   2e-35   Gossypium raimondii
gb|KJB79241.1|  hypothetical protein B456_013G039000                    133   3e-35   Gossypium raimondii
ref|XP_002300585.2|  Ferredoxin 2 family protein                        132   3e-35   Populus trichocarpa [western balsam poplar]
sp|P83584.1|FER_SOLLS  RecName: Full=Ferredoxin                         130   4e-35   Solanum lasiocarpum [Indian nightshade]
gb|KJB32456.1|  hypothetical protein B456_005G241800                    132   4e-35   Gossypium raimondii
gb|AAB25190.1|  ferredoxin A isoprotein, Fd A                           130   5e-35   Alocasia macrorrhizos [ape]
sp|P00221.2|FER1_SPIOL  RecName: Full=Ferredoxin-1, chloroplastic...    131   6e-35   Spinacia oleracea
ref|NP_001266399.1|  adrenodoxin, mitochondrial                         131   6e-35   Zea mays [maize]
ref|XP_008648349.1|  PREDICTED: ferredoxin-5, chloroplastic             132   7e-35   
gb|ACA34366.1|  chloroplast ferredoxin 5 precursor                      130   1e-34   Zea mays [maize]
ref|XP_010458476.1|  PREDICTED: ferredoxin-1, chloroplastic-like        130   1e-34   Camelina sativa [gold-of-pleasure]
ref|NP_172565.1|  ferredoxin 1                                          130   1e-34   Arabidopsis thaliana [mouse-ear cress]
sp|P00228.2|FER_WHEAT  RecName: Full=Ferredoxin, chloroplastic; F...    130   1e-34   Triticum aestivum [Canadian hard winter wheat]
sp|P83526.1|FER_TOBAC  RecName: Full=Ferredoxin                         129   2e-34   Nicotiana tabacum [American tobacco]
gb|EYU35456.1|  hypothetical protein MIMGU_mgv1a025159mg                129   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_011092337.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin-like    130   2e-34   Sesamum indicum [beniseed]
gb|EMT21184.1|  Ferredoxin, chloroplastic                               130   2e-34   
gb|AAL77198.1|  anti-disease protein 1                                  130   2e-34   Oryza sativa [red rice]
gb|KFK43391.1|  hypothetical protein AALP_AA1G119900                    130   2e-34   Arabis alpina [alpine rockcress]
ref|XP_011039858.1|  PREDICTED: ferredoxin-like                         130   2e-34   Populus euphratica
sp|P00226.1|FER_SAMNI  RecName: Full=Ferredoxin                         128   4e-34   Sambucus nigra
ref|NP_001105344.1|  ferredoxin-5, chloroplastic precursor              129   4e-34   
ref|XP_007148534.1|  hypothetical protein PHAVU_006G216700g             130   5e-34   Phaseolus vulgaris [French bean]
ref|XP_002443703.1|  hypothetical protein SORBIDRAFT_07g000600          129   5e-34   Sorghum bicolor [broomcorn]
ref|XP_002443705.1|  hypothetical protein SORBIDRAFT_07g000620          128   7e-34   
ref|XP_010492189.1|  PREDICTED: ferredoxin-1, chloroplastic-like        128   1e-33   Camelina sativa [gold-of-pleasure]
gb|ACG47467.1|  ferredoxin-1                                            128   1e-33   Zea mays [maize]
ref|XP_010907538.1|  PREDICTED: ferredoxin-A-like                       128   1e-33   Elaeis guineensis
sp|P83527.1|FER_CAPAA  RecName: Full=Ferredoxin                         126   1e-33   Capsicum annuum var. annuum [chilli pepper]
gb|KCW57094.1|  hypothetical protein EUGRSUZ_I02744                     127   1e-33   Eucalyptus grandis [rose gum]
ref|NP_001060779.1|  Os08g0104600                                       127   1e-33   
sp|P83525.1|FER_SCOJA  RecName: Full=Ferredoxin                         126   1e-33   Scopolia japonica
sp|P83582.1|FER_SOLNI  RecName: Full=Ferredoxin                         126   2e-33   Solanum nigrum
sp|P83520.1|FER_BRUAR  RecName: Full=Ferredoxin                         126   2e-33   Brugmansia arborea
ref|XP_002889843.1|  hypothetical protein ARALYDRAFT_471234             127   2e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_003573262.1|  PREDICTED: ferredoxin-like                         127   2e-33   Brachypodium distachyon [annual false brome]
ref|XP_004972427.1|  PREDICTED: ferredoxin-1, chloroplastic-like        127   2e-33   Setaria italica
sp|P83583.1|FER_SOLLY  RecName: Full=Ferredoxin                         125   3e-33   Solanum lyratum
sp|P85121.1|FER_PANGI  RecName: Full=Ferredoxin                         125   3e-33   Panax ginseng [Asiatic ginseng]
sp|P81373.1|FERB_ALOMA  RecName: Full=Ferredoxin-B; Short=Fd B          125   3e-33   Alocasia macrorrhizos [ape]
ref|XP_010475984.1|  PREDICTED: ferredoxin-1, chloroplastic-like        127   4e-33   Camelina sativa [gold-of-pleasure]
emb|CDY33318.1|  BnaAnng04290D                                          127   4e-33   Brassica napus [oilseed rape]
sp|P84872.1|FER_ATRBE  RecName: Full=Ferredoxin                         125   4e-33   Atropa belladonna [deadly nightshade]
sp|P68163.1|FER_DATIN  RecName: Full=Ferredoxin                         125   4e-33   Datura inoxia [downy thornapple]
sp|P83522.1|FER_HORVU  RecName: Full=Ferredoxin                         125   5e-33   Hordeum vulgare [barley]
ref|XP_004159876.1|  PREDICTED: ferredoxin-1, chloroplastic-like        126   5e-33   
ref|XP_003573263.1|  PREDICTED: ferredoxin                              126   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_004506180.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    127   5e-33   Cicer arietinum [garbanzo]
sp|P84874.1|FER2_HYONI  RecName: Full=Ferredoxin-2; AltName: Full...    125   6e-33   Hyoscyamus niger [black henbane]
ref|XP_003606105.1|  Ferredoxin-6                                       126   6e-33   
ref|XP_003629832.1|  Ferredoxin-6                                       126   7e-33   
sp|P68165.1|FER_DATST  RecName: Full=Ferredoxin                         124   7e-33   Datura stramonium [common thornapple]
emb|CAN74125.1|  hypothetical protein VITISV_038770                     126   8e-33   Vitis vinifera
ref|XP_010688241.1|  PREDICTED: ferredoxin-2-like                       125   9e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004972426.1|  PREDICTED: ferredoxin-5, chloroplastic-like        125   1e-32   Setaria italica
sp|P83523.1|FER_LYCCN  RecName: Full=Ferredoxin                         124   1e-32   Lycium chinense [Chinese boxthorn]
sp|P00222.1|FER_COLES  RecName: Full=Ferredoxin                         123   2e-32   Colocasia esculenta [cocoyam]
gb|AAY85661.1|  heterotrophic ferredoxin 2                              125   2e-32   Helianthus annuus
ref|XP_006659025.1|  PREDICTED: ferredoxin-1, chloroplastic-like        125   2e-32   Oryza brachyantha
gb|EYU26711.1|  hypothetical protein MIMGU_mgv1a015613mg                125   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_011088892.1|  PREDICTED: ferredoxin, root R-B1-like              125   2e-32   Sesamum indicum [beniseed]
ref|XP_004140901.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    125   3e-32   
sp|P00225.1|FER_LEULE  RecName: Full=Ferredoxin                         123   3e-32   Leucaena leucocephala [cassie]
prf||2210387A  ferredoxin:ISOTYPE=I                                     123   3e-32
ref|XP_006855030.1|  hypothetical protein AMTR_s00031p00053820          124   3e-32   Amborella trichopoda
ref|XP_008456052.1|  PREDICTED: ferredoxin-like                         124   4e-32   Cucumis melo [Oriental melon]
ref|XP_006305843.1|  hypothetical protein CARUB_v10010893mg             124   4e-32   Capsella rubella
ref|XP_010651884.1|  PREDICTED: ferredoxin-3, chloroplastic             125   4e-32   
ref|NP_001238738.1|  uncharacterized protein LOC100499711               124   4e-32   Glycine max [soybeans]
ref|XP_001692808.1|  apoferredoxin                                      123   4e-32   Chlamydomonas reinhardtii
ref|NP_001241349.1|  uncharacterized protein LOC100785611               124   5e-32   Glycine max [soybeans]
ref|XP_008456600.1|  PREDICTED: ferredoxin, root R-B2-like              124   5e-32   Cucumis melo [Oriental melon]
gb|KHN21149.1|  Ferredoxin-3, chloroplastic                             124   5e-32   Glycine soja [wild soybean]
gb|EYU32959.1|  hypothetical protein MIMGU_mgv1a015634mg                124   6e-32   Erythranthe guttata [common monkey flower]
emb|CDX97925.1|  BnaA06g06760D                                          124   6e-32   
gb|AFK36593.1|  unknown                                                 124   6e-32   Lotus japonicus
gb|ACG44867.1|  ferredoxin-1                                            125   7e-32   Zea mays [maize]
prf||1802399A  ferredoxin                                               122   7e-32
ref|WP_023173697.1|  ferredoxin                                         122   7e-32   Gloeobacter kilaueensis
sp|P84873.1|FER1_HYONI  RecName: Full=Ferredoxin-1; AltName: Full...    122   8e-32   Hyoscyamus niger [black henbane]
ref|XP_007132438.1|  hypothetical protein PHAVU_011G094400g             124   8e-32   Phaseolus vulgaris [French bean]
ref|XP_003596823.1|  Ferredoxin                                         123   9e-32   Medicago truncatula
ref|XP_002443704.1|  hypothetical protein SORBIDRAFT_07g000610          123   1e-31   Sorghum bicolor [broomcorn]
ref|XP_004497151.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    123   1e-31   Cicer arietinum [garbanzo]
ref|XP_009148437.1|  PREDICTED: ferredoxin-1, chloroplastic             122   2e-31   Brassica rapa
ref|XP_008783366.1|  PREDICTED: ferredoxin-like                         122   2e-31   Phoenix dactylifera
ref|XP_006859155.1|  hypothetical protein AMTR_s00070p00129320          122   2e-31   Amborella trichopoda
ref|XP_010686005.1|  PREDICTED: ferredoxin, root R-B1                   122   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_011143612.1|  ferredoxin                                         120   2e-31   Gloeobacter violaceus
ref|WP_010873424.1|  ferredoxin                                         120   2e-31   Synechocystis
ref|XP_009124654.1|  PREDICTED: ferredoxin, leaf L-A-like               123   2e-31   Brassica rapa
ref|XP_007015816.1|  Ferredoxin 3                                       122   3e-31   Theobroma cacao [chocolate]
gb|AFK43837.1|  unknown                                                 122   3e-31   Medicago truncatula
ref|WP_028946897.1|  ferredoxin                                         120   3e-31   Synechocystis sp. PCC 6714
gb|ACG46956.1|  ferredoxin-1                                            121   4e-31   Zea mays [maize]
ref|NP_001104844.1|  ferredoxin2                                        121   4e-31   Zea mays [maize]
gb|ACU19632.1|  unknown                                                 122   4e-31   Glycine max [soybeans]
ref|XP_010658808.1|  PREDICTED: ferredoxin, root R-B1-like              121   5e-31   Vitis vinifera
emb|CBI18580.3|  unnamed protein product                                122   5e-31   Vitis vinifera
gb|KHG14857.1|  Ferredoxin-3, chloroplastic -like protein               121   5e-31   Gossypium arboreum [tree cotton]
pdb|3P63|A  Chain A, Structure Of M. Laminosus Ferredoxin With A ...    119   6e-31   Mastigocladus laminosus
ref|XP_007207484.1|  hypothetical protein PRUPE_ppa012826mg             121   6e-31   Prunus persica
ref|XP_008228634.1|  PREDICTED: ferredoxin, root R-B1                   121   8e-31   Prunus mume [ume]
emb|CDY19334.1|  BnaC05g08430D                                          120   8e-31   Brassica napus [oilseed rape]
ref|XP_006361079.1|  PREDICTED: ferredoxin-3, chloroplastic-like        120   8e-31   Solanum tuberosum [potatoes]
ref|XP_010244968.1|  PREDICTED: ferredoxin, root R-B2                   120   9e-31   Nelumbo nucifera [Indian lotus]
ref|WP_015164599.1|  ferredoxin 2Fe-2S                                  119   1e-30   Pseudanabaena sp. PCC 7367
gb|AAB33405.1|  ferredoxin component a1                                 119   1e-30   Raphanus sativus var. niger [daikon]
gb|KDO44408.1|  hypothetical protein CISIN_1g031979mg                   120   1e-30   Citrus sinensis [apfelsine]
ref|NP_001105345.1|  ferredoxin-1, chloroplastic precursor              120   1e-30   
sp|P83585.1|FER_SOLAB  RecName: Full=Ferredoxin                         119   1e-30   Solanum abutiloides
ref|XP_008456215.1|  PREDICTED: ferredoxin-like                         120   1e-30   Cucumis melo [Oriental melon]
sp|P14938.1|FER3_RAPSA  RecName: Full=Ferredoxin, leaf L-A              119   1e-30   Raphanus sativus
sp|P00230.1|FER1_PHYAN  RecName: Full=Ferredoxin-1; AltName: Full...    118   2e-30   Phytolacca acinosa [food pokeberry]
prf||0602214A  ferredoxin I                                             118   2e-30
pdb|1DOX|A  Chain A, 1h And 15n Sequential Assignment, Secondary ...    118   2e-30   Synechocystis sp. PCC 6803
pdb|1GAQ|B  Chain B, Crystal Structure Of The Complex Between Fer...    118   2e-30   Zea mays [maize]
prf||1506385C  ferredoxin LFdA                                          118   2e-30
sp|P00238.1|FER_SCEQU  RecName: Full=Ferredoxin                         118   2e-30   Scenedesmus quadricauda
gb|AAB22616.1|  apo-ferredoxin                                          118   2e-30   Synechocystis
ref|NP_001236409.1|  uncharacterized protein LOC100500583               119   3e-30   Glycine max [soybeans]
prf||0812212A  ferredoxin                                               118   3e-30
sp|P00227.1|FER_BRANA  RecName: Full=Ferredoxin                         118   3e-30   Brassica napus [oilseed rape]
ref|XP_002311943.2|  ferredoxin I family protein                        119   3e-30   Populus trichocarpa [western balsam poplar]
gb|KEH44304.1|  2Fe-2S ferredoxin superfamily protein                   120   3e-30   Medicago truncatula
ref|WP_017713981.1|  ferredoxin                                         118   3e-30   Prochlorothrix hollandica
gb|AFK42562.1|  unknown                                                 119   3e-30   Medicago truncatula
ref|XP_006445732.1|  hypothetical protein CICLE_v10016676mg             119   3e-30   Citrus clementina [clementine]
gb|ACJ84066.1|  unknown                                                 119   3e-30   Medicago truncatula
pdb|3W5V|B  Chain B, Cross-linked Complex Between Ferredoxin And ...    117   3e-30   Zea mays [maize]
ref|XP_011024187.1|  PREDICTED: ferredoxin, root R-B1-like isofor...    119   3e-30   Populus euphratica
ref|XP_011032872.1|  PREDICTED: ferredoxin, root R-B1-like              119   3e-30   Populus euphratica
ref|XP_004146259.1|  PREDICTED: ferredoxin-2, chloroplastic-like        119   4e-30   Cucumis sativus [cucumbers]
ref|WP_002796877.1|  ferredoxin                                         117   4e-30   Microcystis aeruginosa
ref|XP_002966767.1|  hypothetical protein SELMODRAFT_230918             117   4e-30   
ref|WP_015212869.1|  ferredoxin (2Fe-2S)                                117   4e-30   Anabaena cylindrica
ref|XP_002316497.1|  ferredoxin I family protein                        119   4e-30   Populus trichocarpa [western balsam poplar]
sp|P00220.1|FER_MEDSA  RecName: Full=Ferredoxin                         117   4e-30   Medicago sativa [alfalfa]
sp|P00223.1|FER_ARCLA  RecName: Full=Ferredoxin                         117   4e-30   Arctium lappa
ref|WP_004160242.1|  Ferredoxin                                         117   5e-30   Microcystis aeruginosa
ref|XP_010089821.1|  Ferredoxin-3                                       119   5e-30   
prf||0406240A  ferredoxin I                                             117   5e-30
gb|EPS71446.1|  hypothetical protein M569_03315                         118   6e-30   Genlisea aurea
sp|P00229.1|FER1_PHYAM  RecName: Full=Ferredoxin-1; AltName: Full...    117   7e-30   Phytolacca americana [common pokeberry]
ref|XP_009592968.1|  PREDICTED: ferredoxin, root R-B1-like              118   7e-30   Nicotiana tomentosiformis
ref|XP_009599754.1|  PREDICTED: ferredoxin, root R-B2-like              118   7e-30   Nicotiana tomentosiformis
ref|XP_010688135.1|  PREDICTED: ferredoxin, root R-B1-like              118   7e-30   Beta vulgaris subsp. vulgaris [field beet]
pdb|2PVG|C  Chain C, Crystal Srtucture Of The Binary Complex Betw...    117   8e-30   Synechocystis sp.
ref|XP_009805054.1|  PREDICTED: ferredoxin, root R-B1-like              118   8e-30   Nicotiana sylvestris
ref|XP_011000933.1|  PREDICTED: ferredoxin, root R-B1-like              118   8e-30   Populus euphratica
ref|XP_006445731.1|  hypothetical protein CICLE_v10016676mg             120   8e-30   
ref|WP_019493669.1|  ferredoxin                                         116   9e-30   Calothrix
gb|KDP43389.1|  hypothetical protein JCGZ_26489                         118   9e-30   Jatropha curcas
pdb|3W5U|B  Chain B, Cross-linked Complex Between Ferredoxin And ...    116   9e-30   Zea mays [maize]
gb|KJB54269.1|  hypothetical protein B456_009G085400                    118   1e-29   Gossypium raimondii
ref|XP_002312819.1|  ferredoxin family protein                          118   1e-29   Populus trichocarpa [western balsam poplar]
ref|WP_002792418.1|  ferredoxin                                         116   1e-29   Microcystis aeruginosa
ref|XP_004291601.1|  PREDICTED: ferredoxin, root R-B1                   118   1e-29   Fragaria vesca subsp. vesca
gb|AAK15005.1|AF233452_1  ferredoxin                                    118   1e-29   Impatiens balsamina [rose balsam]
gb|KCW50548.1|  hypothetical protein EUGRSUZ_J00264                     118   1e-29   Eucalyptus grandis [rose gum]
ref|XP_011024186.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    119   1e-29   Populus euphratica
ref|WP_002790144.1|  ferredoxin                                         116   1e-29   Microcystis
ref|NP_001238228.1|  uncharacterized protein LOC100305886               117   1e-29   Glycine max [soybeans]
sp|P00244.2|FER1_APHFL  RecName: Full=Ferredoxin-1; AltName: Full...    116   1e-29   Aphanizomenon flos-aquae
sp|P83524.1|FER_PHYAF  RecName: Full=Ferredoxin                         115   2e-29   Physalis alkekengi var. franchetii [gua jin deng]
gb|AII16854.1|  ferredoxin                                              117   2e-29   Ocimum basilicum [basil]
ref|XP_001783907.1|  predicted protein                                  117   2e-29   
ref|XP_010909022.1|  PREDICTED: ferredoxin, root R-B1-like              117   2e-29   Elaeis guineensis
ref|XP_009765373.1|  PREDICTED: ferredoxin, root R-B2-like              117   2e-29   Nicotiana sylvestris
emb|CDP06913.1|  unnamed protein product                                117   2e-29   Coffea canephora [robusta coffee]
gb|AFK36614.1|  unknown                                                 117   2e-29   Lotus japonicus
pdb|1A70|A  Chain A, Spinach Ferredoxin                                 115   2e-29   Spinacia oleracea
ref|XP_011042982.1|  PREDICTED: ferredoxin, root R-B1                   117   2e-29   Populus euphratica
ref|XP_009383681.1|  PREDICTED: ferredoxin, root R-B2-like isofor...    117   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_023066739.1|  ferredoxin-1                                       115   3e-29   Lyngbya aestuarii
dbj|BAJ91647.1|  predicted protein                                      115   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_015079457.1|  ferredoxin                                         115   3e-29   Anabaena sp. 90
ref|XP_002515750.1|  Ferredoxin-3, chloroplast precursor, putative      117   3e-29   
sp|P00232.1|FER2_PHYAN  RecName: Full=Ferredoxin-2; AltName: Full...    115   3e-29   Phytolacca acinosa [food pokeberry]
gb|AAW79312.1|  chloroplast ferredixon                                  116   3e-29   Pavlova lutheri
ref|WP_040935341.1|  ferredoxin                                         115   4e-29   
gb|ABK26047.1|  unknown                                                 116   4e-29   Picea sitchensis
ref|XP_011090342.1|  PREDICTED: ferredoxin, root R-B1-like              116   4e-29   Sesamum indicum [beniseed]
ref|WP_012307921.1|  MULTISPECIES: ferredoxin                           114   5e-29   Synechococcus
ref|XP_005844499.1|  hypothetical protein CHLNCDRAFT_138861             115   5e-29   Chlorella variabilis
sp|P00231.1|FER2_PHYAM  RecName: Full=Ferredoxin-2; AltName: Full...    114   5e-29   
ref|XP_001771921.1|  predicted protein                                  116   5e-29   
ref|XP_009383680.1|  PREDICTED: ferredoxin, root R-B2-like isofor...    116   5e-29   
gb|EYU36069.1|  hypothetical protein MIMGU_mgv1a015556mg                116   5e-29   
ref|WP_024546796.1|  ferredoxin                                         114   5e-29   
gb|ACS96441.1|  heterotrophic ferredoxin                                116   6e-29   
ref|WP_024546797.1|  ferredoxin                                         114   6e-29   
ref|WP_015220249.1|  ferredoxin 2Fe-2S                                  114   7e-29   
ref|XP_006445733.1|  hypothetical protein CICLE_v10017081mg             115   7e-29   
ref|WP_017293978.1|  ferredoxin                                         114   7e-29   
ref|XP_009383679.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    117   7e-29   
ref|WP_009783610.1|  ferredoxin                                         114   8e-29   
ref|WP_040484059.1|  ferredoxin                                         114   9e-29   
gb|ABK23744.1|  unknown                                                 115   9e-29   
gb|ABK21210.1|  unknown                                                 115   9e-29   
ref|XP_005644977.1|  chloroplast ferredoxin                             115   9e-29   
ref|XP_006838828.1|  hypothetical protein AMTR_s00002p00263090          115   1e-28   
ref|XP_004139487.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    115   1e-28   
prf||0905173A  ferredoxin I                                             114   1e-28
ref|XP_003064135.1|  ferredoxin, chloroplast precursor                  115   1e-28   
gb|AAB65699.1|  ferredoxin                                              115   1e-28   
ref|XP_006345868.1|  PREDICTED: ferredoxin-3, chloroplastic-like        115   1e-28   
ref|XP_006487938.1|  PREDICTED: ferredoxin-3, chloroplastic-like        115   1e-28   
ref|XP_004139486.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    115   1e-28   
gb|AEQ61826.1|  chloroplast ferredoxin-3                                115   2e-28   
ref|XP_001771882.1|  predicted protein                                  115   2e-28   
ref|XP_006650863.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    115   2e-28   
ref|XP_006424239.1|  hypothetical protein CICLE_v10029499mg             115   2e-28   
ref|WP_040939228.1|  ferredoxin                                         113   2e-28   
ref|WP_009544409.1|  MULTISPECIES: ferredoxin                           113   2e-28   
ref|WP_006528570.1|  ferredoxin, (2Fe-2S)                               113   2e-28   
ref|XP_006361478.1|  PREDICTED: ferredoxin-3, chloroplastic-like        114   2e-28   
emb|CAA73265.1|  ferredoxin                                             114   2e-28   
ref|WP_037223582.1|  ferredoxin                                         113   2e-28   
ref|XP_010271745.1|  PREDICTED: ferredoxin, root R-B2-like isofor...    114   2e-28   
ref|XP_009604116.1|  PREDICTED: ferredoxin, root R-B1-like              114   2e-28   
gb|AAP79142.1|  ferredoxin 1                                            115   2e-28   
ref|WP_026734522.1|  ferredoxin                                         113   3e-28   
sp|P00224.1|FER2_SPIOL  RecName: Full=Ferredoxin-2; AltName: Full...    112   3e-28   
ref|XP_007142856.1|  hypothetical protein PHAVU_007G022500g             114   3e-28   
ref|XP_010271686.1|  PREDICTED: ferredoxin, root R-B2-like isofor...    115   3e-28   
ref|XP_003562934.1|  PREDICTED: ferredoxin-3, chloroplastic             114   3e-28   
ref|WP_015221325.1|  ferredoxin 2Fe-2S                                  112   3e-28   
ref|XP_008804846.1|  PREDICTED: ferredoxin, root R-B1                   114   3e-28   
ref|XP_003557329.1|  PREDICTED: ferredoxin, root R-B1-like              114   3e-28   
gb|KDO36686.1|  hypothetical protein CISIN_1g034300mg                   112   3e-28   
ref|XP_002466146.1|  hypothetical protein SORBIDRAFT_01g002180          114   3e-28   
gb|KDP27394.1|  hypothetical protein JCGZ_20218                         114   4e-28   
ref|XP_009415621.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin-1...    115   4e-28   
emb|CAN81747.1|  hypothetical protein VITISV_002047                     112   4e-28   
ref|XP_009794772.1|  PREDICTED: ferredoxin, root R-B1-like              114   5e-28   
emb|CAA87068.1|  non-photosynthetic ferredoxin                          114   5e-28   
ref|WP_013189829.1|  ferredoxin                                         112   5e-28   
ref|XP_010088999.1|  Ferredoxin-3                                       114   5e-28   
ref|XP_004239725.1|  PREDICTED: ferredoxin, root R-B2                   113   6e-28   
ref|XP_004289638.1|  PREDICTED: ferredoxin-3, chloroplastic-like        115   7e-28   
ref|XP_006384806.1|  ferredoxin family protein                          113   7e-28   
ref|WP_012307922.1|  MULTISPECIES: ferredoxin                           111   7e-28   
ref|XP_006650862.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    114   8e-28   
ref|XP_008378445.1|  PREDICTED: ferredoxin, root R-B1-like              113   8e-28   
ref|XP_002958725.1|  ferredoxin                                         112   8e-28   
gb|AAW79313.1|  chloroplast ferredoxin                                  112   9e-28   
gb|ADB85097.1|  putative ferredoxin-3 chloroplast precursor             111   9e-28   
ref|XP_010045206.1|  PREDICTED: ferredoxin, root R-B2-like              113   9e-28   
ref|WP_015145983.1|  ferredoxin, (2Fe-2S)                               111   9e-28   
ref|XP_004241323.1|  PREDICTED: ferredoxin, root R-B2-like              113   9e-28   
ref|XP_008461439.1|  PREDICTED: ferredoxin, root R-B2                   113   9e-28   
gb|KHN11245.1|  Ferredoxin-1, chloroplastic                             111   1e-27   
ref|XP_002952403.1|  Apoferredoxin, chloroplast precursor               112   1e-27   
ref|XP_006362894.1|  PREDICTED: ferredoxin-3, chloroplastic-like ...    112   1e-27   
ref|NP_001051821.1|  Os03g0835900                                       113   1e-27   
ref|XP_009364315.1|  PREDICTED: ferredoxin, root R-B1-like              112   1e-27   
ref|XP_009347787.1|  PREDICTED: ferredoxin, root R-B1-like              112   1e-27   
gb|AAW79311.1|  chloroplast ferredoxin                                  112   1e-27   
gb|ADC30004.1|  ferredoxin-3                                            112   1e-27   
gb|KHG08017.1|  Ferredoxin-3, chloroplastic -like protein               112   1e-27   
ref|WP_039201987.1|  ferredoxin                                         111   1e-27   
emb|CCC15098.1|  putative ferredoxin precursor                          113   1e-27   
ref|XP_002523809.1|  Ferredoxin-3, chloroplast precursor, putative      112   2e-27   
pdb|2MH7|A  Chain A, Solution Structure Of Oxidized [2fe-2s] Ferr...    110   2e-27   
ref|XP_009399196.1|  PREDICTED: ferredoxin, root R-B2-like              112   2e-27   
prf||1503271A  ferredoxin I                                             110   2e-27
ref|NP_001105346.1|  ferredoxin-3, chloroplastic precursor              112   2e-27   
ref|XP_011076950.1|  PREDICTED: ferredoxin, root R-B2-like              112   2e-27   
ref|XP_010905993.1|  PREDICTED: ferredoxin, root R-B1-like              112   2e-27   
ref|XP_009419622.1|  PREDICTED: ferredoxin, root R-B2-like              112   2e-27   
ref|XP_008391121.1|  PREDICTED: ferredoxin, root R-B1                   112   2e-27   
ref|XP_010937483.1|  PREDICTED: ferredoxin, root R-B1-like              112   2e-27   
ref|XP_011006972.1|  PREDICTED: ferredoxin, root R-B1-like              112   2e-27   
ref|XP_004251055.1|  PREDICTED: ferredoxin, root R-B1                   112   3e-27   
ref|WP_008233773.1|  soluble [2Fe-2S] ferredoxin                        110   3e-27   
ref|WP_011610705.1|  ferredoxin                                         110   3e-27   
gb|ABV22117.1|  chloroplast ferredoxin                                  112   3e-27   
ref|NP_045158.1|  ferredoxin                                            110   4e-27   
gb|AAW79308.1|  chloroplast ferredoxin                                  112   4e-27   
gb|AEQ61827.1|  chloroplast ferredoxin-3                                110   4e-27   
ref|WP_006196923.1|  ferredoxin                                         110   4e-27   
emb|CDY31182.1|  BnaC03g47090D                                          111   4e-27   
ref|WP_017320150.1|  ferredoxin                                         109   4e-27   
gb|EMT00397.1|  Ferredoxin-3, chloroplastic                             111   4e-27   
ref|WP_015137311.1|  ferredoxin, (2Fe-2S)                               109   4e-27   
ref|NP_180320.1|  ferredoxin 3                                          111   5e-27   
ref|XP_010542561.1|  PREDICTED: ferredoxin, root R-B1-like isofor...    112   5e-27   
ref|WP_004163775.1|  ferredoxin                                         109   5e-27   
gb|ABG33769.1|  ferredoxin III                                          110   5e-27   
ref|WP_011610706.1|  ferredoxin                                         109   6e-27   
ref|WP_008201292.1|  ferredoxin                                         109   6e-27   
ref|XP_009612137.1|  PREDICTED: ferredoxin, root R-B2-like isofor...    110   6e-27   
emb|CEG00505.1|  2Fe-2S ferredoxin, iron-sulphur binding site           110   7e-27   
gb|ACL54057.1|  unknown                                                 108   9e-27   
gb|AFY56742.1|  ferredoxin, (2Fe-2S)                                    109   9e-27   
ref|XP_009800654.1|  PREDICTED: ferredoxin, root R-B2-like              110   9e-27   
sp|P56408.1|FER_SCEFU  RecName: Full=Ferredoxin                         108   9e-27   
ref|XP_009612136.1|  PREDICTED: ferredoxin, root R-B2-like isofor...    110   9e-27   
emb|CDX77119.1|  BnaC04g39140D                                          110   9e-27   
ref|WP_044292121.1|  ferredoxin                                         108   1e-26   
ref|XP_002603570.1|  hypothetical protein BRAFLDRAFT_126940             110   1e-26   
ref|WP_027402881.1|  ferredoxin                                         108   1e-26   
dbj|GAL91867.1|  soluble [2Fe-2S] ferredoxin                            108   1e-26   
ref|WP_017315200.1|  ferredoxin                                         108   1e-26   
ref|XP_010542562.1|  PREDICTED: ferredoxin, root R-B1-like isofor...    110   1e-26   
ref|WP_010998287.1|  ferredoxin                                         108   1e-26   
ref|WP_011244794.1|  MULTISPECIES: ferredoxin                           108   1e-26   
ref|XP_010031517.1|  PREDICTED: ferredoxin, root R-B1                   110   2e-26   
ref|XP_004981144.1|  PREDICTED: ferredoxin-3, chloroplastic-like        109   2e-26   
ref|WP_009783609.1|  ferredoxin                                         108   2e-26   
ref|XP_008808077.1|  PREDICTED: ferredoxin, root R-B1-like              109   2e-26   
sp|P00253.2|FER_DESMC  RecName: Full=Ferredoxin                         108   2e-26   
ref|WP_015194040.1|  ferredoxin (2Fe-2S)                                108   2e-26   
ref|WP_008054250.1|  ferredoxin                                         108   2e-26   
ref|WP_013320250.1|  ferredoxin                                         107   2e-26   
ref|XP_001421955.1|  predicted protein                                  108   2e-26   
ref|WP_027402880.1|  ferredoxin                                         107   3e-26   
ref|XP_002880924.1|  hypothetical protein ARALYDRAFT_901657             109   3e-26   
ref|WP_012410088.1|  ferredoxin                                         107   3e-26   
ref|WP_027846641.1|  ferredoxin                                         107   3e-26   
gb|ADI99938.1|  plastid ferredoxin                                      110   3e-26   
pdb|1RFK|A  Chain A, Crystal Structure Of 2fe2s Ferredoxin From T...    107   3e-26   
ref|XP_010473143.1|  PREDICTED: ferredoxin-3, chloroplastic-like        108   3e-26   
ref|XP_009140803.1|  PREDICTED: ferredoxin, root R-B2                   108   4e-26   
ref|XP_006652262.1|  PREDICTED: ferredoxin-3, chloroplastic-like        108   4e-26   
ref|WP_006619147.1|  ferredoxin                                         107   4e-26   
gb|ABK25243.1|  unknown                                                 108   4e-26   
gb|AIU44602.1|  ferredoxin                                              107   4e-26   
ref|XP_009103603.1|  PREDICTED: ferredoxin, root R-B1                   108   5e-26   
emb|CDY04500.1|  BnaA07g13260D                                          108   5e-26   
ref|WP_002756062.1|  ferredoxin                                         107   5e-26   
gb|AAB33406.1|  ferredoxin component c                                  107   5e-26   
ref|WP_028084033.1|  ferredoxin                                         106   6e-26   
pdb|1QOA|A  Chain A, Ferredoxin Mutation C49s                           106   6e-26   
ref|XP_009792790.1|  PREDICTED: ferredoxin, root R-B1-like isofor...    108   7e-26   
ref|NP_043205.1|  ferredoxin                                            106   7e-26   
ref|XP_009133892.1|  PREDICTED: ferredoxin, root R-B2-like              108   8e-26   
ref|XP_008678349.1|  PREDICTED: ferredoxin-like                         108   8e-26   
ref|XP_006645059.1|  PREDICTED: ferredoxin-6, chloroplastic-like        108   9e-26   
ref|WP_006509415.1|  ferredoxin, (2Fe-2S)                               106   9e-26   
ref|XP_006654474.1|  PREDICTED: ferredoxin-6, chloroplastic-like        107   9e-26   
ref|XP_010497715.1|  PREDICTED: ferredoxin-3, chloroplastic             107   1e-25   
gb|KIY96892.1|  Ferredoxin                                              107   1e-25   
ref|XP_010510764.1|  PREDICTED: ferredoxin-3, chloroplastic             107   1e-25   
ref|XP_004955900.1|  PREDICTED: ferredoxin-3, chloroplastic-like        107   1e-25   
pdb|1J7C|A  Chain A, Structure Of The Anabaena Ferredoxin Mutant ...    106   1e-25   
prf||0512263A  ferredoxin                                               106   1e-25
ref|WP_015113360.1|  ferredoxin 2Fe-2S                                  106   1e-25   
pdb|1QOG|A  Chain A, Ferredoxin Mutation S47a                           105   1e-25   
pdb|1FXA|A  Chain A, Crystallization And Structure Determination ...    105   1e-25   
emb|CDY30545.1|  BnaA04g15880D                                          107   1e-25   
ref|WP_002781129.1|  Ferredoxin-1                                       105   1e-25   
ref|WP_028090810.1|  ferredoxin                                         105   1e-25   
ref|NP_001172661.1|  Os01g0860601                                       107   1e-25   
ref|WP_026093691.1|  ferredoxin                                         105   1e-25   
ref|YP_008965658.1|  ferredoxin                                         105   1e-25   
ref|XP_008788958.1|  PREDICTED: ferredoxin-3, chloroplastic-like        109   1e-25   
ref|WP_039203244.1|  ferredoxin                                         105   2e-25   
ref|NP_050798.1|  ferredoxin                                            105   2e-25   
emb|CDX71446.1|  BnaC04g16810D                                          107   2e-25   
emb|CDP06912.1|  unnamed protein product                                107   2e-25   
gb|EAY94032.1|  hypothetical protein OsI_15810                          107   2e-25   
ref|WP_015154889.1|  MULTISPECIES: ferredoxin 2Fe-2S                    105   2e-25   
emb|CAH67162.1|  H0717B12.9                                             107   2e-25   
pdb|3AV8|A  Chain A, Refined Structure Of Plant-Type [2fe-2s] Fer...    105   2e-25   
ref|WP_019504188.1|  ferredoxin                                         105   2e-25   
sp|P14936.1|FER1_RAPSA  RecName: Full=Ferredoxin, root R-B1             105   2e-25   
ref|NP_001052738.1|  Os04g0412200                                       107   2e-25   
ref|WP_009556660.1|  ferredoxin, (2Fe-2S)                               105   2e-25   
ref|WP_006623255.1|  MULTISPECIES: ferredoxin                           105   2e-25   
sp|P00250.2|FER_APHSA  RecName: Full=Ferredoxin-1; AltName: Full=...    105   2e-25   
ref|WP_011317615.1|  ferredoxin                                         105   2e-25   
ref|YP_003359279.1|  ferredoxin                                         105   3e-25   
ref|WP_027249810.1|  ferredoxin                                         105   3e-25   
gb|KIE10965.1|  ferredoxin                                              105   3e-25   
ref|WP_006279072.1|  ferredoxin                                         105   3e-25   
ref|WP_015120306.1|  ferredoxin, (2Fe-2S)                               105   3e-25   
ref|WP_036902223.1|  ferredoxin                                         105   3e-25   
gb|EAY76570.1|  hypothetical protein OsI_04516                          106   3e-25   
ref|WP_026795015.1|  MULTISPECIES: ferredoxin                           105   3e-25   
emb|CAB65696.1|  putative ferredoxin                                    104   3e-25   
dbj|BAJ90092.1|  predicted protein                                      106   3e-25   
prf||750656A  ferredoxin                                                104   3e-25
ref|WP_036918460.1|  MULTISPECIES: ferredoxin                           104   4e-25   
ref|XP_002993720.1|  hypothetical protein SELMODRAFT_236801             105   4e-25   
ref|WP_025930799.1|  ferredoxin                                         104   4e-25   
ref|WP_011132986.1|  ferredoxin                                         104   4e-25   
ref|WP_011125585.1|  MULTISPECIES: ferredoxin                           104   4e-25   
ref|XP_002508604.1|  ferredoxin, chloroplast precursor                  105   4e-25   
sp|P09735.1|FER_MARPO  RecName: Full=Ferredoxin                         104   5e-25   
ref|WP_017654803.1|  ferredoxin                                         104   5e-25   
ref|WP_015134157.1|  ferredoxin 2Fe-2S                                  104   5e-25   
ref|WP_022607833.1|  ferredoxin (2Fe-2S)                                104   5e-25   
ref|XP_010557416.1|  PREDICTED: ferredoxin, root R-B2-like              105   5e-25   
ref|WP_010477315.1|  MULTISPECIES: ferredoxin                           104   5e-25   
ref|WP_027254422.1|  ferredoxin                                         104   5e-25   
ref|WP_011430272.1|  ferredoxin                                         104   5e-25   
gb|KIZ01723.1|  Ferredoxin                                              105   6e-25   
pdb|1J7B|A  Chain A, Structure Of The Anabaena Ferredoxin Mutant ...    104   6e-25   
pdb|1QOF|A  Chain A, Ferredoxin Mutation Q70k                           104   6e-25   
ref|WP_002736278.1|  ferredoxin                                         104   6e-25   
ref|WP_015186770.1|  ferredoxin (2Fe-2S)                                104   6e-25   
ref|WP_015134156.1|  ferredoxin 2Fe-2S                                  103   6e-25   
ref|YP_001293609.1|  ferredoxin                                         103   7e-25   
emb|CDO99914.1|  unnamed protein product                                105   7e-25   



>gb|ACB05671.1| chloroplast ferredoxin [Capsicum annuum]
Length=145

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRM-TCMASYKVKLVT  367
            MA++S G +MSTSF+  KPA    SL+ I N   A  GLKS N G+M TCMA+YKVKLVT
Sbjct  1    MASIS-GIVMSTSFMPRKPAVT--SLKPIPNVGEALFGLKSANGGKMITCMATYKVKLVT  57

Query  366  PTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQM  187
            P+G  +FDCPDDVY+LDQAEE G DLPYSCRAG+CSSCAGK+VSG +DQSDNSFLDD+QM
Sbjct  58   PSGTVQFDCPDDVYILDQAEEAGHDLPYSCRAGACSSCAGKIVSGKIDQSDNSFLDDDQM  117

Query  186  DAGYVLTCVAYPTSNVVIETHKE  118
            DAGYVLTCVA+P S+V +ETHKE
Sbjct  118  DAGYVLTCVAFPQSDVTLETHKE  140



>ref|XP_006339919.1| PREDICTED: ferredoxin-1, chloroplastic-like [Solanum tuberosum]
Length=144

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KP     SL+AISN   A  GLKSG  GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMISTSFLPRKPVVT--SLKAISNVGEALFGLKSGRNGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV +GTVDQSD +FLDD+Q  
Sbjct  58   DGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGNFLDDDQEA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            AG+VLTCVAYP  +V IETHKE
Sbjct  118  AGFVLTCVAYPKCDVTIETHKE  139



>emb|CAC38395.1| ferredoxin I [Solanum tuberosum]
Length=144

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KP     SL+AISN   A  GLKSG  GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMISTSFLPRKPVVT--SLKAISNVGEALFGLKSGRNGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV +GTVDQSD  FLDD+Q  
Sbjct  58   DGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            AG+VLTCVAYP  +V IETHKE
Sbjct  118  AGFVLTCVAYPKCDVTIETHKE  139



>ref|NP_001234059.1| ferredoxin-1, chloroplastic [Solanum lycopersicum]
 sp|Q43517.1|FER1_SOLLC RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Ferredoxin 
I; Flags: Precursor [Solanum lycopersicum]
 emb|CAA99756.1| ferredoxin-I [Solanum lycopersicum]
Length=144

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KPA    SL+AISN   A  GLKSG  GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMISTSFLPRKPAVT--SLKAISNVGEALFGLKSGRNGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV +G+VDQSD +FLD++Q  
Sbjct  58   EGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            AG+VLTCVAYP  +V IETHKE
Sbjct  118  AGFVLTCVAYPKGDVTIETHKE  139



>ref|XP_009796636.1| PREDICTED: ferredoxin [Nicotiana sylvestris]
Length=144

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KP     SL+AI N   A  GLKS   GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMVSTSFLPRKPVVT--SLKAIPNVGQALFGLKSQRGGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EFDCPDDVY+LDQAEE+G DLPYSCRAGSCSSCAGKV +G VDQSD +FLDD+QM 
Sbjct  58   EGAVEFDCPDDVYILDQAEEMGHDLPYSCRAGSCSSCAGKVTAGNVDQSDGNFLDDDQMA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S+V IETHKE
Sbjct  118  DGFVLTCVAYPQSDVTIETHKE  139



>ref|XP_006367399.1| PREDICTED: ferredoxin-1, chloroplastic-like [Solanum tuberosum]
Length=144

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MAT+ + ++++T FL  KP     SL+AI N   A  G+K G  GR+TCMA+YKVKL+TP
Sbjct  1    MATIPS-TIVNTCFLPRKPVVT--SLKAIPNVGEALFGVKCGRSGRITCMATYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G FEFDCPDDVY+LD+AEE G DLPYSCRAG+CSSCAGKV +G+VDQSDNS+LDD QMD
Sbjct  58   DGPFEFDCPDDVYILDRAEETGIDLPYSCRAGACSSCAGKVTTGSVDQSDNSYLDDGQMD  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP SNV IETHKE
Sbjct  118  EGFVLTCVAYPKSNVTIETHKE  139



>gb|AAW64931.1| chloroplast ferredoxin I [Nicotiana tabacum]
Length=144

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KP     SL+AI N   A  GLKS   GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMVSTSFLPRKPVVT--SLKAIPNVGQALFGLKSERGGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV  G VDQSD +FLDD+QM 
Sbjct  58   EGTVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTGGNVDQSDGNFLDDDQMA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S+V IETHKE
Sbjct  118  GGFVLTCVAYPQSDVTIETHKE  139



>ref|XP_002269617.1| PREDICTED: ferredoxin-like [Vitis vinifera]
Length=142

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 115/142 (81%), Gaps = 5/142 (4%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MATLS G+M+STSF+  +P     SLRA+ N   A  GLK+G  GR+T MA YKVKL+TP
Sbjct  1    MATLS-GAMVSTSFIRRQPVT---SLRALPNVGQALFGLKAGR-GRVTAMAVYKVKLITP  55

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVYVLD AEE+G DLPYSCRAGSCSSCAG+VV GTVDQSD SFL+DEQM+
Sbjct  56   EGAKEFECPDDVYVLDHAEEIGIDLPYSCRAGSCSSCAGRVVEGTVDQSDGSFLEDEQME  115

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S++VIETHKE
Sbjct  116  EGWVLTCVAYPQSDLVIETHKE  137



>ref|XP_009600605.1| PREDICTED: ferredoxin [Nicotiana tomentosiformis]
 gb|AAS58496.1| chloroplast ferredoxin I [Nicotiana tabacum]
Length=144

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KP     SL+AI N   A  GLKS   GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMVSTSFLPRKPVVT--SLKAIPNVGQALFGLKSERGGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV  G VDQSD +FLDD+QM 
Sbjct  58   EGTVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTGGNVDQSDGNFLDDDQMA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S+V IETHKE
Sbjct  118  DGFVLTCVAYPQSDVTIETHKE  139



>gb|ABB30150.1| chloroplast Tsip1-interacting ferredoxin [Nicotiana tabacum]
Length=144

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSFL  KP     SL+AI N   A  GLKS   GR+TCMASYKVKL+TP
Sbjct  1    MASIS-GTMVSTSFLPRKPVVT--SLKAIPNVGQALFGLKSERGGRITCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV  G +DQSD +FLDD+QM 
Sbjct  58   EGTVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTGGNIDQSDGNFLDDDQMA  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S+V IETHKE
Sbjct  118  DGFVLTCVAYPQSDVTIETHKE  139



>ref|XP_010101150.1| Ferredoxin [Morus notabilis]
 gb|EXB87368.1| Ferredoxin [Morus notabilis]
Length=148

 Score =   168 bits (425),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 114/146 (78%), Gaps = 7/146 (5%)
 Frame = -3

Query  543  MATLSA----GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVK  376
            MAT +A    G+M+STSF       A  SLRA+ N   A  GLK+   GR+T MASYKVK
Sbjct  1    MATTTAAALSGTMVSTSFARRH---AVSSLRALPNTGQALFGLKASRGGRVTAMASYKVK  57

Query  375  LVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDD  196
            L+TP G+ EFDCPDDVY+LD AEE+G DLPYSCRAGSCSSCAGKVVSGT+DQSD SFLDD
Sbjct  58   LITPDGEKEFDCPDDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVSGTLDQSDQSFLDD  117

Query  195  EQMDAGYVLTCVAYPTSNVVIETHKE  118
            EQ+DAG+VLTCVAYP  +V IETHKE
Sbjct  118  EQIDAGWVLTCVAYPQCDVTIETHKE  143



>sp|Q9ZTS2.1|FER_CAPAN RecName: Full=Ferredoxin, chloroplastic; AltName: Full=PFLP; 
Flags: Precursor [Capsicum annuum]
 gb|AAD02175.1| ferredoxin-like protein [Capsicum annuum]
Length=144

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++SA +M+STSF+  KPA    SL+ I N   A  GLKS N G++TCMASYKVKL+TP
Sbjct  1    MASVSA-TMISTSFMPRKPAVT--SLKPIPNVGEALFGLKSANGGKVTCMASYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EFDCPD+VY+LDQAEE G DLPYSCRAGSCSSCAGK+  G VDQ+D +FLDD+Q++
Sbjct  58   DGPIEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLE  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S+V IETHKE
Sbjct  118  EGWVLTCVAYPQSDVTIETHKE  139



>ref|XP_004230473.1| PREDICTED: ferredoxin-like [Solanum lycopersicum]
Length=140

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 7/142 (5%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+++STSF+  KP     S +A     PA LG+K  N G++TCMA+YKVKL+TP
Sbjct  1    MASIS-GTIISTSFMPRKPVVT--SFKAF----PAILGVKYANGGKITCMATYKVKLITP  53

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
            +G  EFDCPDDVY+LDQAEE G ++PYSCRAGSCSSCAGK+VSG+VDQSD +FLDDEQ+ 
Sbjct  54   SGAVEFDCPDDVYILDQAEEEGHEIPYSCRAGSCSSCAGKIVSGSVDQSDGNFLDDEQIS  113

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            +GYVLTCVAYP S+V IETHKE
Sbjct  114  SGYVLTCVAYPQSDVTIETHKE  135



>ref|XP_004249046.2| PREDICTED: ferredoxin [Solanum lycopersicum]
Length=144

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++ + ++++TSFL  +      SL++I N   +  GLKSG  GR+TCMA+YKVKL+TP
Sbjct  1    MASIPS-TIVNTSFLPRRSVVT--SLKSIPNVGESLFGLKSGRSGRITCMATYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G FEFDCPDDV +LD+AEE G DLPYSCRAG+CSSCAGKV +G+VDQSDNSFLDD+Q+D
Sbjct  58   EGPFEFDCPDDVSILDRAEETGLDLPYSCRAGACSSCAGKVTAGSVDQSDNSFLDDDQID  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP SNV I+THKE
Sbjct  118  EGFVLTCVAYPKSNVTIQTHKE  139



>ref|XP_003525006.1| PREDICTED: ferredoxin, chloroplastic-like [Glycine max]
 gb|KHN06491.1| Ferredoxin, chloroplastic [Glycine soja]
Length=147

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 113/144 (78%), Gaps = 3/144 (2%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT +A  G+M+STSF+  +P     SL+   N   A  GLKSG  GR+TCMASYKVKL+
Sbjct  1    MATTAALSGTMVSTSFMRRQPMTTT-SLKTFPNVGEALFGLKSGRGGRVTCMASYKVKLI  59

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ EF+CPDDV+++D+AE+ G +LPYSCRAGSC SC GK+V G VDQSD SFLDDEQ
Sbjct  60   TPEGEVEFECPDDVFIVDKAEDEGIELPYSCRAGSCVSCVGKIVEGNVDQSDGSFLDDEQ  119

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +D+G+VLTCVA P S+VVIETHKE
Sbjct  120  IDSGWVLTCVAQPRSDVVIETHKE  143



>ref|XP_007042270.1| 2Fe-2S ferredoxin-like superfamily protein, A,ATFD2 [Theobroma 
cacao]
 gb|EOX98101.1| 2Fe-2S ferredoxin-like superfamily protein, A,ATFD2 [Theobroma 
cacao]
Length=143

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 115/141 (82%), Gaps = 5/141 (4%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            ATLS+ +M+STSF+  +P     SLR++  FR A  GLK+   GR+T MA+YKV L+TP 
Sbjct  5    ATLSS-AMVSTSFVRRQPVT---SLRSLPTFRQALFGLKAQRGGRLT-MAAYKVTLLTPE  59

Query  360  GDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDA  181
            G  EF+CPDDVY+LDQAEE G D+PYSCRAGSCSSCAGKV  G+VDQSD SFLDDEQ+D+
Sbjct  60   GPLEFECPDDVYILDQAEEEGIDIPYSCRAGSCSSCAGKVTKGSVDQSDGSFLDDEQIDS  119

Query  180  GYVLTCVAYPTSNVVIETHKE  118
            G+VLTCVAYPTS+VVIETHKE
Sbjct  120  GFVLTCVAYPTSDVVIETHKE  140



>gb|AFK35324.1| unknown [Lotus japonicus]
Length=142

 Score =   162 bits (410),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 113/144 (78%), Gaps = 9/144 (6%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT  A  G+M++TSFL  +P      L+A  N   A  GLKSG  GR+T MA+YKVKL+
Sbjct  1    MATTPALSGTMVNTSFLRRQP------LKAFPNVGQALFGLKSGCGGRVT-MAAYKVKLI  53

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G FEF+CPDDVY+LD AEE G D+PYSCRAGSCSSCAGKVV G VDQSD SFLDD+Q
Sbjct  54   TPEGPFEFECPDDVYILDHAEEQGIDIPYSCRAGSCSSCAGKVVGGNVDQSDGSFLDDDQ  113

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +DAG+VLTCVAYP S+VVIETHKE
Sbjct  114  IDAGFVLTCVAYPQSDVVIETHKE  137



>ref|XP_006349353.1| PREDICTED: ferredoxin, chloroplastic-like [Solanum tuberosum]
Length=136

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 11/142 (8%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA++S G+M+STSF+  KP         I  F P  LG+K  N G++TCMA+YKVKL+TP
Sbjct  1    MASIS-GTMISTSFMPRKP---------IVTF-PDLLGVKYANGGKITCMATYKVKLITP  49

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
            +G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGK+VSG+VDQSD +FL+DEQ+ 
Sbjct  50   SGAVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKIVSGSVDQSDGNFLEDEQIS  109

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            +GYVLTCVAYP S+V IETHKE
Sbjct  110  SGYVLTCVAYPQSDVTIETHKE  131



>ref|XP_006431821.1| hypothetical protein CICLE_v10002793mg [Citrus clementina]
 gb|ESR45061.1| hypothetical protein CICLE_v10002793mg [Citrus clementina]
Length=144

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MATLS+ +M+STSF+  KP A   SL+A+ N   A  GLK+   GR+  MA+YKVKL+TP
Sbjct  1    MATLSS-AMVSTSFIRSKPTAT--SLKAMPNMGQAMFGLKANRGGRVVAMATYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G+ E +CPDD ++LD AEE G DLPYSCRAG+CSSC GKVVSGTVDQS+ SFLDD+QM 
Sbjct  58   GGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMG  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTC AYPTS+V IETHKE
Sbjct  118  EGFVLTCAAYPTSDVTIETHKE  139



>ref|XP_008218558.1| PREDICTED: ferredoxin [Prunus mume]
Length=142

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 5/142 (4%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA LS G+M+STSF+ G+P     SLR   N   A  GLK+   GR+T MA++KVKL+TP
Sbjct  1    MAALS-GTMVSTSFIRGQPMT---SLRLAPNMGQALFGLKANRGGRVT-MAAFKVKLLTP  55

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKVV G VDQSD SFLDDEQ+D
Sbjct  56   EGPLEFECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVEGGVDQSDQSFLDDEQID  115

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP+S+VV+ETHKE
Sbjct  116  GGFVLTCVAYPSSDVVLETHKE  137



>gb|KDO50080.1| hypothetical protein CISIN_1g032269mg [Citrus sinensis]
Length=144

 Score =   159 bits (403),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MATLS+ +M+STSF+  KP A   SL+A+ N   A  GLK+   GR+  MA+YKVKL+TP
Sbjct  1    MATLSS-AMVSTSFIRSKPTAT--SLKAMPNMGQAIFGLKANRGGRVVAMATYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G+ E +CPDD ++LD AEE G DLPYSCRAG+CSSC GKVVSGTVDQS+ SFLDD+QM 
Sbjct  58   GGEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMG  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTC AYPTS+V IETHKE
Sbjct  118  EGFVLTCAAYPTSDVTIETHKE  139



>ref|NP_001235138.1| uncharacterized protein LOC100305932 [Glycine max]
 gb|ACU13854.1| unknown [Glycine max]
 gb|KHN48094.1| Ferredoxin, chloroplastic [Glycine soja]
Length=144

 Score =   159 bits (403),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 113/144 (78%), Gaps = 6/144 (4%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT +A  G+M+STSF+  +P     + +++  F  A  GLK G  GR+TCMASYKVKL+
Sbjct  1    MATTAALSGTMVSTSFMRKQPM----TTKSLKTFPNALFGLKGGRGGRVTCMASYKVKLI  56

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ EF+CPDDV+++D+AEE G +LPYSCRAGSC SC GK+V G VDQSD SFLDDEQ
Sbjct  57   TPEGEVEFECPDDVFIVDKAEEEGIELPYSCRAGSCVSCVGKIVKGDVDQSDGSFLDDEQ  116

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +++G+VLTCVA P S+VVIETHK+
Sbjct  117  IESGWVLTCVALPRSDVVIETHKD  140



>ref|XP_008339498.1| PREDICTED: ferredoxin-like [Malus domestica]
Length=144

 Score =   159 bits (402),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            AT  +G+M+STSF+ G+P     SLR   N   A  GLK+   GR+  MA+YKVKL+TP 
Sbjct  3    ATALSGTMVSTSFIRGQPMT---SLRLSPNVGQALFGLKANRGGRVA-MAAYKVKLLTPE  58

Query  360  GDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDA  181
            G  EF+CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG VDQSD SFLDDEQMD 
Sbjct  59   GPQEFECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVSGGVDQSDQSFLDDEQMDG  118

Query  180  GYVLTCVAYPTSNVVIETHKE  118
            G+VLTCVAYP+S+V +ETHKE
Sbjct  119  GFVLTCVAYPSSDVTLETHKE  139



>ref|XP_010242690.1| PREDICTED: ferredoxin-like [Nelumbo nucifera]
Length=144

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 117/144 (81%), Gaps = 7/144 (5%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MATL++  G+M+STSF+  KP     S+RA+ N   A  G+K+G  GR+T MA +KVKL+
Sbjct  1    MATLTSLSGTMVSTSFVR-KPTT---SIRALPNVGQALFGVKAGR-GRITAMAIHKVKLI  55

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+  F+CPDDVY+LDQAEE+G +LPYSCRAGSCSSCAGKVVSG +DQSD SFLDD+Q
Sbjct  56   TPEGEKVFECPDDVYILDQAEEVGIELPYSCRAGSCSSCAGKVVSGPIDQSDQSFLDDDQ  115

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +DAG+VLTC+AYP  +VVIETHKE
Sbjct  116  IDAGWVLTCIAYPQGDVVIETHKE  139



>ref|XP_007226018.1| hypothetical protein PRUPE_ppa013058mg [Prunus persica]
 gb|EMJ27217.1| hypothetical protein PRUPE_ppa013058mg [Prunus persica]
Length=142

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 5/142 (4%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA LS G+M+STSF+ G+P     SLR   N   A  GLK+   GR+T MA++KVKL+TP
Sbjct  1    MAALS-GTMVSTSFIRGQPMT---SLRLAPNMGQALFGLKANRGGRVT-MAAFKVKLLTP  55

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKVV G VDQSD SFLDDEQ+D
Sbjct  56   DGPQEFECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVEGGVDQSDQSFLDDEQID  115

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP+S+VV+ETHKE
Sbjct  116  GGFVLTCVAYPSSDVVLETHKE  137



>ref|XP_006471012.1| PREDICTED: ferredoxin-2, chloroplastic-like [Citrus sinensis]
Length=144

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MATLS+ +M+STSF+  KP A   SL+A+ N   A  GLK+   GR+  MA+YKVKL+TP
Sbjct  1    MATLSS-AMVSTSFIRSKPTAT--SLKAMPNMGQAIFGLKANRGGRVVAMATYKVKLITP  57

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G+ E +CPDD ++LD AEE G DLPYSCRAG+CSSC GKVVSGTVDQS+ SFLDD+Q+ 
Sbjct  58   GGEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQIG  117

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTC AYPTS+V IETHKE
Sbjct  118  EGFVLTCAAYPTSDVTIETHKE  139



>ref|NP_001289320.1| ferredoxin-like [Pyrus x bretschneideri]
 gb|AHM26652.1| ferredoxin 1 [Pyrus x bretschneideri]
Length=144

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            AT  +G+M+STSF+ G+P     SLR   N   A  GLK+   GR+  MA+YKVKL+TP 
Sbjct  3    ATALSGTMVSTSFIRGQPMT---SLRLSPNVGQALFGLKANRGGRVA-MAAYKVKLLTPE  58

Query  360  GDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDA  181
            G  EF+CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG VDQSD SFLDDEQ+D 
Sbjct  59   GPQEFECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVSGGVDQSDQSFLDDEQIDG  118

Query  180  GYVLTCVAYPTSNVVIETHKE  118
            G+VLTCVAYP+S+V +ETHKE
Sbjct  119  GFVLTCVAYPSSDVTLETHKE  139



>gb|KDP38815.1| hypothetical protein JCGZ_04972 [Jatropha curcas]
Length=145

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 3/141 (2%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            +T  + +M+STSF   +P     SLRA+ N   A  GLKS   G+   MASYKVKL+TP 
Sbjct  3    STALSSAMVSTSFTRRQPVT---SLRALPNVGQALFGLKSSRGGKFKAMASYKVKLLTPE  59

Query  360  GDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDA  181
            G+   +CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKVV G VDQSD SFLDDEQM+ 
Sbjct  60   GEKVIECPDDVYILDAAEEAGVDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQMEE  119

Query  180  GYVLTCVAYPTSNVVIETHKE  118
            G+VLTCVAYPTS+VVIETHKE
Sbjct  120  GWVLTCVAYPTSDVVIETHKE  140



>gb|KDO50081.1| hypothetical protein CISIN_1g032230mg [Citrus sinensis]
Length=145

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 114/144 (79%), Gaps = 5/144 (3%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLV  370
            MA LS+ +M+STSF+  KP     SL+A+ N   A  GLK+ N   GR+  MA+YKVKL+
Sbjct  1    MAALSS-AMVSTSFIRNKPTVT--SLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLI  57

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +CPDD Y+LD AE+ G DLPYSCRAGSCS+CAGKVVSG+VDQSD SFL+D+Q
Sbjct  58   TPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKVVSGSVDQSDGSFLEDDQ  117

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +DAGYVLTCVAYPTS+V +ETHK+
Sbjct  118  IDAGYVLTCVAYPTSDVTVETHKD  141



>ref|XP_006471013.1| PREDICTED: ferredoxin-2, chloroplastic-like [Citrus sinensis]
Length=145

 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 114/144 (79%), Gaps = 5/144 (3%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLV  370
            MA LS+ +M+STSF+  KP     SL+A+ N   A  GLK+ N   GR+  MA+YKVKL+
Sbjct  1    MAALSS-AMVSTSFVRNKPTVT--SLKAMPNMGQALFGLKANNNRGGRVIAMATYKVKLI  57

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +CPDD Y+LD AE+ G DLPYSCRAGSCS+CAGKVVSG+VDQSD SFL+D+Q
Sbjct  58   TPEGEQEIECPDDTYILDAAEDAGIDLPYSCRAGSCSTCAGKVVSGSVDQSDGSFLEDDQ  117

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +DAGYVLTCVAYPTS+V +ETHK+
Sbjct  118  IDAGYVLTCVAYPTSDVTVETHKD  141



>ref|XP_004299909.1| PREDICTED: ferredoxin-1-like [Fragaria vesca subsp. vesca]
Length=144

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 111/143 (78%), Gaps = 5/143 (3%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAIS-NFRPAQLGLKSGNMGRMTCMASYKVKLVT  367
            MA LS G+M+STSF+ G+P +   SLR+ + N   A  GLKS N G    MA+YKV L T
Sbjct  1    MAALS-GTMVSTSFIRGQPMS---SLRSANPNVGQALFGLKSNNRGGRVAMAAYKVTLKT  56

Query  366  PTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQM  187
            P G  EF+CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKVV GTVDQSD SFLDD+Q+
Sbjct  57   PEGVTEFECPDDVYILDAAEEAGLDLPYSCRAGSCSSCAGKVVDGTVDQSDQSFLDDDQI  116

Query  186  DAGYVLTCVAYPTSNVVIETHKE  118
            D G+VLTCVAYP+S+V +ETHKE
Sbjct  117  DGGFVLTCVAYPSSDVTLETHKE  139



>ref|XP_002530673.1| Ferredoxin-2, chloroplast precursor, putative [Ricinus communis]
 gb|EEF31704.1| Ferredoxin-2, chloroplast precursor, putative [Ricinus communis]
Length=145

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 3/141 (2%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            +T  + +++STSF   +P     SLRA+ N   A  GL S   G+   MA +KVKL+TP 
Sbjct  3    STALSSAVVSTSFTRRQPVT---SLRALPNVGQALFGLNSSRGGKFKAMAVHKVKLITPE  59

Query  360  GDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDA  181
            G+ E +CPDDVY+LD  EE G DLPYSCRAGSCSSCAGKVVSGT+DQSD SFLDDEQM+A
Sbjct  60   GEKELECPDDVYILDHFEEAGVDLPYSCRAGSCSSCAGKVVSGTLDQSDGSFLDDEQMEA  119

Query  180  GYVLTCVAYPTSNVVIETHKE  118
            G+VLTCVAYP S++VIETHKE
Sbjct  120  GWVLTCVAYPQSDLVIETHKE  140



>gb|EYU26514.1| hypothetical protein MIMGU_mgv1a015835mg [Erythranthe guttata]
Length=144

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNMGRMTCMASYKVKLVT  367
            MA+LS+ +M ST+ L  KPAAA  ++ ++ +F+ A L GLKS    R+TCMA+Y V L+T
Sbjct  1    MASLSS-TMFSTAMLPRKPAAA--AVVSLPSFKQAALFGLKSAP-SRLTCMATYNVTLIT  56

Query  366  PTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQM  187
            P G+  F C DDVY+LDQAEE G DLPYSCRAGSCSSCAGKVV G VDQSD SFL+DEQM
Sbjct  57   PEGEVVFPCDDDVYILDQAEEAGYDLPYSCRAGSCSSCAGKVVKGAVDQSDGSFLEDEQM  116

Query  186  DAGYVLTCVAYPTSNVVIETHKE  118
            + G+VLTCVAYPT +VVIETHKE
Sbjct  117  EEGWVLTCVAYPTGDVVIETHKE  139



>ref|XP_011009386.1| PREDICTED: ferredoxin-A-like [Populus euphratica]
Length=149

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 4/142 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            A LS  +M+STSF   KP     SLRA+ +   A  GLK+   GR   MA++KVKL+TP 
Sbjct  5    AALSTSAMVSTSFARQKPVT---SLRALPSVGEALFGLKASRGGRARAMAAHKVKLITPD  61

Query  360  GDFEFDCPDDVYVLDQAEEL-GADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
            G+ EFDCP +VY+LD AEE  G DLPYSCRAG+CSSCAGKVV GTVDQSD SFLD+ Q+ 
Sbjct  62   GEKEFDCPTNVYILDHAEEAHGMDLPYSCRAGACSSCAGKVVQGTVDQSDGSFLDEGQIA  121

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYPTS+VVIETHKE
Sbjct  122  EGWVLTCVAYPTSDVVIETHKE  143



>gb|AFK49089.1| unknown [Lotus japonicus]
Length=143

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 8/144 (6%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT  A  G+ +STSFL  +P AA        N      G+K G+ G    MA+YKVKL+
Sbjct  1    MATAPAFSGATVSTSFLRRQPVAA------FPNVGQVMFGVKGGSRGGRVTMAAYKVKLI  54

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G  EF+CPDDVY+LDQAEE+G D+PYSCRAGSCSSCAGKVV G V+QSD SFLDD+Q
Sbjct  55   TPEGPQEFECPDDVYILDQAEEVGIDIPYSCRAGSCSSCAGKVVEGAVNQSDGSFLDDDQ  114

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            ++ G+VLTCVAYP S+VVIETHKE
Sbjct  115  VEGGFVLTCVAYPKSDVVIETHKE  138



>ref|XP_011028285.1| PREDICTED: ferredoxin-like [Populus euphratica]
Length=147

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 109/145 (75%), Gaps = 6/145 (4%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT +A   +M+STSF    P     SLRA+ N   A LGLK+   GR+  MA++ VKL+
Sbjct  1    MATTAALSSAMVSTSFTRRVPVT---SLRALPNVGEALLGLKASRGGRVKAMAAHTVKLI  57

Query  369  TPTGDFEFDCPDDVYVLDQAEELGA-DLPYscragscsscaGKVVSGTVDQSDNSFLDDE  193
            TP G+ EF CPDD+Y+LD AEE    DLPYSCRAGSCSSC GK+V GTVDQSD SFLDD+
Sbjct  58   TPDGEKEFKCPDDIYILDHAEEAEEIDLPYSCRAGSCSSCLGKIVKGTVDQSDASFLDDD  117

Query  192  QMDAGYVLTCVAYPTSNVVIETHKE  118
            Q++ G+VLTCVAYPTS+VVIETHKE
Sbjct  118  QIEEGWVLTCVAYPTSDVVIETHKE  142



>ref|XP_006384985.1| Ferredoxin 2 family protein [Populus trichocarpa]
 gb|ABK95659.1| unknown [Populus trichocarpa]
 gb|ABK96407.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP62782.1| Ferredoxin 2 family protein [Populus trichocarpa]
Length=147

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 109/145 (75%), Gaps = 6/145 (4%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT +A   +M+STSF    P     SLRA+ N   + LGLK+   GR+  MA+Y VKL+
Sbjct  1    MATTAALSSAMVSTSFTRRVPVT---SLRALPNVGESLLGLKASRGGRVKAMAAYTVKLI  57

Query  369  TPTGDFEFDCPDDVYVLDQAEELG-ADLPYscragscsscaGKVVSGTVDQSDNSFLDDE  193
            TP G+ EF CPDD+Y+LD AEE    DLPYSCRAGSCSSC GK+V GTVDQSD SFLDD+
Sbjct  58   TPDGEKEFACPDDIYILDHAEEAEEIDLPYSCRAGSCSSCLGKIVKGTVDQSDASFLDDD  117

Query  192  QMDAGYVLTCVAYPTSNVVIETHKE  118
            Q++ G+VLTCVAYPTS+VVIETHKE
Sbjct  118  QIEEGWVLTCVAYPTSDVVIETHKE  142



>ref|XP_009355250.1| PREDICTED: ferredoxin, leaf L-A-like [Pyrus x bretschneideri]
Length=147

 Score =   149 bits (377),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = -3

Query  522  SMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFD  343
            +M+STSF+ G+P     SLR   N   A  GLK+   GR+  MA+YKVKL+TP G  EF+
Sbjct  12   TMVSTSFIRGQPMT---SLRLSPNVGQALFGLKANRGGRVA-MAAYKVKLITPEGPQEFE  67

Query  342  CPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTC  163
            CP+DVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q+  G+VLTC
Sbjct  68   CPEDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIGGGFVLTC  127

Query  162  VAYPTSNVVIETHKE  118
            VAYP+S+V +ETHKE
Sbjct  128  VAYPSSDVTLETHKE  142



>ref|XP_003629958.1| Ferredoxin I [Medicago truncatula]
 gb|AET04434.1| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
Length=148

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 5/145 (3%)
 Frame = -3

Query  543  MATLSA---GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKL  373
            MAT +A   G+M+STSF+  +P     SL A  N      G+K+G   R+T MA+YKVKL
Sbjct  1    MATTTAALSGTMVSTSFIRRQPM--NTSLTAFPNVGQTLFGVKAGRGSRITAMATYKVKL  58

Query  372  VTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDE  193
            +TP G  E  CPD+ Y+LD AEE G DLPYSCRAG+CSSCA KVV G VD SDNSFLDD+
Sbjct  59   ITPDGTKELTCPDNEYILDVAEEQGIDLPYSCRAGACSSCAAKVVEGEVDNSDNSFLDDD  118

Query  192  QMDAGYVLTCVAYPTSNVVIETHKE  118
            Q+ AG+VLTCVAYP S++VIETHKE
Sbjct  119  QLSAGFVLTCVAYPRSDLVIETHKE  143



>gb|AFK39763.1| unknown [Lotus japonicus]
Length=132

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 9/137 (7%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT  A  G+M++TSFL  +P      L+A  N   A  GLKSG  GR+T MA+YKVKL+
Sbjct  1    MATTPALSGTMVNTSFLRRQP------LKAFPNVGQALFGLKSGCGGRVT-MAAYKVKLI  53

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G FEF+CPDDVY+LD AEE G D+PYSCRAGSCSSCAGKVV G VDQSD SFLDD+Q
Sbjct  54   TPEGPFEFECPDDVYILDHAEEQGIDIPYSCRAGSCSSCAGKVVGGNVDQSDGSFLDDDQ  113

Query  189  MDAGYVLTCVAYPTSNV  139
            +DAG+VLTCVAYP S+V
Sbjct  114  IDAGFVLTCVAYPQSDV  130



>ref|XP_004504188.1| PREDICTED: ferredoxin-1, chloroplastic-like [Cicer arietinum]
Length=148

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 2/137 (1%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFE  349
            +G+M S SF+  +  A   SLRA  N   A  G+K+G   R+T MA+YK+KL+TP G  E
Sbjct  9    SGTMASASFV--RRQATSTSLRAFPNSGQALFGVKAGRGSRVTAMAAYKIKLITPEGTKE  66

Query  348  FDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVL  169
            F CPD+  +LD+AEE   DLPYSCRAG+CSSC GKV+ G VDQ+DNSFLDD+Q++AG++L
Sbjct  67   FQCPDEEIILDKAEEENIDLPYSCRAGACSSCVGKVIEGKVDQTDNSFLDDDQINAGFIL  126

Query  168  TCVAYPTSNVVIETHKE  118
            TCVAYP S+VVIETHKE
Sbjct  127  TCVAYPRSDVVIETHKE  143



>sp|P09911.2|FER1_PEA RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Ferredoxin 
I; Flags: Precursor [Pisum sativum]
 gb|AAA33665.1| ferredoxin I precursor [Pisum sativum]
Length=149

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAG-GSLRAISN-FRPAQLGLKSGNMGRMTCMASYKVK  376
            MAT  A  G+ +STSFL  +P      + +A SN F   +  LK G++     MASYKVK
Sbjct  1    MATTPALYGTAVSTSFLRTQPMPMSVTTTKAFSNGFLGLKTSLKRGDLA--VAMASYKVK  58

Query  375  LVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDD  196
            LVTP G  EF+CP DVY+LD AEE+G DLPYSCRAGSCSSCAGKVV G VDQSD SFLDD
Sbjct  59   LVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDD  118

Query  195  EQMDAGYVLTCVAYPTSNVVIETHKE  118
            EQ++AG+VLTCVAYPTS+VVIETHKE
Sbjct  119  EQIEAGFVLTCVAYPTSDVVIETHKE  144



>ref|XP_002304053.1| ferredoxin I family protein [Populus trichocarpa]
 gb|ABK94793.1| unknown [Populus trichocarpa]
 gb|ABK95222.1| unknown [Populus trichocarpa]
 gb|EEE79032.1| ferredoxin I family protein [Populus trichocarpa]
Length=149

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = -3

Query  519  MMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDC  340
            M+STSF   KP     SLRA+     A  GLK+   GR   MA++KVKL+TP G+ EFDC
Sbjct  12   MVSTSFAKQKPVT---SLRALPAVGEALFGLKASRGGRAKAMAAHKVKLITPDGEEEFDC  68

Query  339  PDDVYVLDQAEEL-GADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTC  163
            P +VY+LD AEE  G DLPYSCRAG+CSSCAGKVV GTVDQSD SFLD++Q+  G+VLTC
Sbjct  69   PTNVYILDHAEEAHGMDLPYSCRAGACSSCAGKVVQGTVDQSDGSFLDEDQIAEGWVLTC  128

Query  162  VAYPTSNVVIETHKE  118
            VAYPTS+VVIETHKE
Sbjct  129  VAYPTSDVVIETHKE  143



>ref|XP_006302971.1| hypothetical protein CARUB_v10021110mg [Capsella rubella]
 gb|EOA35869.1| hypothetical protein CARUB_v10021110mg [Capsella rubella]
Length=148

 Score =   147 bits (371),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 109/144 (76%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+   PA    SLR++       L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFIRRSPAPI--SLRSLPLANAQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDDEQ
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +DAG+VLTC AYPTS+V IETHKE
Sbjct  121  IDAGFVLTCAAYPTSDVTIETHKE  144



>ref|XP_008378879.1| PREDICTED: ferredoxin, leaf L-A-like [Malus domestica]
Length=147

 Score =   147 bits (370),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = -3

Query  522  SMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFD  343
            +M+STSF+ G+P     SLR   N      GLK+   GR+  MA+YKVKL+TP G  EF+
Sbjct  12   TMVSTSFIRGQPMT---SLRLSPNVGQXLXGLKANRGGRVA-MAAYKVKLITPEGPQEFE  67

Query  342  CPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTC  163
            CP+DVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q+  G+VLTC
Sbjct  68   CPEDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIGGGFVLTC  127

Query  162  VAYPTSNVVIETHKE  118
            VAYP S+V +ETHKE
Sbjct  128  VAYPASDVTLETHKE  142



>gb|AAO42615.1| ferredoxin [Helianthus annuus]
Length=142

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 101/133 (76%), Gaps = 10/133 (8%)
 Frame = -3

Query  513  STSFLSGKPAAAGGSLRAISNFRPA-QLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCP  337
            STSFL  +P          ++ +P+   GLKS N G +T MA+YKV L+TP G  EFDC 
Sbjct  14   STSFLRPQPT---------TSMKPSVMFGLKSSNRGGVTMMATYKVTLITPEGKTEFDCA  64

Query  336  DDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA  157
            DD Y+LD  E+ G DLPYSCRAGSCSSC GKV+SGTVDQSD SFLDD+Q++AG+VLTCVA
Sbjct  65   DDTYILDHCEDAGIDLPYSCRAGSCSSCTGKVISGTVDQSDQSFLDDDQIEAGWVLTCVA  124

Query  156  YPTSNVVIETHKE  118
            YPTS+VVIETHKE
Sbjct  125  YPTSDVVIETHKE  137



>ref|XP_004485473.1| PREDICTED: ferredoxin-1, chloroplastic-like [Cicer arietinum]
Length=151

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -3

Query  525  GSMMSTSFLSGKPAAAGGSLRAISNFR-PAQLGLKSGNMGRMT-CMASYKVKLVTPTGDF  352
            G+ +STSF+  +P +   +    +    P   GLK G  G +   MA+YKVKL+TP G  
Sbjct  9    GTSVSTSFIRRQPMSVTTATTTTTKASFPNSFGLKGGRRGDLVIAMAAYKVKLITPEGPQ  68

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
            EF+CPDDVY+LDQAEE+G +LPYSCRAGSCSSCAGKVV G VDQSD SFLDDEQ+D G+V
Sbjct  69   EFECPDDVYILDQAEEVGLELPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQVDGGFV  128

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYP S+VVIETHKE
Sbjct  129  LTCVAYPKSDVVIETHKE  146



>ref|NP_176291.1| ferredoxin-2 [Arabidopsis thaliana]
 sp|P16972.1|FER2_ARATH RecName: Full=Ferredoxin-2, chloroplastic; Short=AtFd2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG40057.1|AF324706_1 At1g60950 [Arabidopsis thaliana]
 gb|AAG41467.1|AF326885_1 putative ferrodoxin precursor protein [Arabidopsis thaliana]
 gb|AAG51652.1|AC018908_18 ferrodoxin precursor; 39650-40096 [Arabidopsis thaliana]
 gb|AAK00387.1|AF339705_1 putative ferrodoxin precursor protein [Arabidopsis thaliana]
 emb|CAA35754.1| ferredoxin precursor [Arabidopsis thaliana]
 gb|AAA32790.1| ferrodoxin A [Arabidopsis thaliana]
 gb|AAM13033.1| ferrodoxin precursor [Arabidopsis thaliana]
 gb|AAM91336.1| ferrodoxin precursor [Arabidopsis thaliana]
 dbj|BAE98526.1| ferrodoxin precursor [Arabidopsis thaliana]
 gb|AEE33752.1| ferredoxin-2 [Arabidopsis thaliana]
Length=148

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+   PA    SLR++ +     L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFIRRSPAPI--SLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDDEQ
Sbjct  61   TPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETHKE
Sbjct  121  IGEGFVLTCAAYPTSDVTIETHKE  144



>ref|XP_003540157.1| PREDICTED: ferredoxin-1, chloroplastic-like [Glycine max]
Length=147

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 5/144 (3%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT +A  G+MMS+SFL  K  A   SL+A  N   A  G+K G  G +T MAS+KVKL+
Sbjct  1    MATTAALCGTMMSSSFLRRK--AVVTSLKAFPNAN-AVFGVKGGRGGGVTAMASFKVKLI  57

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ EF+CPDDVY+LDQAEE G +LPYSCRAGSCS CAGKVVSG VD SD +FL+DEQ
Sbjct  58   TPEGEKEFECPDDVYILDQAEEEGLELPYSCRAGSCSVCAGKVVSGKVDNSDATFLEDEQ  117

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            ++AG+ LTCVAYPTS+VVIETHKE
Sbjct  118  LEAGFTLTCVAYPTSDVVIETHKE  141



>ref|NP_001237037.1| uncharacterized protein LOC100500372 [Glycine max]
 gb|ACU15429.1| unknown [Glycine max]
Length=147

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 109/145 (75%), Gaps = 5/145 (3%)
 Frame = -3

Query  543  MAT---LSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKL  373
            MAT   L    ++STSFL  K A A  ++R +        GLK G  GR++ MASY VKL
Sbjct  1    MATTPGLCGSVLLSTSFLR-KQAMASVNMRMLKA-NAGVFGLKGGRGGRVSAMASYNVKL  58

Query  372  VTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDE  193
            +TP G+ EF+CPDDV++L++AEE G DLPYSC+AG+CSSCAGKVVSG VDQSD S+LDD 
Sbjct  59   ITPEGEQEFECPDDVFILEKAEEFGIDLPYSCKAGACSSCAGKVVSGKVDQSDGSYLDDT  118

Query  192  QMDAGYVLTCVAYPTSNVVIETHKE  118
            Q+  G+VLTCVAYPTS+VVI+TH+E
Sbjct  119  QIGNGFVLTCVAYPTSDVVIQTHQE  143



>ref|XP_003592975.1| Ferredoxin I [Medicago truncatula]
 gb|AES63226.1| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
 gb|AFK43357.1| unknown [Medicago truncatula]
Length=150

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 108/147 (73%), Gaps = 7/147 (5%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKS--GNMGRM-TCMASYKV  379
            MAT  A  G+ +STSFL  +P     S+   +   P+  GLKS  G  G +   MA+YKV
Sbjct  1    MATTPALYGTAVSTSFLRRQPMPV--SISTTTKAFPSGFGLKSKTGKRGDLAVAMATYKV  58

Query  378  KLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLD  199
            KLVTP G  EFDCP DVY+LD AEE+G DLPYSCRAGSCSSCAGKV +G VDQSD SFLD
Sbjct  59   KLVTPEGTQEFDCPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVAAGAVDQSDGSFLD  118

Query  198  DEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D+Q++ G+VLTCVAYPTS+V IETHKE
Sbjct  119  DDQIEEGWVLTCVAYPTSDVTIETHKE  145



>ref|XP_004146260.1| PREDICTED: ferredoxin-1, chloroplastic-like [Cucumis sativus]
 gb|KGN57597.1| Ferredoxin-2 [Cucumis sativus]
Length=148

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 103/135 (76%), Gaps = 5/135 (4%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLVTPTGDFEFD  343
            ++TSFL  +P      +R + NF      LK G+   GR+  MA Y VKL+TPTG+ EF 
Sbjct  12   LNTSFLQKQPTT---RIRLVLNFGQDLFKLKGGSSRGGRVIAMAEYNVKLITPTGETEFK  68

Query  342  CPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTC  163
            CPDD Y+LD+AE++G DLPYSCRAGSCSSCAGKVVSG VDQSD S+L+D+QMD G+VLTC
Sbjct  69   CPDDEYILDRAEQMGFDLPYSCRAGSCSSCAGKVVSGKVDQSDGSYLEDDQMDEGWVLTC  128

Query  162  VAYPTSNVVIETHKE  118
            VAYP S+VVIETHKE
Sbjct  129  VAYPQSDVVIETHKE  143



>gb|AEI83424.1| chloroplast ferredoxin I [Camellia sinensis]
Length=147

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA   + +M+STSFL  +      SLR++ N   A  G+K G  GR+T MA YKVKL+TP
Sbjct  3    MAASLSSTMVSTSFLQRQQPVT--SLRSLPNVGQALFGVKGGRGGRVTAMAMYKVKLLTP  60

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G  EF+CPDDVY+LDQAEE+G DLPYSCRAGSCSSCAGK+  G VDQSD SFLDD+QMD
Sbjct  61   EGPQEFECPDDVYILDQAEEIGIDLPYSCRAGSCSSCAGKLTGGKVDQSDGSFLDDDQMD  120

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
             G+VLTCVAYP S+VVIETHKE
Sbjct  121  GGWVLTCVAYPQSDVVIETHKE  142



>gb|KHN45465.1| Ferredoxin-1, chloroplastic [Glycine soja]
Length=145

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 6/144 (4%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MAT  A  G+M++TSFL  + +    S +A      A  G+K G  GR+  MA+YKVKL+
Sbjct  1    MATTGALCGTMLNTSFLKRQASVNMTSFKA----NAAVFGVKGGRGGRVRAMATYKVKLI  56

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ EF+CPDD+Y+LDQAEE G DLPYSCRAGSCS+CA KVVSG +DQSD SFLDD+Q
Sbjct  57   TPEGEQEFECPDDIYILDQAEENGIDLPYSCRAGSCSACAAKVVSGKLDQSDGSFLDDDQ  116

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +DAG+VLTCVAYPTS++VIETH+E
Sbjct  117  IDAGFVLTCVAYPTSDIVIETHRE  140



>emb|CDY20591.1| BnaC08g14670D [Brassica napus]
Length=148

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 110/144 (76%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + ++++TSFL  +      SLR++       L GLKS     GR+TCMA+YKVK +
Sbjct  3    STALSSAIVNTSFLRRQQTPI--SLRSLPLANTQSLFGLKSSTARGGRVTCMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD A+E G DLPYSCRAGSCSSCAGKVVSG+VDQ+D SFLDD+Q
Sbjct  61   TPEGEQEVECEDDVYVLDAADEAGIDLPYSCRAGSCSSCAGKVVSGSVDQTDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M+ GYVLTCVAYPTS+VVIETHKE
Sbjct  121  MNEGYVLTCVAYPTSDVVIETHKE  144



>ref|XP_006417400.1| hypothetical protein EUTSA_v10009020mg [Eutrema salsugineum]
 gb|ESQ35753.1| hypothetical protein EUTSA_v10009020mg [Eutrema salsugineum]
Length=148

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 109/144 (76%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++STSFL  +      SLR++       L GLKS     GR+T MA+YKVK +
Sbjct  3    STALSSAIVSTSFLRRQQTPI--SLRSLPAANTQSLFGLKSSTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG++DQSD SFLDD+Q
Sbjct  61   TPEGEQEVECEDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M+ GYVLTCVAYPTS+VVIETHKE
Sbjct  121  MNDGYVLTCVAYPTSDVVIETHKE  144



>gb|AAQ21119.1| ferredoxin I [Trifolium pratense]
Length=152

 Score =   144 bits (363),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 5/147 (3%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGR---MTCMASYKV  379
            MAT  A  G+ +STSF+  +P     +    +   P+  GLKS +  R      MA+YKV
Sbjct  1    MATTPALYGTAVSTSFMRRQPVPMSVATTTTTKAFPSGFGLKSVSTKRGDLAVAMATYKV  60

Query  378  KLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLD  199
            KL+TP G  EFDCPDDVY+LD AEE+G +LPYSCRAGSCSSCAGKVV+G V+Q D SFLD
Sbjct  61   KLITPEGPQEFDCPDDVYILDHAEEVGIELPYSCRAGSCSSCAGKVVNGNVNQEDGSFLD  120

Query  198  DEQMDAGYVLTCVAYPTSNVVIETHKE  118
            DEQ++ G+VLTCVA+PTS+V IETHKE
Sbjct  121  DEQIEGGWVLTCVAFPTSDVTIETHKE  147



>ref|XP_003540156.2| PREDICTED: ferredoxin-1, chloroplastic-like [Glycine max]
Length=174

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 6/146 (4%)
 Frame = -3

Query  549  KKMATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVK  376
            + MAT  A  G+M++TSFL  + +    S +A      A  G+K G  GR+  MA+YKVK
Sbjct  28   ENMATTGALCGTMLNTSFLKRQASVNMTSFKA----NAAVFGVKGGRGGRVRAMATYKVK  83

Query  375  LVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDD  196
            L+TP G+ EF+CPDD+Y+LDQAEE G DLPYSCRAGSCS+CA KVVSG +DQSD SFLDD
Sbjct  84   LITPEGEQEFECPDDIYILDQAEENGIDLPYSCRAGSCSACAAKVVSGKLDQSDGSFLDD  143

Query  195  EQMDAGYVLTCVAYPTSNVVIETHKE  118
            +Q+DAG+VLTCVAYPTS++VIETH+E
Sbjct  144  DQIDAGFVLTCVAYPTSDIVIETHRE  169



>ref|XP_002888117.1| fed A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64376.1| fed A [Arabidopsis lyrata subsp. lyrata]
Length=148

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+   PA    SLR++ +     L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFIRRSPAPI--SLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDDEQ
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETHKE
Sbjct  121  IGQGFVLTCAAYPTSDVTIETHKE  144



>gb|EPS71399.1| ferredoxin-1, chloroplastic [Genlisea aurea]
Length=145

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -3

Query  441  AQLGLKS--GNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscrag  268
            A  GLKS  G  GR TCMASY VKL+TP G+  F+C DDVY+LD+AE+ G +LPYSCRAG
Sbjct  31   ALFGLKSRAGGGGRFTCMASYNVKLITPEGEINFECSDDVYILDKAEDEGYELPYSCRAG  90

Query  267  scsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            SCSSCAGKVVSG+VDQ D SFL+DEQ+ AG+VLTCVAYPTS+VVIETHKE
Sbjct  91   SCSSCAGKVVSGSVDQQDGSFLEDEQVGAGWVLTCVAYPTSDVVIETHKE  140



>ref|XP_010030127.1| PREDICTED: ferredoxin-like [Eucalyptus grandis]
Length=146

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFE  349
            +G+++S+ F+  +P      LRA  N   A  G+ SG  GR+T MA+YKV L+TP G  E
Sbjct  9    SGTVVSSPFVRMQPV---NRLRAFPNVGQALFGVNSGR-GRVTAMAAYKVTLLTPEGKVE  64

Query  348  FDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVL  169
             D PDDVY+LD AEE G DLPYSCRAGSCSSCAGKVV+G+VDQSD SFLDD+Q++ G+VL
Sbjct  65   LDVPDDVYILDYAEEQGIDLPYSCRAGSCSSCAGKVVAGSVDQSDGSFLDDDQIEEGWVL  124

Query  168  TCVAYPTSNVVIETHKE  118
            TCVAYP S V IETHKE
Sbjct  125  TCVAYPKSEVTIETHKE  141



>emb|CDY20975.1| BnaA08g25500D [Brassica napus]
Length=148

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + ++++TSFL  +      SLR++       L GL+S     GR+TCMA+YKVK +
Sbjct  3    STAFSSAIVNTSFLRRQQTPL--SLRSLPVANTQSLFGLRSSTARGGRVTCMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG +DQ+D SFLDD+Q
Sbjct  61   TPEGEQEVECEDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFIDQTDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M  GYVLTCVAYPTS+VVIETHKE
Sbjct  121  MSEGYVLTCVAYPTSDVVIETHKE  144



>ref|XP_008456053.1| PREDICTED: ferredoxin-like [Cucumis melo]
Length=148

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 103/135 (76%), Gaps = 5/135 (4%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLVTPTGDFEFD  343
            ++TSFL  +PA   GS   + NF     GLK G+   GR+  MA Y VKL+TP G+ EF 
Sbjct  12   LNTSFLRKQPATRLGS---VLNFGQDLFGLKGGSSRGGRVIAMAEYNVKLITPAGETEFK  68

Query  342  CPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTC  163
            C DD Y+LD+AEE+G DLPYSCRAGSCSSCAGKVVSG VDQSD S+LD++QM+ G+VLTC
Sbjct  69   CQDDDYILDRAEEMGFDLPYSCRAGSCSSCAGKVVSGKVDQSDGSYLDEDQMNEGWVLTC  128

Query  162  VAYPTSNVVIETHKE  118
            VAYP S+VVIETHKE
Sbjct  129  VAYPQSDVVIETHKE  143



>ref|XP_010547432.1| PREDICTED: ferredoxin, leaf L-A [Tarenaya hassleriana]
Length=150

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLVT  367
            +T  +G++ STSFL  +P+    +           LGL+S +   GR+  MA+YKVK +T
Sbjct  4    STALSGAIFSTSFLHRQPSPPAVAFTLTPANSSTALGLRSTSSRGGRVVAMATYKVKFIT  63

Query  366  PTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQM  187
            P G+ E +CPDDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q+
Sbjct  64   PDGESEVECPDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQI  123

Query  186  DAGYVLTCVAYPTSNVVIETHKE  118
              GYVLTC AYP S+VVI+TH+E
Sbjct  124  AEGYVLTCAAYPASDVVIQTHQE  146



>sp|P04669.1|FER_SILPR RecName: Full=Ferredoxin, chloroplastic; Flags: Precursor [Silene 
latifolia subsp. alba]
 emb|CAA26281.1| unnamed protein product [Silene latifolia subsp. alba]
Length=146

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  456  SNFRPAQLGLKSGNMGRMTCMASYKVKLVT-PTGDFEFDCPDDVYVLDQAEELGADLPYs  280
            +N   A  GLK+G+ GR+T MA+YKV L+T  +G   FDCPDDVYVLDQAEE G DLPYS
Sbjct  28   TNMGQALFGLKAGSRGRVTAMATYKVTLITKESGTVTFDCPDDVYVLDQAEEEGIDLPYS  87

Query  279  cragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CRAGSCSSCAGKVV+G+VDQSD SFLDD+Q++AG+VLTC AYP+++V IETHKE
Sbjct  88   CRAGSCSSCAGKVVAGSVDQSDQSFLDDDQIEAGWVLTCAAYPSADVTIETHKE  141



>ref|XP_009399171.1| PREDICTED: ferredoxin, leaf L-A-like [Musa acuminata subsp. malaccensis]
Length=143

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = -3

Query  519  MMSTSFLS-GKPAA----AGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD  355
            M S S LS G P A    AG SLRA+     +  G+ +G  GR+T MA YKVKL+TP G+
Sbjct  1    MASASALSLGTPFALRQSAGVSLRALPKLGRSLFGVDAGR-GRVTAMAVYKVKLLTPEGE  59

Query  354  FEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGY  175
               +CPDDVY+LD AEE   DLPYSC AGSCSSCAGKVV G+VDQSD SFLDD+Q+ AG+
Sbjct  60   KVIECPDDVYILDAAEEAEIDLPYSCHAGSCSSCAGKVVQGSVDQSDGSFLDDDQIGAGF  119

Query  174  VLTCVAYPTSNVVIETHKE  118
            VLTCVAYPTS+VVIETHKE
Sbjct  120  VLTCVAYPTSDVVIETHKE  138



>gb|KFK40743.1| hypothetical protein AALP_AA2G035400 [Arabis alpina]
Length=148

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  +   A  SLR++S      L GLKS  +  GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFI--RRHTAPTSLRSLSTSNTQSLFGLKSSTVRGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKV SG+VDQSD SFLDDEQ
Sbjct  61   TPDGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVKSGSVDQSDQSFLDDEQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETHKE
Sbjct  121  IAEGFVLTCAAYPTSDVTIETHKE  144



>ref|XP_007148535.1| hypothetical protein PHAVU_006G216800g [Phaseolus vulgaris]
 gb|ESW20529.1| hypothetical protein PHAVU_006G216800g [Phaseolus vulgaris]
Length=148

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -3

Query  531  SAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF  352
            S GS+++TSFL  +P     SL+A SN   A  G+K G  GR+T MASYKVKLVTP+G+ 
Sbjct  8    SCGSVLNTSFLRKQPLNHT-SLKAFSNAN-AVFGVKGGRGGRVTAMASYKVKLVTPSGEQ  65

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
            EF CPDD Y+LD AEE G DLPYSCRAGSCSSCAGKVV G VDQSD +FLDD+Q++ G+V
Sbjct  66   EFSCPDDAYILDAAEEEGIDLPYSCRAGSCSSCAGKVVGGQVDQSDGNFLDDDQIEQGFV  125

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYPTS+VVI THKE
Sbjct  126  LTCVAYPTSDVVIVTHKE  143



>ref|XP_007148533.1| hypothetical protein PHAVU_006G216600g [Phaseolus vulgaris]
 gb|ESW20527.1| hypothetical protein PHAVU_006G216600g [Phaseolus vulgaris]
Length=148

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -3

Query  531  SAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF  352
            S GS+++TSFL  +P     SL+A SN   A  G+K G  GR+T MASYKVKLVTP+G+ 
Sbjct  8    SCGSVLNTSFLRKQPLNHT-SLKAFSNAN-AVFGVKGGRGGRVTAMASYKVKLVTPSGEQ  65

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
            EF CPDD Y+LD AEE G DLPYSCRAGSCSSCAGKVV G VDQSD +FLDD+Q++ G+V
Sbjct  66   EFSCPDDAYILDAAEEEGIDLPYSCRAGSCSSCAGKVVGGQVDQSDGNFLDDDQIEQGFV  125

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYPTS+VVI THKE
Sbjct  126  LTCVAYPTSDVVIVTHKE  143



>emb|CDO97577.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 106/146 (73%), Gaps = 8/146 (5%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLK----SGNMGRMTCMASYKVK  376
            MATLS G+M+STSFL  KP     SL  ++    A  GLK    +G  G++TCMA YK+K
Sbjct  1    MATLS-GTMVSTSFLQRKPVTGLSSLPCVNR---ALFGLKGVAGAGRGGKITCMAGYKIK  56

Query  375  LVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDD  196
            L+TP G+ E     + Y+LD  EE G DLPYSCRAGSCSSCAGK+V GTVDQ+D SFLDD
Sbjct  57   LITPGGEVEHVVDGEEYILDAFEEAGYDLPYSCRAGSCSSCAGKIVQGTVDQADQSFLDD  116

Query  195  EQMDAGYVLTCVAYPTSNVVIETHKE  118
            +QMD G+VLTCVA PTS +VIETHKE
Sbjct  117  DQMDEGWVLTCVARPTSELVIETHKE  142



>emb|CDY03773.1| BnaC01g28900D [Brassica napus]
Length=148

 Score =   139 bits (350),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSFL  + A    SLR++ +     L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFLRRQTAPI--SLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETH+E
Sbjct  121  IAEGFVLTCAAYPTSDVTIETHRE  144



>ref|XP_010430084.1| PREDICTED: ferredoxin-2, chloroplastic [Camelina sativa]
Length=148

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + + A  SLR++       L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFI--RRSTAPISLRSLPLANTQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+   +C DD+YVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQVVECDDDIYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M+ G+VLTCVAYPTS+V IETHKE
Sbjct  121  MNEGFVLTCVAYPTSDVTIETHKE  144



>ref|XP_009104198.1| PREDICTED: ferredoxin, leaf L-A [Brassica rapa]
 emb|CDY46194.1| BnaA01g23160D [Brassica napus]
Length=148

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSFL  +      SLR++ +     L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFLRRQTTPI--SLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            + AG+VLTC AYPTS+V IETH+E
Sbjct  121  IAAGFVLTCAAYPTSDVTIETHRE  144



>ref|XP_011092335.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin-like [Sesamum indicum]
Length=148

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKS-GNMGRMTCMASYKVKLV  370
            M +LS+ +M S + LS KP     S+R++     A L GLKS  + GR+TCMA+Y VK +
Sbjct  1    MVSLSS-TMFSAAVLSRKPVVCATSIRSLPGLNQAALFGLKSPSSGGRVTCMATYNVKXI  59

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP+G+  F C DD Y+L++AEE+G  LPYSC AGSCSSCAGKVVSG VDQSD S+LD +Q
Sbjct  60   TPSGELTFSCADDEYLLEKAEEVGHGLPYSCGAGSCSSCAGKVVSGXVDQSDQSYLDYDQ  119

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            ++ G+VL C AYPTS+V IETHKE
Sbjct  120  IEEGWVLMCAAYPTSDVTIETHKE  143



>ref|XP_009144404.1| PREDICTED: ferredoxin-1, chloroplastic [Brassica rapa]
Length=148

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + ++++TSFL  +      SLR++       L GL+S     GR+T MA+YKVK +
Sbjct  3    STALSSAIVNTSFLRRQQPPL--SLRSLPLANTQSLFGLRSSTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG +DQ+D SFLDD+Q
Sbjct  61   TPGGEQEVECEDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFIDQTDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M  GYVLTCVAYPTS+VVIETHKE
Sbjct  121  MSEGYVLTCVAYPTSDVVIETHKE  144



>ref|XP_010533959.1| PREDICTED: ferredoxin, leaf L-A-like [Tarenaya hassleriana]
Length=151

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNF--RPA-QLGLKSGNMGRMTCMASYKVKLV  370
            +T  +G++ STSFL  +P+ +  +++++S     PA +L   S   G +  MA+YKVK V
Sbjct  4    STALSGAIFSTSFLPLQPSPSPVTIKSLSPAISSPALRLSSASSRGGGVVAMATYKVKFV  63

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E  C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVV+G+VDQSD SFLDD+Q
Sbjct  64   TPDGETEIQCDDDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVTGSVDQSDQSFLDDDQ  123

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  GYVLTCVAYPTS+VVI+TH+E
Sbjct  124  IGEGYVLTCVAYPTSDVVIQTHQE  147



>ref|XP_008799183.1| PREDICTED: ferredoxin-like [Phoenix dactylifera]
Length=152

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGAD  292
            SLRA+     A  GL+S + GR+T MA + VKL+TP G+  FDCPDD Y+LD+AEE G D
Sbjct  31   SLRALPRTGRALFGLES-SRGRVTAMAVFNVKLITPDGEVVFDCPDDRYILDEAEEQGID  89

Query  291  LPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +PYSCRAGSC +C GK+V G VDQSD S LDD+QM  GYVLTCVAYP SNVVIETHKE
Sbjct  90   MPYSCRAGSCVTCVGKMVGGEVDQSDGSMLDDDQMKEGYVLTCVAYPRSNVVIETHKE  147



>sp|O04683.1|FER1_MESCR RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Ferredoxin 
I; Flags: Precursor [Mesembryanthemum crystallinum]
 gb|AAB61593.1| ferredoxin I precursor [Mesembryanthemum crystallinum]
Length=148

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKS-GNMGRMTCMASYKVKLVTPTGDF  352
            +G+ MST+F    P          +N   A  GLKS  + GR+T MA+YKV LVTP G  
Sbjct  9    SGATMSTAFAPKTPPMTAA---LPTNVGRALFGLKSSASRGRVTAMAAYKVTLVTPEGKQ  65

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
            E +CPDDVY+LD AEE G DLPYSCRAGSCSSCAGKV SG+V+Q D SFLDD+Q+  G+V
Sbjct  66   ELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWV  125

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYPT +V IETHKE
Sbjct  126  LTCVAYPTGDVTIETHKE  143



>emb|CDY54581.1| BnaCnng27360D [Brassica napus]
Length=148

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + A    SLR++ +     L GLKSG    GR+  MA+YKVK +
Sbjct  3    STALSSAIVGTSFIRRQTAPI--SLRSLPSANTQSLFGLKSGTARGGRVIAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETH+E
Sbjct  121  IAEGFVLTCAAYPTSDVTIETHRE  144



>ref|XP_009113156.1| PREDICTED: ferredoxin, leaf L-A [Brassica rapa]
 emb|CDY12877.1| BnaA09g13970D [Brassica napus]
Length=148

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 5/137 (4%)
 Frame = -3

Query  519  MMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTGDFE  349
            ++ TSFL  + +    SLR++       L GLKSG    GR+T MA+YKVK +TP G+ E
Sbjct  10   IVGTSFLRRQTSPI--SLRSLPLANTQTLFGLKSGTARGGRVTAMATYKVKFITPEGEQE  67

Query  348  FDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVL  169
             +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG VDQSD SFLDD+Q+ AG+VL
Sbjct  68   VECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDQSFLDDDQIAAGFVL  127

Query  168  TCVAYPTSNVVIETHKE  118
            TC AYPTS+V IETH+E
Sbjct  128  TCAAYPTSDVTIETHRE  144



>ref|XP_010418043.1| PREDICTED: ferredoxin, leaf L-A [Camelina sativa]
 ref|XP_010473291.1| PREDICTED: ferredoxin, leaf L-A [Camelina sativa]
Length=148

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + + A  SLR++       L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFI--RRSTAPISLRSLPLANTQSLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+   +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKV SG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQVVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M  G+VLTCVAYPTS+V IETHKE
Sbjct  121  MAEGFVLTCVAYPTSDVTIETHKE  144



>emb|CDY44833.1| BnaCnng11890D [Brassica napus]
Length=148

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSFL  + +    SLR++       L GLKSG    GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFLRRQTSPI--SLRSLPLANTQTLFGLKSGTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETH+E
Sbjct  121  IAEGFVLTCAAYPTSDVTIETHRE  144



>gb|AIX10940.1| putative chloroplast ferredoxin [Gardenia jasminoides]
Length=147

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 8/146 (5%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGR----MTCMASYKVK  376
            MATLS G+++STSFL  KP     SLR++ N   A  G+K G        +TC A+YKVK
Sbjct  1    MATLS-GTLVSTSFLPRKPVT---SLRSLPNVNQALFGVKGGAGVGRGGRITCTATYKVK  56

Query  375  LVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDD  196
            ++TP G  E+D  +D Y+LD  E+ G DLPYSCRAGSCSSCAGK+ SGTVDQSD SFLDD
Sbjct  57   VITPDGPLEYDVDEDTYILDHFEKQGHDLPYSCRAGSCSSCAGKLASGTVDQSDQSFLDD  116

Query  195  EQMDAGYVLTCVAYPTSNVVIETHKE  118
            +QMDAG+VLTCVA PTS++VIE+HKE
Sbjct  117  DQMDAGFVLTCVARPTSDIVIESHKE  142



>ref|XP_009420963.1| PREDICTED: ferredoxin-like [Musa acuminata subsp. malaccensis]
Length=151

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = -3

Query  435  LGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscss  256
             G+ +G  GR+  MA+YKVKLV P G+FE DCPDDVY+LD AEE G  LPYSCRAGSCSS
Sbjct  42   FGVDAGR-GRVRAMATYKVKLVLPEGEFELDCPDDVYILDHAEEAGISLPYSCRAGSCSS  100

Query  255  caGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CAGK+V G VDQ+D SFLDD+Q++AGYVLTC AYP S+V+IETHKE
Sbjct  101  CAGKIVKGEVDQADASFLDDDQIEAGYVLTCAAYPRSDVIIETHKE  146



>ref|XP_006392090.1| hypothetical protein EUTSA_v10023742mg [Eutrema salsugineum]
 dbj|BAJ33728.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29376.1| hypothetical protein EUTSA_v10023742mg [Eutrema salsugineum]
Length=148

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 107/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + A    SLR++ +     L GLKS     GR+T MA+YKVK +
Sbjct  3    STALSSAIVGTSFIRRQTAPI--SLRSLPSGNTQSLFGLKSATSRGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVV+G+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVTGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETHKE
Sbjct  121  IGEGFVLTCAAYPTSDVTIETHKE  144



>emb|CDY54579.1| BnaCnng27340D [Brassica napus]
Length=148

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 106/144 (74%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + A    SLR++       L GLKSG    GR+  MA+YKVK +
Sbjct  3    STALSSAIVGTSFIRRQTAPI--SLRSLPLANTQSLFGLKSGTARGGRVIAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AYPTS+V IETH+E
Sbjct  121  IAEGFVLTCAAYPTSDVTIETHRE  144



>gb|ACN40369.1| unknown [Picea sitchensis]
Length=155

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 101/138 (73%), Gaps = 11/138 (8%)
 Frame = -3

Query  501  LSGKPAAAGG---------SLRAI-SNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF  352
            L G   AAGG         SL+A  SN   +  G+K+ +  R+T MA++KVKL+TP G+ 
Sbjct  15   LCGGAKAAGGLRQTAPSMVSLKAFNSNMGQSLFGVKA-SRARVTAMATFKVKLLTPEGEK  73

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
              +CPDDVYVLD AEE G DLPYSCRAGSCSSCAGKVV G VDQSD SFLDD+Q+  GYV
Sbjct  74   LIECPDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVEGEVDQSDGSFLDDDQIGEGYV  133

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYPT++V IETHKE
Sbjct  134  LTCVAYPTADVTIETHKE  151



>sp|P81372.1|FERA_ALOMA RecName: Full=Ferredoxin-A; Short=Fd A [Alocasia macrorrhizos]
Length=97

 Score =   132 bits (333),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV  G VDQSD
Sbjct  1    ATYKVKLVTPQGQQEFDCPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVKQGEVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDDEQM+ G+VLTCVA+PTS+VVIETHKE
Sbjct  61   GSFLDDEQMEQGWVLTCVAFPTSDVVIETHKE  92



>pdb|1PFD|A Chain A, The Solution Structure Of High Plant Parsley [2fe-2s] 
Ferredoxin, Nmr, 18 Structures
 prf||0712213A ferredoxin
Length=96

 Score =   132 bits (332),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+Y VKL+TP G+ EF C DDVYVLDQAEE G D+PYSCRAGSCSSCAGKVVSG++DQSD
Sbjct  1    ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDDEQMDAGYVLTC AYPTS+VVIETHKE
Sbjct  61   QSFLDDEQMDAGYVLTCHAYPTSDVVIETHKE  92



>prf||2210387B ferredoxin:ISOTYPE=II
Length=97

 Score =   132 bits (332),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKL+TP G FEFDCPDDV +LD+AEE G DLPYSCRAG+CSSCAGKV +G+VDQSD
Sbjct  1    ATYKVKLITPEGPFEFDCPDDVSILDRAEETGLDLPYSCRAGACSSCAGKVTAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            NSFLDD+Q+D G+VLTCVAYP SNV IETHKE
Sbjct  61   NSFLDDDQIDEGFVLTCVAYPKSNVTIETHKE  92



>ref|XP_010690121.1| PREDICTED: ferredoxin-1, chloroplastic-like [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score =   134 bits (336),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  456  SNFRPAQLGLKSGNMG-RMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYs  280
            +N   A  GLK+G+ G R+  MA+YKV L+TP+G  EF+CPDDVYVLD AEE G DLPYS
Sbjct  29   TNTGRAVFGLKAGSRGGRVVAMATYKVTLITPSGTQEFECPDDVYVLDAAEEQGLDLPYS  88

Query  279  cragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CRAGSCSSCAGK+ +G++DQSD SFLDD+Q++ G+VLTC AYP+S+V IETHKE
Sbjct  89   CRAGSCSSCAGKLKTGSLDQSDQSFLDDDQIEEGWVLTCAAYPSSDVTIETHKE  142



>gb|KJB47457.1| hypothetical protein B456_008G027600 [Gossypium raimondii]
Length=138

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 106/144 (74%), Gaps = 13/144 (9%)
 Frame = -3

Query  543  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLV  370
            MA++++   +M+S SF+  +P  +  SL           GLK    G +T M +Y VKLV
Sbjct  1    MASITSLSSAMVSPSFIRRQPLTSPRSL----------FGLKPLKGGSLT-MGAYNVKLV  49

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G  EF+CPDDVY+LDQAE+LG DLPYSCRAGSCS+CAG +  G+VDQSD +FLDD+Q
Sbjct  50   TPDGPQEFECPDDVYILDQAEKLGIDLPYSCRAGSCSTCAGVIKQGSVDQSDGNFLDDDQ  109

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            + AG+VLTCVAYPTS+VVIETHKE
Sbjct  110  IAAGFVLTCVAYPTSDVVIETHKE  133



>gb|ABR17063.1| unknown [Picea sitchensis]
Length=155

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 11/138 (8%)
 Frame = -3

Query  501  LSGKPAAAGG---------SLRAI-SNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF  352
            L G   AAGG         SL+A  SN   +  G+K+ +  R+T MA++KVKL+TP G+ 
Sbjct  15   LCGGAKAAGGLRQTAPSMVSLKAFNSNMGQSLFGVKA-SRARVTAMATFKVKLLTPEGEK  73

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
              +CPDDVYVLD AEE G DLPYSCRAGSCSSCAGKV+ G VDQSD SFLDD+Q+  GYV
Sbjct  74   LIECPDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVLEGEVDQSDGSFLDDDQIGEGYV  133

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYPT++V IETHKE
Sbjct  134  LTCVAYPTADVTIETHKE  151



>gb|ABK23878.1| unknown [Picea sitchensis]
Length=155

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 11/138 (8%)
 Frame = -3

Query  501  LSGKPAAAGG---------SLRAI-SNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF  352
            L G   AAGG         SL+A  SN   +  G+K+ +  R+T MA++KVKL+TP G+ 
Sbjct  15   LCGGAKAAGGLRQTAPSMVSLKAFNSNMGQSLFGVKA-SRARVTAMATFKVKLLTPEGEK  73

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
              +CPDDVYVLD AEE G DLPYSCRAGSCSSCAGKV+ G VDQSD SFLDD+Q+  GYV
Sbjct  74   LIECPDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVLEGEVDQSDGSFLDDDQIGEGYV  133

Query  171  LTCVAYPTSNVVIETHKE  118
            LTCVAYPT++V IETHKE
Sbjct  134  LTCVAYPTADVTIETHKE  151



>gb|KJB32457.1| hypothetical protein B456_005G241900 [Gossypium raimondii]
 gb|KJB32458.1| hypothetical protein B456_005G241900 [Gossypium raimondii]
Length=143

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  513  STSFLSGKPAAAGGSLRAISN--FRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDC  340
            +T+ LS     A  + R +S+  F  +  GLKS   GR T MAS+KV L+TP+G  +FDC
Sbjct  5    TTATLSIAVTTAAMTTRTLSSLPFNQSVFGLKSQRKGRFT-MASHKVTLITPSGTKQFDC  63

Query  339  PDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCV  160
             D  Y+LD+AEE+G DLPYSCRAG+CSSCAG +  GTVDQSDNSFLDDE +DAG+VLTCV
Sbjct  64   SDSDYILDRAEEVGMDLPYSCRAGACSSCAGLIKQGTVDQSDNSFLDDELIDAGFVLTCV  123

Query  159  AYPTSNVVIETHKE  118
            A P S+V+IETHKE
Sbjct  124  AIPKSDVIIETHKE  137



>gb|KJB79241.1| hypothetical protein B456_013G039000 [Gossypium raimondii]
Length=164

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGAD  292
            SL ++ NF+ A  GLK    GR+T MA YKV L+TP G  EF+CPDD+ +LD AEE G D
Sbjct  44   SLSSLPNFKQALFGLKPQRGGRLT-MAVYKVTLLTPEGPQEFECPDDLKILDAAEENGID  102

Query  291  LPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            LPYSCRAG+CSSCAG+V  G+VDQS+NSFL DEQM  G+VLTCVA PTS+VVIETH+E
Sbjct  103  LPYSCRAGACSSCAGRVKEGSVDQSENSFLSDEQMGEGFVLTCVALPTSDVVIETHRE  160



>ref|XP_002300585.2| Ferredoxin 2 family protein [Populus trichocarpa]
 gb|EEE85390.2| Ferredoxin 2 family protein [Populus trichocarpa]
Length=148

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 106/150 (71%), Gaps = 16/150 (11%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQ-------LGLKSGNMG-RMTCMAS  388
            MA+ S  +M S SF   KPA        +++ RPA         GLK+G+ G R+  MA+
Sbjct  1    MASTSVAAMASASFTHQKPA--------VTSPRPALPKVGQSLFGLKAGHRGGRVKAMAT  52

Query  387  YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNS  208
            Y VKL+TP G+   +C D+ Y+LD+AEE G DLPYSCRAG+CSSCAGK+V G VDQSD S
Sbjct  53   YSVKLITPDGEKVIECSDETYILDKAEEEGIDLPYSCRAGACSSCAGKIVEGIVDQSDAS  112

Query  207  FLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            FL ++Q++AG+VLTC+AYP S++VIETHKE
Sbjct  113  FLGEDQIEAGWVLTCLAYPRSDLVIETHKE  142



>sp|P83584.1|FER_SOLLS RecName: Full=Ferredoxin [Solanum lasiocarpum]
Length=97

 Score =   130 bits (327),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASYKVKL+TP G  EF+CPDDVY+LD+AEE G DLPYSCRAG+CSSCAGK+V G+VDQSD
Sbjct  1    ASYKVKLITPDGPIEFNCPDDVYILDRAEEEGHDLPYSCRAGACSSCAGKIVDGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            NSFLDD+Q+  G+VLTCVAYP SNV IETHKE
Sbjct  61   NSFLDDDQIGGGFVLTCVAYPKSNVTIETHKE  92



>gb|KJB32456.1| hypothetical protein B456_005G241800 [Gossypium raimondii]
Length=145

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 106/141 (75%), Gaps = 5/141 (4%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT  361
            A+LS  ++ +TSFL G P     +L ++  F  +  GLK    GR+T MA++KV L+TP 
Sbjct  5    ASLST-AVATTSFLRGHPVPK--TLNSLP-FNQSLFGLKPQRNGRLT-MAAFKVTLLTPE  59

Query  360  GDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDA  181
            G  EF CPDDVY++DQAEE G DLP+SCRAGSCSSCAG +  G+VDQSD +FLDD+Q+ A
Sbjct  60   GPQEFVCPDDVYIVDQAEEEGIDLPFSCRAGSCSSCAGMIKQGSVDQSDGNFLDDDQIAA  119

Query  180  GYVLTCVAYPTSNVVIETHKE  118
            G+VLTCVAYP S+VVIETHKE
Sbjct  120  GFVLTCVAYPQSDVVIETHKE  140



>gb|AAB25190.1| ferredoxin A isoprotein, Fd A [Alocasia macrorrhiza=elephant 
ear, Schott, Peptide, 97 aa]
Length=97

 Score =   130 bits (326),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EF CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV  G VDQSD
Sbjct  1    ATYKVKLVTPQGQQEFXCPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVKQGEVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDDEQM+ G+VLTCVA+PTS+VVIETHKE
Sbjct  61   GSFLDDEQMEQGWVLTCVAFPTSDVVIETHKE  92



>sp|P00221.2|FER1_SPIOL RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Ferredoxin 
I; Short=Fd I; Flags: Precursor [Spinacia oleracea]
 gb|AAA34028.1| ferredoxin I precursor [Spinacia oleracea]
 prf||1704156A ferredoxin I
Length=147

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -3

Query  456  SNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYsc  277
            SN   +  GLK+G+ G    MA+YKV LVTPTG+ EF CPDDVY+LD AEE G DLPYSC
Sbjct  30   SNTGRSLFGLKTGSRGGRMTMAAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSC  89

Query  276  ragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            RAGSCSSCAGK+ +G+++Q D SFLDD+Q+D G+VLTC AYP S+V IETHKE
Sbjct  90   RAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKE  142



>ref|NP_001266399.1| adrenodoxin, mitochondrial [Zea mays]
 gb|ACA34367.1| chloroplast ferredoxin 1 precursor [Zea mays]
 gb|ACF85017.1| unknown [Zea mays]
 gb|ACF88347.1| unknown [Zea mays]
 gb|ACG39427.1| ferredoxin-1 [Zea mays]
 gb|AFW74222.1| ferredoxin-1, Precursor [Zea mays]
Length=150

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -3

Query  519  MMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDC  340
              S S L   PA    +L A    +   +G  + + GR+   A+Y VKL+TP G+ E   
Sbjct  14   FFSPSSLRAAPAPTAVALPAA---KVGIMGRSASSRGRLRAQATYNVKLITPEGEVELQV  70

Query  339  PDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCV  160
            PDDVY+LDQAEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD S+LDD Q+ AG+VLTC 
Sbjct  71   PDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIAAGWVLTCH  130

Query  159  AYPTSNVVIETHKE  118
            AYPTS+VVIETHKE
Sbjct  131  AYPTSDVVIETHKE  144



>ref|XP_008648349.1| PREDICTED: ferredoxin-5, chloroplastic [Zea mays]
Length=194

 Score =   132 bits (333),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -3

Query  567  TQESKKKKMATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMAS  388
            T  S +      +A   M+T   S +  A   SLRA        +    G   R+   A+
Sbjct  40   TSTSSRSLQPLPAASKQMATVLSSPRAPAFSFSLRAAPAPTTVAMTRGGGASSRLRAQAT  99

Query  387  YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNS  208
            Y VKL+TP G+ E   PDDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD S
Sbjct  100  YNVKLITPEGEVELQVPDDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQS  159

Query  207  FLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LDD Q+ AG+VLTCVAYPTS+VVIETHKE
Sbjct  160  YLDDGQIAAGWVLTCVAYPTSDVVIETHKE  189



>gb|ACA34366.1| chloroplast ferredoxin 5 precursor [Zea mays]
 gb|ACN27847.1| unknown [Zea mays]
 gb|AFW74224.1| ferredoxin-5, Precursor isoform 1 [Zea mays]
 gb|AFW74225.1| ferredoxin-5, Precursor isoform 2 [Zea mays]
Length=138

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCP  337
            M+T   S +  A   SLRA        +    G   R+   A+Y VKL+TP G+ E   P
Sbjct  1    MATVLSSPRAPAFSFSLRAAPAPTTVAMTRGGGASSRLRAQATYNVKLITPEGEVELQVP  60

Query  336  DDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA  157
            DDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD S+LDD Q+ AG+VLTCVA
Sbjct  61   DDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIAAGWVLTCVA  120

Query  156  YPTSNVVIETHKE  118
            YPTS+VVIETHKE
Sbjct  121  YPTSDVVIETHKE  133



>ref|XP_010458476.1| PREDICTED: ferredoxin-1, chloroplastic-like [Camelina sativa]
Length=145

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTG  358
            +G+++STSFL  +      SLR++       L GLKS     GR+T   +YKVK +TP G
Sbjct  7    SGAIVSTSFLRRQQTPM--SLRSLPAANTQSLFGLKSSTARGGRVT---AYKVKFITPEG  61

Query  357  DFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAG  178
            + E +C  DV+VLD AE+ G DLPYSCRAG+CSSC GKVVSG+VDQS+ SFLDDEQM+ G
Sbjct  62   EKEVECASDVFVLDAAEDAGMDLPYSCRAGACSSCVGKVVSGSVDQSEQSFLDDEQMEMG  121

Query  177  YVLTCVAYPTSNVVIETHKE  118
            YVLTC+A+PTS+VVIETHKE
Sbjct  122  YVLTCMAWPTSDVVIETHKE  141



>ref|NP_172565.1| ferredoxin 1 [Arabidopsis thaliana]
 sp|O04090.1|FER1_ARATH RecName: Full=Ferredoxin-1, chloroplastic; Short=AtFd1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAB65481.1| ferredoxin precusor isolog; 63541-63095 [Arabidopsis thaliana]
 gb|AAM63221.1| ferredoxin precusor isolog [Arabidopsis thaliana]
 gb|AEE28669.1| ferredoxin 1 [Arabidopsis thaliana]
Length=148

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 109/145 (75%), Gaps = 7/145 (5%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQ--LGLKSGNM--GRMTCMASYKVKL  373
            +T  + +++STSFL  +      SLR++  F   Q   GLKS     GR+T MA+YKVK 
Sbjct  3    STALSSAIVSTSFLRRQQTPI--SLRSLP-FANTQSLFGLKSSTARGGRVTAMATYKVKF  59

Query  372  VTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDE  193
            +TP G+ E +C +DVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG++DQSD SFLDDE
Sbjct  60   ITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDE  119

Query  192  QMDAGYVLTCVAYPTSNVVIETHKE  118
            QM  GYVLTCVAYPTS+VVIETHKE
Sbjct  120  QMSEGYVLTCVAYPTSDVVIETHKE  144



>sp|P00228.2|FER_WHEAT RecName: Full=Ferredoxin, chloroplastic; Flags: Precursor [Triticum 
aestivum]
 emb|CAA52980.1| ferredoxin [Triticum aestivum]
Length=143

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  411  GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSG  232
             R+   A+YKVKLVTP G+ E + PDDVY+LDQAEE G DLPYSCRAGSCSSCAGK+VSG
Sbjct  41   ARLRAQATYKVKLVTPEGEVELEVPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKLVSG  100

Query  231  TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +DQSD SFLDD+QM+AG+VLTC AYP S++VIETHKE
Sbjct  101  EIDQSDQSFLDDDQMEAGWVLTCHAYPKSDIVIETHKE  138



>sp|P83526.1|FER_TOBAC RecName: Full=Ferredoxin [Nicotiana tabacum]
Length=97

 Score =   129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASYKVKL+TP G  EFDCPDDVY+LDQAEE+G DLPYSCRAGSCSSCAGKV +G VDQSD
Sbjct  1    ASYKVKLITPEGAVEFDCPDDVYILDQAEEMGHDLPYSCRAGSCSSCAGKVTAGNVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQMADGFVLTCVAYPQSDVTIETHKE  92



>gb|EYU35456.1| hypothetical protein MIMGU_mgv1a025159mg [Erythranthe guttata]
Length=113

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = -3

Query  435  LGLKS-GNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscs  259
             GLKS    G   CMA+Y VKL+TP+G+  F+C DDVY++D+AEE G D+P++CRAGSCS
Sbjct  2    FGLKSPSGGGGAKCMATYSVKLITPSGELRFECDDDVYIVDKAEEEGLDVPFACRAGSCS  61

Query  258  scaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +CAGK+VSG VDQSD SFLDDEQ+DAG+VLTC+AYPTS+V I TH+E
Sbjct  62   ACAGKLVSGGVDQSDGSFLDDEQIDAGWVLTCIAYPTSDVTIVTHRE  108



>ref|XP_011092337.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin-like [Sesamum indicum]
Length=133

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (74%), Gaps = 14/142 (10%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MA+LS+ +M S + L  KP  +   L   + F     GLKS + GR+TCMA+YKV L TP
Sbjct  1    MASLSS-TMFSAAVLPRKPVVSAPGLNQAALF-----GLKSSS-GRLTCMATYKVTLQTP  53

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
            +G+ +F+CPD+ Y+LD+AEELG DLPYSCRAG+CSSCAGKV+SGTVDQSDNSFLDDEQ+D
Sbjct  54   SGEVKFECPDNEYILDRAEELGHDLPYSCRAGACSSCAGKVLSGTVDQSDNSFLDDEQID  113

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            AG        PTS+V + TH+E
Sbjct  114  AG-------XPTSDVTVATHQE  128



>gb|EMT21184.1| Ferredoxin, chloroplastic [Aegilops tauschii]
Length=141

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 100/142 (70%), Gaps = 6/142 (4%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MAT+ +   +  S     P+A   S  A+     A  G+      R+   A+YKVKL+TP
Sbjct  1    MATVLSSLRLPFSVCPAAPSAPMASRVALPPSSTAARGM------RLRAQATYKVKLITP  54

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G+ + + PDDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG +DQSD SFLDD+Q++
Sbjct  55   EGEVDLEVPDDVYILDHAEEEGIDLPYSCRAGSCSSCAGKVVSGQLDQSDQSFLDDDQIE  114

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            AG+VLTC AYPTS++VIETHKE
Sbjct  115  AGWVLTCAAYPTSDLVIETHKE  136



>gb|AAL77198.1| anti-disease protein 1 [Oryza sativa]
Length=138

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGN-MG-RMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELG  298
            SLR  +   PA++ L + N +G R+   A+Y VKL+TP G+ E   PDDVY+LDQAEE G
Sbjct  15   SLRVATAPAPARVVLPASNKLGDRLRMQATYNVKLITPDGEVELQVPDDVYILDQAEEEG  74

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             DLPYSCRAGSCSSCAGKVVSG +DQSD SFLDD+Q+ AG+VLTC AYP S+VVIETHKE
Sbjct  75   IDLPYSCRAGSCSSCAGKVVSGEIDQSDQSFLDDDQVAAGWVLTCHAYPKSDVVIETHKE  134



>gb|KFK43391.1| hypothetical protein AALP_AA1G119900 [Arabis alpina]
Length=148

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 108/144 (75%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++STSFL  +      SLR++S      L GLKS     GR+T MA+YKVK +
Sbjct  3    STALSSAIVSTSFLRRQQTPI--SLRSLSVANTQSLFGLKSSTARGGRVTAMATYKVKFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C +DVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECEEDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            M  GYVLTCVAYPTS+V IETHKE
Sbjct  121  MKEGYVLTCVAYPTSDVTIETHKE  144



>ref|XP_011039858.1| PREDICTED: ferredoxin-like [Populus euphratica]
Length=148

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 4/144 (3%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLR-AISNFRPAQLGLKSGNMG-RMTCMASYKVKLV  370
            MA+ S  +M S SF    PA    SLR A+     +  GLK+G+ G R+  MA+Y VKL+
Sbjct  1    MASTSVVAMASASFTHQNPAVT--SLRPALPKVGQSLFGLKAGHRGGRVKAMATYSVKLI  58

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+   +C D+ Y+LD+AEE G DLPYSCRAG+CSSCAGK+V G VDQSD SFL ++Q
Sbjct  59   TPDGEKVIECSDETYILDKAEEEGVDLPYSCRAGACSSCAGKIVEGIVDQSDASFLGEDQ  118

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            ++AG+VLTC AYP S++VIETHKE
Sbjct  119  IEAGWVLTCHAYPRSDLVIETHKE  142



>sp|P00226.1|FER_SAMNI RecName: Full=Ferredoxin [Sambucus nigra]
 prf||0601253A ferredoxin
Length=97

 Score =   128 bits (321),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASYKVKL+TP G  EF+CPDDVY+L+ AEELG D+PYSCRAGSCSSCAGK+V+G+VDQSD
Sbjct  1    ASYKVKLITPDGPQEFECPDDVYILEHAEELGIDIPYSCRAGSCSSCAGKLVAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDDEQ++ G+VLTCVAYP S+V IETHKE
Sbjct  61   QSFLDDEQIEEGWVLTCVAYPKSDVTIETHKE  92



>ref|NP_001105344.1| ferredoxin-5, chloroplastic precursor [Zea mays]
 sp|P27789.1|FER5_MAIZE RecName: Full=Ferredoxin-5, chloroplastic; AltName: Full=Ferredoxin 
V; Short=Fd V; Flags: Precursor [Zea mays]
 gb|AAA33462.1| ferredoxin [Zea mays]
 prf||1907324A ferredoxin:ISOTYPE=V
Length=135

 Score =   129 bits (324),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQ-LGLKSGNMGRMTCMASYKVKLVTPTGDFEFDC  340
            M+T   S +  A   SLRA     PA  + +  G   R+   A+Y VKL+TP G+ E   
Sbjct  1    MATVLSSPRAPAFSFSLRAA----PATTVAMTRGASSRLRAQATYNVKLITPEGEVELQV  56

Query  339  PDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCV  160
            PDDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG++DQSD SFLDD Q+  G+VLTCV
Sbjct  57   PDDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSLDQSDQSFLDDSQVADGWVLTCV  116

Query  159  AYPTSNVVIETHKE  118
            AYPTS+VVIETHKE
Sbjct  117  AYPTSDVVIETHKE  130



>ref|XP_007148534.1| hypothetical protein PHAVU_006G216700g [Phaseolus vulgaris]
 gb|ESW20528.1| hypothetical protein PHAVU_006G216700g [Phaseolus vulgaris]
Length=199

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 107/148 (72%), Gaps = 8/148 (5%)
 Frame = -3

Query  552  KKKMATLSA---GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYK  382
            +++MA ++    G  ++TSFL     +     +A + F     G+K G  GR+T MA +K
Sbjct  52   RRRMACMTVAMCGPALNTSFLRRHAVSLNAFPKANAVF-----GVKGGGGGRVTAMAKHK  106

Query  381  VKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFL  202
            VKL+TP G+  F C D+ ++LD AEE+G DLPYSCRAG+CSSC GKVV+G VDQS+ S+L
Sbjct  107  VKLITPEGEKTFVCSDETFILDAAEEVGLDLPYSCRAGACSSCLGKVVNGQVDQSEGSYL  166

Query  201  DDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            DD+Q+D GYVLTC+AYPTS+VVI+THKE
Sbjct  167  DDDQIDQGYVLTCIAYPTSDVVIQTHKE  194



>ref|XP_002443703.1| hypothetical protein SORBIDRAFT_07g000600 [Sorghum bicolor]
 gb|EES13198.1| hypothetical protein SORBIDRAFT_07g000600 [Sorghum bicolor]
Length=144

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  426  KSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaG  247
            K     R+   A+Y VKL+TP G+ E   PDDVY+LDQAEE G DLP+SCRAGSCSSCAG
Sbjct  37   KPARGARLRAQATYNVKLITPDGEVELQVPDDVYILDQAEEEGIDLPFSCRAGSCSSCAG  96

Query  246  KVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            KVVSGTVDQSD SFLDD Q++ G+VLTC AYPTS+VVIETHKE
Sbjct  97   KVVSGTVDQSDQSFLDDAQVEGGWVLTCAAYPTSDVVIETHKE  139



>ref|XP_002443705.1| hypothetical protein SORBIDRAFT_07g000620 [Sorghum bicolor]
 gb|EES13200.1| hypothetical protein SORBIDRAFT_07g000620 [Sorghum bicolor]
Length=134

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKS-----GNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAE  307
            SLRA ++  P+ L + +         R+   A+Y VKLVTP G+ E  CPDDVY+LDQA+
Sbjct  7    SLRAPASTFPSSLRVAAVPGMAARGARLRAQATYNVKLVTPEGEVELQCPDDVYILDQAQ  66

Query  306  ELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIET  127
            E G DLPYSCRAGSCSSCAGKVV+G+VDQSD SFLDD+Q+ AG+VLTC AYPTS+VVI T
Sbjct  67   EEGIDLPYSCRAGSCSSCAGKVVAGSVDQSDQSFLDDDQIAAGWVLTCHAYPTSDVVIAT  126

Query  126  HKE  118
            H E
Sbjct  127  HLE  129



>ref|XP_010492189.1| PREDICTED: ferredoxin-1, chloroplastic-like [Camelina sativa]
Length=145

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTG  358
            +G+++STSFL  +      SLR++       L GLKS     GR+T   +YKVK +TP G
Sbjct  7    SGAIVSTSFLRRQQTPI--SLRSLPAANTQSLFGLKSSTARGGRVT---AYKVKFITPEG  61

Query  357  DFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAG  178
            + E +C  D+YVLD AE+ G DLPYSCRAG+CSSC GKVVSG+VDQSD SFLDD+Q++ G
Sbjct  62   EKEVECASDLYVLDAAEDAGMDLPYSCRAGACSSCLGKVVSGSVDQSDQSFLDDDQLEMG  121

Query  177  YVLTCVAYPTSNVVIETHKE  118
            YVLTC+A PTS+VVIETHKE
Sbjct  122  YVLTCIAVPTSDVVIETHKE  141



>gb|ACG47467.1| ferredoxin-1 [Zea mays]
Length=138

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCP  337
            M+T   S +  A   SLRA        +    G   R+   A+Y VKL+TP G+ E   P
Sbjct  1    MATVLSSPRAPAFSFSLRAAPAPTTVAMTRGGGASSRLRAQATYNVKLITPEGEVELQVP  60

Query  336  DDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA  157
            DDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD S+LDD Q+ AG+VLTCVA
Sbjct  61   DDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIAAGWVLTCVA  120

Query  156  YPTSNVVIETHKE  118
            YPTS+VVIET+KE
Sbjct  121  YPTSDVVIETYKE  133



>ref|XP_010907538.1| PREDICTED: ferredoxin-A-like [Elaeis guineensis]
Length=151

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGAD  292
            SL A+     A  GL+SG  GR+T M++Y VKL+TP G+   DCPDD Y+LD AEE G D
Sbjct  31   SLGALPRTGRALFGLESGR-GRVTAMSTYSVKLITPEGEQVLDCPDDAYILDVAEEAGID  89

Query  291  LPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            LPYSCRAGSC SC G + SG VDQSD + LDD+Q++ GYVLTCVAYP S+VVIETHKE
Sbjct  90   LPYSCRAGSCISCVGIIKSGEVDQSDGTMLDDDQLEKGYVLTCVAYPKSDVVIETHKE  147



>sp|P83527.1|FER_CAPAA RecName: Full=Ferredoxin [Capsicum annuum var. annuum]
Length=97

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASYKVKL+TP G  EFDCPDDVY+LDQAEE G DLPYSCRAGSCSSCAGK+  G VDQ+D
Sbjct  1    ASYKVKLITPDGPIEFDCPDDVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+Q++ G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQLEEGWVLTCVAYPQSDVTIETHKE  92



>gb|KCW57094.1| hypothetical protein EUGRSUZ_I02744 [Eucalyptus grandis]
Length=136

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFE  349
            +G+++S+ F+  +P      LRA  N   A  G+ SG  GR+T MA+YKV L+TP G  E
Sbjct  9    SGTVVSSPFVRMQPV---NRLRAFPNVGQALFGVNSGR-GRVTAMAAYKVTLLTPEGKVE  64

Query  348  FDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVL  169
             D PDDVY+LD AEE G DLPYSCRAGSCSSCAGKVV+G+VDQSD SFLDD+Q++ G+VL
Sbjct  65   LDVPDDVYILDYAEEQGIDLPYSCRAGSCSSCAGKVVAGSVDQSDGSFLDDDQIEEGWVL  124

Query  168  TCVAYPTSNV  139
            TCVAYP S +
Sbjct  125  TCVAYPKSEL  134



>ref|NP_001060779.1| Os08g0104600 [Oryza sativa Japonica Group]
 sp|Q0J8M2.1|FER1_ORYSJ RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Anti-disease 
protein 1; AltName: Full=Ferredoxin I; Flags: Precursor 
[Oryza sativa Japonica Group]
 sp|A2YQD9.1|FER1_ORYSI RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Anti-disease 
protein 1; AltName: Full=Ferredoxin I; Flags: Precursor 
[Oryza sativa Indica Group]
 pir||FERZ ferredoxin [2Fe-2S] I precursor - rice [Oryza sativa]
 dbj|BAA06436.1| ferredoxin [Oryza sativa Japonica Group]
 dbj|BAD08924.1| Ferredoxin I, chloroplast precursor [Oryza sativa Japonica Group]
 dbj|BAF22693.1| Os08g0104600 [Oryza sativa Japonica Group]
 gb|EAZ05300.1| hypothetical protein OsI_27505 [Oryza sativa Indica Group]
 gb|EAZ41237.1| hypothetical protein OsJ_25743 [Oryza sativa Japonica Group]
 dbj|BAG99579.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99760.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99993.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 93/121 (77%), Gaps = 3/121 (2%)
 Frame = -3

Query  471  SLRAISNFRPAQLGL--KSGNMG-RMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEEL  301
            SLR  +   PA++ +   S  +G R+   A+Y VKL+TP G+ E   PDDVY+LDQAEE 
Sbjct  15   SLRVATAPAPARVSVLPASNKLGDRLRMQATYNVKLITPDGEVELQVPDDVYILDQAEEE  74

Query  300  GADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHK  121
            G DLPYSCRAGSCSSCAGKVVSG +DQSD SFLDD+Q+ AG+VLTC AYP S+VVIETHK
Sbjct  75   GIDLPYSCRAGSCSSCAGKVVSGEIDQSDQSFLDDDQVAAGWVLTCHAYPKSDVVIETHK  134

Query  120  E  118
            E
Sbjct  135  E  135



>sp|P83525.1|FER_SCOJA RecName: Full=Ferredoxin [Scopolia japonica]
Length=97

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+QM  G+VLTCVAYP S+V+IETHKE
Sbjct  61   GNFLDDDQMADGFVLTCVAYPQSDVIIETHKE  92



>sp|P83582.1|FER_SOLNI RecName: Full=Ferredoxin [Solanum nigrum]
Length=97

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPIEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQMADGFVLTCVAYPKSDVTIETHKE  92



>sp|P83520.1|FER_BRUAR RecName: Full=Ferredoxin [Brugmansia arborea]
 gb|AAB32785.1| [2Fe-2S] ferredoxin [Datura arborea, Peptide, 97 aa]
 prf||2114375A ferredoxin
Length=97

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQMADGFVLTCVAYPQSDVTIETHKE  92



>ref|XP_002889843.1| hypothetical protein ARALYDRAFT_471234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66102.1| hypothetical protein ARALYDRAFT_471234 [Arabidopsis lyrata subsp. 
lyrata]
Length=148

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 111/145 (77%), Gaps = 7/145 (5%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAI--SNFRPAQLGLKSGNM--GRMTCMASYKVKL  373
            +T  + +++STSFL  +      SLR++  +N + +  GLKS     GR+T MA+YKVK 
Sbjct  3    STALSSAIVSTSFLRRQQTPI--SLRSLPLANTQ-SIFGLKSSTARGGRITAMATYKVKF  59

Query  372  VTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDE  193
            +TP G+ E +C +DV+VLD AEE G DLPYSCRAGSCSSCAGKVVSG++DQSD SFLDDE
Sbjct  60   ITPEGEQEVECEEDVFVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDE  119

Query  192  QMDAGYVLTCVAYPTSNVVIETHKE  118
            Q+  GYVLTCVAYPTS+VVIETHKE
Sbjct  120  QISEGYVLTCVAYPTSDVVIETHKE  144



>ref|XP_003573262.1| PREDICTED: ferredoxin-like [Brachypodium distachyon]
Length=140

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 99/142 (70%), Gaps = 7/142 (5%)
 Frame = -3

Query  543  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP  364
            MAT +  S+  + F +  P ++  S R +       L   S    R+   A+YKVKLVTP
Sbjct  1    MATTALSSL--SLFTAAPPPSSAVSSRVV-----LPLTAPSARGMRLRAQATYKVKLVTP  53

Query  363  TGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMD  184
             G+ + + PDDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG VDQSD SFLDD+Q+ 
Sbjct  54   EGEVDLEVPDDVYILDHAEEEGIDLPYSCRAGSCSSCAGKVVSGEVDQSDQSFLDDDQVA  113

Query  183  AGYVLTCVAYPTSNVVIETHKE  118
            AG+VLTC AYP S++VIETHKE
Sbjct  114  AGWVLTCAAYPQSDLVIETHKE  135



>ref|XP_004972427.1| PREDICTED: ferredoxin-1, chloroplastic-like [Setaria italica]
Length=137

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  426  KSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaG  247
            K     R+   A+Y VKL+TP G+ E   PDDVY+LDQAEE G DLPYSCRAGSCSSCAG
Sbjct  31   KVARGARLRAQATYNVKLITPDGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAG  90

Query  246  KVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            KVVSG+VDQSD SFLDD Q+ AG+VLTC AYPTS+VVIETHKE
Sbjct  91   KVVSGSVDQSDQSFLDDGQVAAGWVLTCHAYPTSDVVIETHKE  133



>sp|P83583.1|FER_SOLLY RecName: Full=Ferredoxin [Solanum lyratum]
Length=97

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKL+TP G  EF+CPDDVY+LD AEE G DLPYSCRAG+CSSCAGK+ +G VDQSD
Sbjct  1    ATYKVKLITPEGPVEFNCPDDVYILDSAEENGHDLPYSCRAGACSSCAGKITAGNVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            NSFLDD+Q+  G+VLTCVAYP SNV IETHKE
Sbjct  61   NSFLDDDQVAEGFVLTCVAYPKSNVTIETHKE  92



>sp|P85121.1|FER_PANGI RecName: Full=Ferredoxin [Panax ginseng]
Length=96

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -3

Query  387  YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNS  208
            YKVKL+TP G+ EF+CPDDVY+LD AEE+G DLPYSCRAGSCSSCAGKVVSG VD SDNS
Sbjct  4    YKVKLLTPEGEKEFECPDDVYILDNAEEIGIDLPYSCRAGSCSSCAGKVVSGKVDNSDNS  63

Query  207  FLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            FL+D+ MDAGYVLTC AY  S+VVIETHKE
Sbjct  64   FLNDDNMDAGYVLTCHAYANSDVVIETHKE  93



>sp|P81373.1|FERB_ALOMA RecName: Full=Ferredoxin-B; Short=Fd B [Alocasia macrorrhizos]
 gb|AAB25191.1| ferredoxin B isoprotein, Fd B [Alocasia macrorrhiza=elephant 
ear, Schott, Peptide, 98 aa]
Length=98

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = -3

Query  393  ASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            A+YKVKLVTP+G   EF+CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV +G VDQS
Sbjct  1    ATYKVKLVTPSGQPLEFECPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVKNGNVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q+  G+VLTCVAYPTS+VVIETHKE
Sbjct  61   DGSFLDDDQIGEGWVLTCVAYPTSDVVIETHKE  93



>ref|XP_010475984.1| PREDICTED: ferredoxin-1, chloroplastic-like [Camelina sativa]
Length=145

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTG  358
            +G+++STSFL  +      SLR++       L GLKS     GR+T   +YKVK +TP G
Sbjct  7    SGAIVSTSFLRRQQTPI--SLRSLPAANTQSLFGLKSSTARGGRVT---AYKVKFITPEG  61

Query  357  DFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAG  178
            + E +C  D+YVLD AE+ G DLPYSCRAG+CSSC GKVVSG+VDQSD SFLDDEQ+  G
Sbjct  62   EKEVECASDLYVLDAAEDAGMDLPYSCRAGACSSCLGKVVSGSVDQSDQSFLDDEQLAMG  121

Query  177  YVLTCVAYPTSNVVIETHKE  118
            YVLTC+A P S+VVIETHKE
Sbjct  122  YVLTCIAVPASDVVIETHKE  141



>emb|CDY33318.1| BnaAnng04290D [Brassica napus]
Length=148

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 102/144 (71%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + A    SLR++       L GLKSG    GR+  MA+YKV+ +
Sbjct  3    STALSSAIVGTSFIRRQTAPI--SLRSLPLANTQSLFGLKSGTTHGGRVIAMATYKVQFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSC AGSCSSCAGK VSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCHAGSCSSCAGKFVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+ LTC AYPT +V IETH+E
Sbjct  121  IAEGFFLTCAAYPTFDVTIETHRE  144



>sp|P84872.1|FER_ATRBE RecName: Full=Ferredoxin [Atropa belladonna]
Length=97

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQMADGFVLTCVAYPQSDVTIETHKE  92



>sp|P68163.1|FER_DATIN RecName: Full=Ferredoxin [Datura inoxia]
 sp|P68164.1|FER_DATME RecName: Full=Ferredoxin [Datura metel]
 gb|AAB35514.1| [2Fe-2S] ferredoxin [Datura quercifolia, leaves, Peptide, 97 
aa]
 prf||2009395A ferredoxin
Length=97

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LD+AEE G DLPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFDCPDDVYILDRAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             ++LDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNYLDDDQMAEGFVLTCVAYPQSDVTIETHKE  92



>sp|P83522.1|FER_HORVU RecName: Full=Ferredoxin [Hordeum vulgare]
Length=97

 Score =   125 bits (313),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G+ E + PDDVY+LDQAEE G DLPYSCRAGSCSSCAGK+VSG +DQSD
Sbjct  1    ATYKVKLVTPEGEVELEVPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKLVSGEIDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+QM+ G+VLTC AYP S+VVIETHKE
Sbjct  61   QSFLDDDQMEEGWVLTCAAYPKSDVVIETHKE  92



>ref|XP_004159876.1| PREDICTED: ferredoxin-1, chloroplastic-like [Cucumis sativus]
Length=147

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLVTPTGDFEFD  343
            ++TSFL  +P      +R + NF      LK G+   GR+  MA Y VKL+TPTG+ EF 
Sbjct  12   LNTSFLQKQPTT---RIRLVLNFGQDLFKLKGGSSRGGRVIAMAEYNVKLITPTGETEFK  68

Query  342  CPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTC  163
            CPDD Y+LD+AE++G DLPYSCRAGSCSSCAGKVVSG VDQSD S+L+D+QMD G+   C
Sbjct  69   CPDDEYILDRAEQMGFDLPYSCRAGSCSSCAGKVVSGKVDQSDGSYLEDDQMDEGWFNLC  128

Query  162  VAYPTSNVVIETHKE  118
               P S+VVIETHKE
Sbjct  129  -CLPQSDVVIETHKE  142



>ref|XP_003573263.1| PREDICTED: ferredoxin [Brachypodium distachyon]
Length=144

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 3/112 (3%)
 Frame = -3

Query  444  PAQLGLK---SGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscr  274
            P+++ L    S    R+   A+YKVKLVTP G+ E + PDDVY+LD  EE G DLPYSCR
Sbjct  28   PSRVALPLTPSARAIRLRAQATYKVKLVTPEGEVEMEVPDDVYILDHFEEEGIDLPYSCR  87

Query  273  agscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            AGSCSSCAGKV+SG VDQSD SFLDD+QM+AG+VLTC AYP S++VIETHKE
Sbjct  88   AGSCSSCAGKVISGEVDQSDQSFLDDDQMEAGWVLTCHAYPKSDLVIETHKE  139



>ref|XP_004506180.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform X1 [Cicer 
arietinum]
 ref|XP_004506181.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform X2 [Cicer 
arietinum]
Length=155

 Score =   127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS ++IS      LGLKS +  R T  A+YKVKL+ P G + EFD PDDVY+LD AE  G
Sbjct  36   GSAKSIS----FSLGLKSSSSFRTTAKAAYKVKLIGPDGKENEFDAPDDVYILDAAENAG  91

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+VSG VDQSD SFLDD Q+  G+VLTCV+YPT++ VIETHKE
Sbjct  92   VELPYSCRAGACSTCAGKIVSGAVDQSDGSFLDDNQLKEGFVLTCVSYPTADCVIETHKE  151



>sp|P84874.1|FER2_HYONI RecName: Full=Ferredoxin-2; AltName: Full=Minor ferredoxin [Hyoscyamus 
niger]
Length=97

 Score =   125 bits (313),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVKAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQMADGFVLTCVAYPQSDVTIETHKE  92



>ref|XP_003606105.1| Ferredoxin-6 [Medicago truncatula]
Length=142

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = -3

Query  432  GLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYscragscss  256
            GLKS +  R T MA+YKVKL+ P G + EFD PDDVY+LD AE+ G +LPYSCRAG+CS+
Sbjct  33   GLKSSSSYRTTAMAAYKVKLIGPDGKENEFDAPDDVYILDAAEDAGVELPYSCRAGACST  92

Query  255  caGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CAGK+VSG+VDQSD SFLDD Q+  G+VLTCV+YPT++ +IETHKE
Sbjct  93   CAGKIVSGSVDQSDGSFLDDNQLKDGFVLTCVSYPTADCIIETHKE  138



>ref|XP_003629832.1| Ferredoxin-6 [Medicago truncatula]
 gb|AFK41324.1| unknown [Medicago truncatula]
 gb|AES88302.2| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
Length=155

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = -3

Query  432  GLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYscragscss  256
            GLKS +  R T MA+YKVKL+ P G + EFD PDDVY+LD AE+ G +LPYSCRAG+CS+
Sbjct  46   GLKSSSSYRTTAMAAYKVKLIGPDGKENEFDAPDDVYILDAAEDAGVELPYSCRAGACST  105

Query  255  caGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CAGK+VSG+VDQSD SFLDD Q+  G+VLTCV+YPT++ +IETHKE
Sbjct  106  CAGKIVSGSVDQSDGSFLDDNQLKDGFVLTCVSYPTADCIIETHKE  151



>sp|P68165.1|FER_DATST RecName: Full=Ferredoxin [Datura stramonium]
 sp|P68166.1|FER_DATQU RecName: Full=Ferredoxin [Datura quercifolia]
 gb|AAB27597.1| [2Fe-2S] ferredoxin, [2Fe-2S] Fd [Datura stramonium, var. stramonium 
and var. tatula, Peptide, 97 aa]
 gb|AAB35515.1| [2Fe-2S] ferredoxin [Datura fastuosa, leaves, Peptide, 97 aa]
 prf||2009392A ferredoxin
Length=97

 Score =   124 bits (312),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EF+CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFNCPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             ++LDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNYLDDDQMADGFVLTCVAYPQSDVTIETHKE  92



>emb|CAN74125.1| hypothetical protein VITISV_038770 [Vitis vinifera]
Length=151

 Score =   126 bits (316),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS+++IS       GLKS    R T MA YK+KL+ P G+  EFD PDD Y+LD AE  G
Sbjct  32   GSVKSISK----AFGLKSSPCFRATAMAVYKIKLIGPEGEEHEFDAPDDAYILDSAENAG  87

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++VSG+VDQSD SFLDD+QM+ GY+LTC++YPTS+ VI THKE
Sbjct  88   VELPYSCRAGACSTCAGQMVSGSVDQSDGSFLDDKQMEKGYLLTCISYPTSDCVIHTHKE  147



>ref|XP_010688241.1| PREDICTED: ferredoxin-2-like [Beta vulgaris subsp. vulgaris]
Length=145

 Score =   125 bits (315),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = -3

Query  456  SNFRPAQLGLKSGNMG-RMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYs  280
            +N   A  GLK+G  G R+T MA+YKV L+TP G  + +CPD+ Y+LD AEE G DLPYS
Sbjct  27   TNVGQAVFGLKAGARGGRITAMATYKVTLITPEGTKKINCPDNEYILDAAEEQGLDLPYS  86

Query  279  cragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CRAG+CSSCAGKV SG+VDQSD ++LDD+Q+  G+VLTC+A PTS+V IETHKE
Sbjct  87   CRAGACSSCAGKVTSGSVDQSDQNYLDDDQVSEGWVLTCIATPTSDVTIETHKE  140



>ref|XP_004972426.1| PREDICTED: ferredoxin-5, chloroplastic-like [Setaria italica]
Length=139

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -3

Query  435  LGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscss  256
            L  K+    R+   A+Y VKL+TP G+ E   PDDVY+LD AEE G +LPYSCRAGSCSS
Sbjct  29   LPAKAPRGARLRAQATYNVKLITPDGEVELQVPDDVYILDHAEEEGIELPYSCRAGSCSS  88

Query  255  caGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CAGK+VSG++DQSD SFLDD+Q+ AG+VLTC AYPTS+VVIETHKE
Sbjct  89   CAGKLVSGSIDQSDQSFLDDDQVAAGWVLTCAAYPTSDVVIETHKE  134



>sp|P83523.1|FER_LYCCN RecName: Full=Ferredoxin [Lycium chinense]
Length=97

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+Q+  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQIADGFVLTCVAYPQSDVTIETHKE  92



>sp|P00222.1|FER_COLES RecName: Full=Ferredoxin [Colocasia esculenta]
Length=97

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP+G  EF CPDDVY+LDQAEE+G DLPYSCRAGSCSSCAGKV  G VDQSD
Sbjct  1    ATYKVKLVTPSGQQEFQCPDDVYILDQAEEVGIDLPYSCRAGSCSSCAGKVKVGDVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDDEQ+  G+VLTCVAYP S+  IETHKE
Sbjct  61   GSFLDDEQIGEGWVLTCVAYPVSDGTIETHKE  92



>gb|AAY85661.1| heterotrophic ferredoxin 2 [Helianthus annuus]
Length=157

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  435  LGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscss  256
             GLKSG+  R T MA+Y+VKLVTP G+ EFD PDD Y+LD AE  G +LPYSCRAG+CS+
Sbjct  48   FGLKSGSSFRTTAMATYRVKLVTPDGEHEFDAPDDCYILDSAEAAGIELPYSCRAGACST  107

Query  255  caGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            CAGK+ +G VDQSD SFLDD QM  GY+LTC++YPT + V+ TH+E
Sbjct  108  CAGKLHTGAVDQSDGSFLDDNQMKEGYLLTCISYPTGDCVVHTHEE  153



>ref|XP_006659025.1| PREDICTED: ferredoxin-1, chloroplastic-like [Oryza brachyantha]
Length=140

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -3

Query  408  RMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGT  229
            R+   A++ VKL+TP G+ E   PDDVY+LDQAEE G DLPYSCRAGSCSSCAGKVVSG 
Sbjct  40   RLRVQATFNVKLITPDGEVELQVPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVVSGE  99

Query  228  VDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +DQSD SFLDD+QM AG+VLTC AYP S+VVIETHKE
Sbjct  100  IDQSDQSFLDDDQMAAGWVLTCHAYPKSDVVIETHKE  136



>gb|EYU26711.1| hypothetical protein MIMGU_mgv1a015613mg [Erythranthe guttata]
Length=151

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 7/132 (5%)
 Frame = -3

Query  510  TSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPD  334
            TSFL  K  ++ GSL++ +      LGLKS    R   MA YKVKLV P G + EFD PD
Sbjct  22   TSFL--KSPSSLGSLKSATK----ALGLKSKPDFRACAMACYKVKLVGPDGTETEFDAPD  75

Query  333  DVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY  154
            D Y+LD AEE G +LPYSCRAG+CS+CAGK+++G VDQSD SFLDD QM  GY+LTCV+Y
Sbjct  76   DAYILDSAEEAGLELPYSCRAGACSTCAGKIITGEVDQSDGSFLDDNQMKEGYLLTCVSY  135

Query  153  PTSNVVIETHKE  118
            PTS+ VI THKE
Sbjct  136  PTSDCVIHTHKE  147



>ref|XP_011088892.1| PREDICTED: ferredoxin, root R-B1-like [Sesamum indicum]
Length=151

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS+R+I+       GLK+    R +CMA YKVKL+ P G + EF+ PDD Y+LD AE  G
Sbjct  32   GSVRSITR----TFGLKAKPDFRASCMAVYKVKLIGPDGAECEFEAPDDCYILDSAENAG  87

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+V+GTVDQSD SFLDD QM  GY+LTCV+YPTS+ VI THKE
Sbjct  88   VELPYSCRAGACSTCAGKMVTGTVDQSDGSFLDDNQMKDGYLLTCVSYPTSDCVIHTHKE  147



>ref|XP_004140901.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 1 [Cucumis 
sativus]
 ref|XP_004140902.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159464.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159465.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform 2 [Cucumis 
sativus]
 gb|KGN46037.1| hypothetical protein Csa_6G045160 [Cucumis sativus]
 gb|KGN51038.1| hypothetical protein Csa_5G413260 [Cucumis sativus]
Length=149

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 6/119 (5%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGA  295
            S R++S       GLKS    +++ MASYKVKL+ P G+  EFD PDD Y+LD AE  G 
Sbjct  32   SFRSVSR----SFGLKSSQF-KVSAMASYKVKLIGPDGEENEFDAPDDAYILDSAENAGL  86

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            DLPYSCRAG+CS+CAG+VVSGTVDQ+D SFLDD+QM+ GYVLTCVAYP S+ VI THKE
Sbjct  87   DLPYSCRAGACSTCAGQVVSGTVDQTDGSFLDDKQMEKGYVLTCVAYPQSDCVIHTHKE  145



>sp|P00225.1|FER_LEULE RecName: Full=Ferredoxin [Leucaena leucocephala]
Length=96

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  390  SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDN  211
            ++KVKL+TP G  EF+CPDDVY+LDQAEELG +LPYSCRAGSCSSCAGK+V G +DQSD 
Sbjct  1    AFKVKLLTPDGPKEFECPDDVYILDQAEELGIELPYSCRAGSCSSCAGKLVEGDLDQSDQ  60

Query  210  SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            SFLDDEQ++ G+VLTC AYP S+VVIETHKE
Sbjct  61   SFLDDEQIEEGWVLTCAAYPRSDVVIETHKE  91



>prf||2210387A ferredoxin:ISOTYPE=I
 prf||2210387C ferredoxin:ISOTYPE=A
Length=97

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASYKVKL+TP G  EF+CPDDVY+LDQAEE G DLPYSCRAGSCSSCAGKV +G+VDQSD
Sbjct  1    ASYKVKLITPEGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLD++Q  AG+VLTCVAYP  +V IETHKE
Sbjct  61   GNFLDEDQEAAGFVLTCVAYPKGDVTIETHKE  92



>ref|XP_006855030.1| hypothetical protein AMTR_s00031p00053820 [Amborella trichopoda]
 gb|ERN16497.1| hypothetical protein AMTR_s00031p00053820 [Amborella trichopoda]
Length=152

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = -3

Query  522  SMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEF  346
            S  +TS L  K  ++ G++R IS       GLK  ++ R+  MA+YKVKL+ P G + +F
Sbjct  17   SSRNTSGLHIKAPSSLGTIRNISR----AFGLKKSSVFRVQAMATYKVKLIGPDGVEHDF  72

Query  345  DCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLT  166
            + PDD Y+LD AE  G +LPYSCRAG+CS+CAGK+V GTVDQSD SFLDDEQ+  GYVLT
Sbjct  73   EAPDDSYILDSAEVAGVELPYSCRAGACSTCAGKIVEGTVDQSDGSFLDDEQLGKGYVLT  132

Query  165  CVAYPTSNVVIETHKE  118
            CV+YP S+ VI+THKE
Sbjct  133  CVSYPISDCVIDTHKE  148



>ref|XP_008456052.1| PREDICTED: ferredoxin-like [Cucumis melo]
Length=146

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = -3

Query  513  STSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPD  334
            +TSFL   P   G SL+   N   +  GLK    GR+T MA Y VKL+TP G+    CPD
Sbjct  13   ATSFLRRNPTG-GVSLKPFPNMGESLFGLKH-RGGRVTAMA-YNVKLITPEGEKSITCPD  69

Query  333  DVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY  154
            D Y+LD AEE G DLPYSCRAG+CSSC GKVVSG +DQSD SFLDD+Q+  G+VLTCVA 
Sbjct  70   DAYILDAAEENGIDLPYSCRAGACSSCIGKVVSGKLDQSDQSFLDDDQVAEGWVLTCVAR  129

Query  153  PTSNVVIETHKE  118
              S+VVIETHKE
Sbjct  130  AESDVVIETHKE  141



>ref|XP_006305843.1| hypothetical protein CARUB_v10010893mg [Capsella rubella]
 gb|EOA38741.1| hypothetical protein CARUB_v10010893mg [Capsella rubella]
Length=145

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTG  358
            + +++STSFL  +      SLR++       L GLKS     GR+T   +YKV  +TP G
Sbjct  7    SSAIVSTSFLRRRNTPI--SLRSLPAANTQSLFGLKSSTARGGRVT---AYKVTFITPEG  61

Query  357  DFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAG  178
            +   DCP D Y+LD AEE G DLPYSCRAG+CSSCAGKVVSG++DQS+ SFLDD+QM  G
Sbjct  62   EKVVDCPSDTYLLDAAEEAGMDLPYSCRAGACSSCAGKVVSGSIDQSEQSFLDDDQMSDG  121

Query  177  YVLTCVAYPTSNVVIETHKE  118
            YVLTC+A+PTS+VV+ETHKE
Sbjct  122  YVLTCLAWPTSDVVVETHKE  141



>ref|XP_010651884.1| PREDICTED: ferredoxin-3, chloroplastic [Vitis vinifera]
Length=196

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS+++IS       GLKS    R T MA YK+KL+ P G+  EFD PDD Y+LD AE  G
Sbjct  77   GSVKSISK----AFGLKSSPCFRATAMAVYKIKLIGPEGEEHEFDAPDDAYILDSAENAG  132

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++VSG+VDQSD SFLDD+QM+ GY+LTC++YPTS+ VI THKE
Sbjct  133  VELPYSCRAGACSTCAGQMVSGSVDQSDGSFLDDKQMEKGYLLTCISYPTSDCVIHTHKE  192



>ref|NP_001238738.1| uncharacterized protein LOC100499711 [Glycine max]
 ref|XP_006591835.1| PREDICTED: uncharacterized protein LOC100499711 isoform X1 [Glycine 
max]
 gb|ACU13346.1| unknown [Glycine max]
Length=151

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGA  295
            SLR++ +   +  GLKS +  R+T MASYKVKL+ P G + EF+  DD Y+LD AE  G 
Sbjct  30   SLRSVKSVSRS-FGLKSASSFRVTAMASYKVKLIGPDGTENEFEATDDTYILDAAESAGV  88

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSCRAG+CS+CAGK+VSG+VDQSD SFLDD Q+  G+VLTCV+YPT++ VIETHKE
Sbjct  89   ELPYSCRAGACSTCAGKIVSGSVDQSDGSFLDDNQLKEGFVLTCVSYPTADCVIETHKE  147



>ref|XP_001692808.1| apoferredoxin [Chlamydomonas reinhardtii]
 sp|P07839.2|FER_CHLRE RecName: Full=Ferredoxin, chloroplastic; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA33085.1| ferredoxin [Chlamydomonas reinhardtii]
 gb|AAC49171.1| ferredoxin precursor [Chlamydomonas reinhardtii]
 gb|ABA01123.1| chloroplast ferredoxin [Chlamydomonas incerta]
 gb|EDP03827.1| apoferredoxin [Chlamydomonas reinhardtii]
Length=126

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 88/123 (72%), Gaps = 10/123 (8%)
 Frame = -3

Query  486  AAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAE  307
            AA  G+  A+   RPA          RM+CMA YKV L TP+GD   +CP D Y+LD AE
Sbjct  10   AARVGAKPAVRGARPAS---------RMSCMA-YKVTLKTPSGDKTIECPADTYILDAAE  59

Query  306  ELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIET  127
            E G DLPYSCRAG+CSSCAGKV +GTVDQSD SFLDD QM  G+VLTCVAYPTS+  I+T
Sbjct  60   EAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQT  119

Query  126  HKE  118
            H+E
Sbjct  120  HQE  122



>ref|NP_001241349.1| uncharacterized protein LOC100785611 [Glycine max]
 gb|ACU24637.1| unknown [Glycine max]
 gb|KHN38632.1| Ferredoxin-3, chloroplastic [Glycine soja]
Length=155

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS+++IS       GLKS +  R+T MASYKVKL+ P G + EF+  DD Y+LD AE  G
Sbjct  36   GSVKSISR----SFGLKSSSSFRVTAMASYKVKLIGPDGTENEFEATDDTYILDAAESAG  91

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+V+G+VDQSD SFLDD Q+  G+VLTCV+YPT++ VIETHKE
Sbjct  92   VELPYSCRAGACSTCAGKIVAGSVDQSDGSFLDDNQLKEGFVLTCVSYPTADCVIETHKE  151



>ref|XP_008456600.1| PREDICTED: ferredoxin, root R-B2-like [Cucumis melo]
Length=149

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 6/119 (5%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGA  295
            S R++S       GLKS +  +++ MASYKVKL+ P G+  EF+ PDD Y+LD AE  G 
Sbjct  32   SFRSVSQ----SFGLKS-SQSKVSAMASYKVKLIGPNGEENEFEAPDDAYILDSAENAGL  86

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            DLPYSCRAG+CS+CAG+VVSGTVDQ+D SFLDD+QM+ GYVLTCVAYP S+ VI THKE
Sbjct  87   DLPYSCRAGACSTCAGQVVSGTVDQTDGSFLDDKQMEQGYVLTCVAYPQSDCVIHTHKE  145



>gb|KHN21149.1| Ferredoxin-3, chloroplastic [Glycine soja]
Length=155

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGA  295
            SLR++ +   +  GLKS +  R+T MASYKVKL+ P G + EF+  DD Y+LD AE  G 
Sbjct  34   SLRSVKSVSRS-FGLKSASSFRVTAMASYKVKLIGPDGTENEFEATDDTYILDAAESAGV  92

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSCRAG+CS+CAGK+VSG+VDQSD SFLDD Q+  G+VLTCV+YPT++ VIETHKE
Sbjct  93   ELPYSCRAGACSTCAGKIVSGSVDQSDGSFLDDNQLKEGFVLTCVSYPTADCVIETHKE  151



>gb|EYU32959.1| hypothetical protein MIMGU_mgv1a015634mg [Erythranthe guttata]
 gb|EYU32960.1| hypothetical protein MIMGU_mgv1a015634mg [Erythranthe guttata]
Length=151

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 96/132 (73%), Gaps = 7/132 (5%)
 Frame = -3

Query  510  TSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPD  334
            T+FL  K  ++ GSL++ +      LGLKS    R   MA YKVKLV P G + EFD PD
Sbjct  22   TNFL--KSPSSLGSLKSATK----ALGLKSKPDFRACAMACYKVKLVGPDGTETEFDAPD  75

Query  333  DVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY  154
            D Y+LD AEE G +LPYSCRAG+CS+CAGK+++G VDQSD SFLDD QM  GY+LTCV+Y
Sbjct  76   DAYILDSAEEAGLELPYSCRAGACSTCAGKIITGEVDQSDGSFLDDNQMKEGYLLTCVSY  135

Query  153  PTSNVVIETHKE  118
            PTS+ VI THKE
Sbjct  136  PTSDCVIHTHKE  147



>emb|CDX97925.1| BnaA06g06760D [Brassica napus]
Length=148

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTGDFEF  346
            +ST FL  +      SLR++       L GLKS     GR+T MA+YKVK +TP G+ E 
Sbjct  11   VSTPFL--RRQQTPNSLRSLPAANTQSLFGLKSSTSRGGRVTAMATYKVKFITPDGEKEV  68

Query  345  DCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLT  166
            +C  D YVLD AEE G DLPYSCRAG+CSSCAGK+VSG+VDQSD SFLDD Q+  G+VLT
Sbjct  69   ECDGDTYVLDAAEESGLDLPYSCRAGACSSCAGKIVSGSVDQSDQSFLDDGQISEGFVLT  128

Query  165  CVAYPTSNVVIETHKE  118
            C+A PTS+VVI TH+E
Sbjct  129  CIALPTSDVVIRTHQE  144



>gb|AFK36593.1| unknown [Lotus japonicus]
Length=152

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = -3

Query  531  SAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-D  355
            +A   +ST   + K   + GS++++S       GLKS    R+T MA+YK+KLV P G +
Sbjct  14   TANRNLSTVATAVKCPISFGSVKSVSR----SFGLKSSTPSRVTAMAAYKIKLVGPDGKE  69

Query  354  FEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGY  175
             EF+  DDVY+LD AE  G +LPYSCRAG+CS+CAGK+V+G+VDQSD SFLDD Q+  G+
Sbjct  70   NEFEAEDDVYILDAAENAGVELPYSCRAGACSTCAGKIVTGSVDQSDGSFLDDNQLKDGF  129

Query  174  VLTCVAYPTSNVVIETHKE  118
            VLTCV+YPT++ VIETHKE
Sbjct  130  VLTCVSYPTADCVIETHKE  148



>gb|ACG44867.1| ferredoxin-1 [Zea mays]
Length=208

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = -3

Query  516  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCP  337
            M+T   S +  A   SLRA        +    G   R+   A+Y VKL+TP G+ E   P
Sbjct  1    MATVLSSPRAPAFSFSLRAAPAPTTVAMTRGGGASSRLRAQATYNVKLITPEGEVELQVP  60

Query  336  DDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA  157
            DDVY+LD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD S+LDD Q+ AG+VLTCVA
Sbjct  61   DDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIAAGWVLTCVA  120

Query  156  YPTSNVVIETHKE  118
            YPTS+VVIET +E
Sbjct  121  YPTSDVVIETLEE  133



>prf||1802399A ferredoxin
Length=97

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+ KVKLVTP G+ E + PDDVY+LDQAEE G DLPYSCRAGSCSSCAGK+VSG +DQSD
Sbjct  1    ATKKVKLVTPEGEVELEVPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKLVSGEIDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+QM+ G+VLTC AYP S+VVIETHKE
Sbjct  61   QSFLDDDQMEEGWVLTCAAYPKSDVVIETHKE  92



>ref|WP_023173697.1| ferredoxin [Gloeobacter kilaueensis]
 gb|AGY58536.1| ferredoxin [Gloeobacter kilaueensis JS1]
Length=97

 Score =   122 bits (305),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+YK+ LVTP+G  E DCP D Y+LD AE  G DLP+SCRAG+CS+CAGK+VSGTVDQS
Sbjct  1    MATYKITLVTPSGKKEIDCPGDEYILDAAERQGLDLPFSCRAGACSTCAGKMVSGTVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q+ AGYVLTCVAYPTSN  IETHKE
Sbjct  61   DQSFLDDDQIAAGYVLTCVAYPTSNSTIETHKE  93



>sp|P84873.1|FER1_HYONI RecName: Full=Ferredoxin-1; AltName: Full=Major ferredoxin [Hyoscyamus 
niger]
Length=97

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EF+CPDDVY+LDQAEE G +LPYSCRAGSCSSCAGKV +GTVDQSD
Sbjct  1    ATYKVKLVTPDGPVEFNCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+Q+  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQIADGFVLTCVAYPQSDVTIETHKE  92



>ref|XP_007132438.1| hypothetical protein PHAVU_011G094400g [Phaseolus vulgaris]
 gb|ESW04432.1| hypothetical protein PHAVU_011G094400g [Phaseolus vulgaris]
Length=155

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS++++S       GLKS +  R+T MASYKVKL+ P G + EF+  DD Y+LD AE+ G
Sbjct  36   GSVKSVSR----SFGLKSSSSFRVTAMASYKVKLIGPDGKENEFEASDDTYILDAAEDAG  91

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+V+G+VDQSD SFLDD Q+  G+VLTC++YPT++ VIETHKE
Sbjct  92   VELPYSCRAGACSTCAGKIVAGSVDQSDGSFLDDNQLKEGFVLTCISYPTADCVIETHKE  151



>ref|XP_003596823.1| Ferredoxin [Medicago truncatula]
 gb|AES67074.1| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
 gb|AFK38836.1| unknown [Medicago truncatula]
 gb|AFK45239.1| unknown [Medicago truncatula]
Length=155

 Score =   123 bits (309),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS + +S       GLKS    R+T +A+YKVKL+ P G + EF+  DD Y+LD AE  G
Sbjct  36   GSAKNVSR----SFGLKSSASSRVTAVAAYKVKLIGPDGKENEFEATDDTYILDAAENAG  91

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGKVVSG+VDQSD SFLDD Q++ GYVLTCVAYPTS+ VI THKE
Sbjct  92   VELPYSCRAGACSTCAGKVVSGSVDQSDGSFLDDNQLNEGYVLTCVAYPTSDCVIHTHKE  151



>ref|XP_002443704.1| hypothetical protein SORBIDRAFT_07g000610 [Sorghum bicolor]
 gb|EES13199.1| hypothetical protein SORBIDRAFT_07g000610 [Sorghum bicolor]
Length=143

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -3

Query  411  GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSG  232
             R+   A+Y VKLVTP G+ E   PDDVY+LDQAEE G +LPYSCRAGSCSSCAGKVV+G
Sbjct  39   ARLRAQATYTVKLVTPEGEVELKVPDDVYILDQAEEEGIELPYSCRAGSCSSCAGKVVAG  98

Query  231  TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            TVDQSD SFLDD+Q+ +G+VLTC AYPTS+VVI TH E
Sbjct  99   TVDQSDQSFLDDDQIASGWVLTCAAYPTSDVVIATHLE  136



>ref|XP_004497151.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform X1 [Cicer 
arietinum]
 ref|XP_004497152.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform X2 [Cicer 
arietinum]
Length=155

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELGA  295
            +LR++ N      GLKS +  R++ MA YKVKL+ P G   EFD PDD Y+LD AE  G 
Sbjct  35   TLRSVKNVSKV-FGLKSSSF-RVSAMAVYKVKLIGPDGTANEFDAPDDFYILDSAENAGV  92

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            DLPYSCRAG+CS+CAG+VVSG+VDQSD SFLDD+Q++ GY+LTCV+YP S++VI THKE
Sbjct  93   DLPYSCRAGACSTCAGQVVSGSVDQSDQSFLDDQQIEKGYLLTCVSYPKSDIVIYTHKE  151



>ref|XP_009148437.1| PREDICTED: ferredoxin-1, chloroplastic [Brassica rapa]
Length=148

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = -3

Query  471  SLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEEL  301
            SLR++       L GLKS     GR+T MA+YKVK +TP G+ E +C  D YVLD AEE 
Sbjct  24   SLRSLPAANTQSLFGLKSSTSRGGRVTAMATYKVKFITPDGEKEVECDGDTYVLDAAEES  83

Query  300  GADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHK  121
            G DLPYSCRAG+CSSCAGK+VSG+VDQSD SFLDD Q+  G+VLTC+A PTS+VVI TH+
Sbjct  84   GLDLPYSCRAGACSSCAGKIVSGSVDQSDQSFLDDGQISEGFVLTCIALPTSDVVITTHQ  143

Query  120  E  118
            E
Sbjct  144  E  144



>ref|XP_008783366.1| PREDICTED: ferredoxin-like [Phoenix dactylifera]
Length=153

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -3

Query  471  SLR-AISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGA  295
            SLR A+     A   L++G  GR+T MA+Y VKL+TP G+  F+CPDDVY+LD  EEL  
Sbjct  31   SLRSALPRAGWALFELEAGR-GRVTAMATYNVKLITPEGEQVFECPDDVYILDMGEELAF  89

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            DLPYSCRAGSCSSCAGK+V+G VDQS+ S+L D+Q+   +VLTCVAYP S+VVIETHKE
Sbjct  90   DLPYSCRAGSCSSCAGKIVAGEVDQSEGSYLTDDQIGQRFVLTCVAYPKSDVVIETHKE  148



>ref|XP_006859155.1| hypothetical protein AMTR_s00070p00129320 [Amborella trichopoda]
 gb|ERN20622.1| hypothetical protein AMTR_s00070p00129320 [Amborella trichopoda]
Length=147

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = -3

Query  513  STSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPD  334
            +T+F   + A   G+L  +        G++S   GR+T MA+YKV LVTP G    +CPD
Sbjct  14   NTAFTQRRSAVLCGALPKVGY---TAFGVRSARGGRVTAMATYKVTLVTPEGTKVLECPD  70

Query  333  DVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY  154
            D Y+LDQA + G DLPYSCRAGSCSSCAGK+  GTVDQSD ++LDD+Q+   +VLTCVA+
Sbjct  71   DTYILDQALDTGIDLPYSCRAGSCSSCAGKIKGGTVDQSDGNYLDDDQLSENWVLTCVAF  130

Query  153  PTSNVVIETHKE  118
            P S+V IETHKE
Sbjct  131  PMSDVTIETHKE  142



>ref|XP_010686005.1| PREDICTED: ferredoxin, root R-B1 [Beta vulgaris subsp. vulgaris]
Length=151

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELG  298
            GS+++IS       GLKS +  R T MA YKVKL+ P G   EFD PDD Y+LD AE  G
Sbjct  32   GSVKSISK----SFGLKSSSSFRTTAMAVYKVKLIGPDGQVSEFDAPDDCYILDSAENEG  87

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             ++PYSCRAG+CS+CAGK+ +GTVDQSD SFLDD QMD+GY+LTCV+YP S+ VI THKE
Sbjct  88   VEIPYSCRAGACSTCAGKLETGTVDQSDGSFLDDGQMDSGYLLTCVSYPRSDCVIHTHKE  147



>ref|WP_011143612.1| ferredoxin [Gloeobacter violaceus]
 ref|NP_926569.1| ferredoxin [Gloeobacter violaceus PCC 7421]
 dbj|BAC91564.1| ferredoxin [Gloeobacter violaceus PCC 7421]
Length=97

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+YKV LVTP+G  E DCP D Y+LD AE  G DLP+SCRAG+CS+CAGK+VSGT+DQ 
Sbjct  1    MATYKVTLVTPSGKKEIDCPSDEYILDAAERQGLDLPFSCRAGACSTCAGKMVSGTIDQG  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q+ AGYVLTCVAYPTSN  IETHKE
Sbjct  61   DQSFLDDDQIAAGYVLTCVAYPTSNCSIETHKE  93



>ref|WP_010873424.1| ferredoxin [Synechocystis sp. PCC 6803]
 ref|NP_442127.1| ferredoxin [Synechocystis sp. PCC 6803]
 sp|P27320.2|FER_SYNY3 RecName: Full=Ferredoxin-1; AltName: Full=Ferredoxin I [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 pdb|1OFF|A Chain A, 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803
 dbj|BAA10197.1| ferredoxin [Synechocystis sp. PCC 6803]
 gb|AAB72025.1| ferredoxin [Synechocystis sp. PCC 6803]
 dbj|BAA24020.1| ferredoxin I [Synechocystis sp. PCC 6803]
 dbj|BAK50980.1| ferredoxin [Synechocystis sp. PCC 6803]
 dbj|BAL29978.1| ferredoxin [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL33147.1| ferredoxin [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36316.1| ferredoxin [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM54458.1| ferredoxin [Synechocystis sp. PCC 6803]
 gb|AGF52490.1| ferredoxin [Synechocystis sp. PCC 6803]
Length=97

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MASY VKL+TP G+   +C DD Y+LD AEE G DLPYSCRAG+CS+CAGK+ +G+VDQS
Sbjct  1    MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct  61   DQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE  93



>ref|XP_009124654.1| PREDICTED: ferredoxin, leaf L-A-like [Brassica rapa]
Length=174

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 103/144 (72%), Gaps = 5/144 (3%)
 Frame = -3

Query  540  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV  370
            +T  + +++ TSF+  + A    SLR++       L GLKSG    G +  MA+YKV+ +
Sbjct  3    STALSSAIVGTSFIRRQTAPI--SLRSLPLANTQSLFGLKSGTTHGGCVIAMATYKVQFI  60

Query  369  TPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQ  190
            TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD SFLDD+Q
Sbjct  61   TPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQ  120

Query  189  MDAGYVLTCVAYPTSNVVIETHKE  118
            +  G+VLTC AY T +V IETH+E
Sbjct  121  IAEGFVLTCAAYLTFDVTIETHRE  144



>ref|XP_007015816.1| Ferredoxin 3 [Theobroma cacao]
 gb|EOY33435.1| Ferredoxin 3 [Theobroma cacao]
Length=150

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS+++IS       GLK  +  R + MA YK+KLV P G+  EF+ PDD Y+LD AEE G
Sbjct  32   GSVKSISK----SFGLKCSSNYRAS-MAVYKIKLVGPNGEECEFEAPDDKYILDAAEEAG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             DLPYSCRAG+CS+CAGK++SG+VDQSD SFLDD+QM+ GYVLTCV+YPTS+  I THKE
Sbjct  87   VDLPYSCRAGACSTCAGKIISGSVDQSDGSFLDDKQMEEGYVLTCVSYPTSDCEIHTHKE  146



>gb|AFK43837.1| unknown [Medicago truncatula]
 gb|KEH44307.1| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
Length=154

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGA  295
            +LR++ N    + GLKS +  R++ MA YKVKL+ P G + EFD PDD Y+LD AEE G 
Sbjct  34   TLRSVKNVS-KRFGLKSSSF-RISAMAVYKVKLIQPDGTENEFDAPDDYYILDSAEEAGV  91

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSCRAG+CS+CAG+VVSG+VDQSD SFLD +Q++ GY+LTCV+YP S+ VI THKE
Sbjct  92   ELPYSCRAGACSTCAGQVVSGSVDQSDQSFLDKQQIEKGYLLTCVSYPKSDTVIYTHKE  150



>ref|WP_028946897.1| ferredoxin [Synechocystis sp. PCC 6714]
 sp|P00243.2|FER_SYNY4 RecName: Full=Ferredoxin [Synechocystis sp. PCC 6714]
 gb|AIE72625.1| soluble [2Fe-2S] ferredoxin [Synechocystis sp. PCC 6714]
Length=97

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MASY VKL+TP G+   +C DD Y+LD AEE G DLPYSCRAG+CS+CAGK+ +G+VDQS
Sbjct  1    MASYTVKLITPDGENSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct  61   DQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE  93



>gb|ACG46956.1| ferredoxin-1 [Zea mays]
Length=140

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 6/139 (4%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGR--MTCMASYKVKLVTPTGD  355
            A + +S S L   P      LR     R A     +  M R  +   A+Y VKL+TP G+
Sbjct  2    AATALSMSILRAPPPCFSSPLR----LRVAVAKPLAAPMRRQLLRAQATYNVKLITPEGE  57

Query  354  FEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGY  175
             E   PDDVY+LD AEE G DLP+SCRAGSCSSCAGKVVSG+VDQSD SFL+D Q+  G+
Sbjct  58   MELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGW  117

Query  174  VLTCVAYPTSNVVIETHKE  118
            VLTC AYPTS+VVIETHKE
Sbjct  118  VLTCAAYPTSDVVIETHKE  136



>ref|NP_001104844.1| ferredoxin2 [Zea mays]
 dbj|BAA32348.1| ferredoxin [Zea mays]
 gb|ACA34368.1| chloroplast ferredoxin 2 precursor [Zea mays]
 gb|ACF84727.1| unknown [Zea mays]
 gb|AFW74226.1| chloroplast ferredoxin 2Ferredoxin [Zea mays]
Length=140

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 6/139 (4%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGR--MTCMASYKVKLVTPTGD  355
            A + +S S L   P      LR     R A     +  M R  +   A+Y VKL+TP G+
Sbjct  2    AATALSMSILRAPPPCFSSPLR----LRVAVAKPLAAPMRRQLLRAQATYNVKLITPEGE  57

Query  354  FEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGY  175
             E   PDDVY+LD AEE G DLP+SCRAGSCSSCAGKVVSG+VDQSD SFL+D Q+  G+
Sbjct  58   VELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGW  117

Query  174  VLTCVAYPTSNVVIETHKE  118
            VLTC AYPTS+VVIETHKE
Sbjct  118  VLTCAAYPTSDVVIETHKE  136



>gb|ACU19632.1| unknown [Glycine max]
Length=155

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS+++IS       GLKS +  R+T MASYKVKL+ P G + EF+  DD Y+LD AE  G
Sbjct  36   GSVKSISR----SFGLKSSSSFRVTAMASYKVKLIGPDGTENEFEATDDTYILDAAESAG  91

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+V+G+VDQ D SFLDD Q+  G+VLTCV+YPT++ VIETHKE
Sbjct  92   VELPYSCRAGACSTCAGKIVAGSVDQFDGSFLDDNQLKEGFVLTCVSYPTADCVIETHKE  151



>ref|XP_010658808.1| PREDICTED: ferredoxin, root R-B1-like [Vitis vinifera]
Length=149

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS+R+ S       GLKS +  R++ MA YKVKL+ P G+  EFD PDDVY+LD AE  G
Sbjct  31   GSVRSTSK----AFGLKSSSF-RVSAMAVYKVKLIGPDGEESEFDAPDDVYILDSAENAG  85

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++V G+VDQSD SFLD++QMD GYVLTCV+YPTS+ VI THKE
Sbjct  86   LELPYSCRAGACSTCAGQMVLGSVDQSDGSFLDEKQMDNGYVLTCVSYPTSDSVIHTHKE  145



>emb|CBI18580.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS+R+ S       GLKS +  R++ MA YKVKL+ P G+  EFD PDDVY+LD AE  G
Sbjct  50   GSVRSTSK----AFGLKSSSF-RVSAMAVYKVKLIGPDGEESEFDAPDDVYILDSAENAG  104

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++V G+VDQSD SFLD++QMD GYVLTCV+YPTS+ VI THKE
Sbjct  105  LELPYSCRAGACSTCAGQMVLGSVDQSDGSFLDEKQMDNGYVLTCVSYPTSDSVIHTHKE  164



>gb|KHG14857.1| Ferredoxin-3, chloroplastic -like protein [Gossypium arboreum]
Length=150

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELG  298
            GS+++IS       GLK  +  R T MA+YK+KLV P G+  EF+ PDD Y+LD AEE G
Sbjct  32   GSVKSISK----SFGLKCSSNFR-TSMATYKIKLVGPKGEVNEFEAPDDKYILDAAEEAG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+C +CAGK++SG+VDQSD SFLDD+QM+ GY+LTCVAYPTS+  I THKE
Sbjct  87   VELPYSCRAGACCTCAGKMISGSVDQSDGSFLDDKQMEEGYLLTCVAYPTSDCEIHTHKE  146



>pdb|3P63|A Chain A, Structure Of M. Laminosus Ferredoxin With A Shorter 
L1,2 Loop
 pdb|3P63|B Chain B, Structure Of M. Laminosus Ferredoxin With A Shorter 
L1,2 Loop
Length=96

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV L+ PTG+   + PDD Y+LD AEE G DLPYSCRAG+CS+CAGK++SGTVDQSD
Sbjct  1    ATYKVTLINPTGNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AGYVLTCVAYPTS+ VIETHKE
Sbjct  61   QSFLDDDQIEAGYVLTCVAYPTSDCVIETHKE  92



>ref|XP_007207484.1| hypothetical protein PRUPE_ppa012826mg [Prunus persica]
 gb|EMJ08683.1| hypothetical protein PRUPE_ppa012826mg [Prunus persica]
Length=153

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 90/120 (75%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS++ IS       GLK+ +  R + MA YKVKLV P G + EFD PDD Y+LD AE  G
Sbjct  35   GSVKNISK----AFGLKASSNFRAS-MAVYKVKLVGPDGAECEFDAPDDAYILDSAENAG  89

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+V+G+VDQSD SFLDD QM  GYVLTCVAYPTS+ VI THKE
Sbjct  90   VELPYSCRAGACSTCAGKLVAGSVDQSDGSFLDDNQMKEGYVLTCVAYPTSDAVIHTHKE  149



>ref|XP_008228634.1| PREDICTED: ferredoxin, root R-B1 [Prunus mume]
Length=153

 Score =   121 bits (303),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS++ IS       GLK+ +  R + MA +KVKLV P G  +EFD PDD Y+LD AE  G
Sbjct  35   GSVKNISK----AFGLKASSNFRAS-MAVHKVKLVGPDGAKYEFDAPDDAYILDSAENAG  89

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+V+G+VDQSD SFLDD QM  GYVLTCVAYPTS+ VI THKE
Sbjct  90   VELPYSCRAGACSTCAGKLVAGSVDQSDGSFLDDNQMKEGYVLTCVAYPTSDAVIHTHKE  149



>emb|CDY19334.1| BnaC05g08430D [Brassica napus]
Length=139

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -3

Query  411  GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSG  232
            GR+T MA+YK+K +TP G+ E  C  D YVLD AE+   DLPYSCRAG+CSSCAGK+VSG
Sbjct  38   GRVTAMATYKIKFITPDGEKEVKCDGDTYVLDAAEDAEMDLPYSCRAGACSSCAGKIVSG  97

Query  231  TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +VDQSD SFLDD+Q+  G+VLTC+A PTS+VVIETHKE
Sbjct  98   SVDQSDQSFLDDDQISEGFVLTCIARPTSDVVIETHKE  135



>ref|XP_006361079.1| PREDICTED: ferredoxin-3, chloroplastic-like [Solanum tuberosum]
Length=151

 Score =   120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = -3

Query  492  KPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLD  316
            K  A+ GS+R+IS       GLK+ +  R +  A YKVKLV P G + EF+   D Y+LD
Sbjct  26   KSPASLGSVRSISK----GFGLKASSGFRASASAVYKVKLVCPEGVEHEFEASSDTYILD  81

Query  315  QAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVV  136
             AE  G +LPYSCRAG+CS+CAGK+VSG+VDQSD SFLDD QM+ GYVLTCV+YPTS+ V
Sbjct  82   AAENAGVELPYSCRAGACSTCAGKIVSGSVDQSDGSFLDDNQMEEGYVLTCVSYPTSDCV  141

Query  135  IETHKE  118
            I THKE
Sbjct  142  IHTHKE  147



>ref|XP_010244968.1| PREDICTED: ferredoxin, root R-B2 [Nelumbo nucifera]
Length=150

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFE-FDCPDDVYVLDQAEELG  298
            GSL++ S       GLK+ +  R++ MA YKVKLV P G+    D PDD Y+LD AE  G
Sbjct  31   GSLKSASKL----FGLKASSGFRVSAMAVYKVKLVGPNGEEHVIDAPDDTYILDSAESAG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++VSG+VDQSD SFLDD+QM+ GYVLTCV+YPT++ VI THKE
Sbjct  87   VELPYSCRAGACSTCAGQMVSGSVDQSDGSFLDDKQMENGYVLTCVSYPTADCVIHTHKE  146



>ref|WP_015164599.1| ferredoxin 2Fe-2S [Pseudanabaena sp. PCC 7367]
 gb|AFY69626.1| ferredoxin (2Fe-2S) [Pseudanabaena sp. PCC 7367]
Length=97

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA Y V L TP G+ +  CPDD Y+LD+AEE G DLPYSCRAG+CS+CAGK+VSG+VDQS
Sbjct  1    MADYTVTLKTPDGEKQITCPDDTYILDKAEEEGLDLPYSCRAGACSTCAGKMVSGSVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDDEQ++AGYVLTCVAYPT++  IETHKE
Sbjct  61   DQSFLDDEQIEAGYVLTCVAYPTADCTIETHKE  93



>gb|AAB33405.1| ferredoxin component a1 [Raphanus sativus var. longipinnatus=Chinese 
radish, leaves, seedlings, Peptide, 96 aa]
Length=96

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVK VTP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD
Sbjct  1    ATYKVKFVTPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q+  G+VLTC AYPTS+V IETH+E
Sbjct  61   QSFLDDDQIAEGFVLTCAAYPTSDVTIETHRE  92



>gb|KDO44408.1| hypothetical protein CISIN_1g031979mg [Citrus sinensis]
Length=149

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 6/126 (5%)
 Frame = -3

Query  492  KPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLD  316
            K  A+ GS R++S       GLK  +  + + MA YKVKL+ P G+  EFD PDD Y++D
Sbjct  25   KSPASLGSTRSVSK----AFGLKCSSF-KASAMAVYKVKLIGPNGEENEFDAPDDAYIID  79

Query  315  QAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVV  136
             AE+ G +LPYSCRAG+CS+CAG++VSG+VDQSD SFLDD+QM+ G+VLTCVAYPTS+ V
Sbjct  80   SAEDTGMELPYSCRAGACSTCAGQMVSGSVDQSDGSFLDDKQMEKGFVLTCVAYPTSDCV  139

Query  135  IETHKE  118
            I THKE
Sbjct  140  IYTHKE  145



>ref|NP_001105345.1| ferredoxin-1, chloroplastic precursor [Zea mays]
 sp|P27787.1|FER1_MAIZE RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Ferredoxin 
I; Short=Fd I; Flags: Precursor [Zea mays]
 gb|AAA33459.1| ferredoxin [Zea mays]
 gb|AAA33460.1| ferredoxin [Zea mays]
 prf||1907324B ferredoxin:ISOTYPE=I
Length=150

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRM----------TCMASYKVKLVTPTGDFEFDCPDDVYV  322
            SLRA     P  + L +  +G M             A+Y VKL+TP G+ E   PDDVY+
Sbjct  19   SLRAAP--APTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPDDVYI  76

Query  321  LDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSN  142
            LDQAEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD S+LDD Q+  G+VLTC AYPTS+
Sbjct  77   LDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSD  136

Query  141  VVIETHKE  118
            VVIETHKE
Sbjct  137  VVIETHKE  144



>sp|P83585.1|FER_SOLAB RecName: Full=Ferredoxin [Solanum abutiloides]
Length=97

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVKLVTP G  EF+CPDD Y+LD+AEE G DLPYSCRAGSCSSCAGK+ +G+VDQSD
Sbjct  1    ATYKVKLVTPDGPVEFECPDDEYILDRAEEEGHDLPYSCRAGSCSSCAGKIAAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +FLDD+Q+  G+VLTCVAYP S+V IETHKE
Sbjct  61   GNFLDDDQIADGFVLTCVAYPQSDVTIETHKE  92



>ref|XP_008456215.1| PREDICTED: ferredoxin-like [Cucumis melo]
Length=149

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 100/139 (72%), Gaps = 3/139 (2%)
 Frame = -3

Query  534  LSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD  355
            +S+  + +TSFL  +      +LR+  N      GL+     R+T MA+YKVKL+TP+G 
Sbjct  1    MSSIPITTTSFLRYQLLTT--TLRSAPNVGECLFGLQKRG-SRVTAMATYKVKLITPSGV  57

Query  354  FEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGY  175
             E  CPDD Y+L+ AE+ G DLPYSCRAG+CSSCAGK++SG VDQS+ SFLDD+Q+  G+
Sbjct  58   KEIKCPDDNYILNVAEDEGLDLPYSCRAGACSSCAGKLISGKVDQSNISFLDDDQIAKGW  117

Query  174  VLTCVAYPTSNVVIETHKE  118
            V+ C+AYP S+VVIETHKE
Sbjct  118  VINCMAYPLSDVVIETHKE  136



>sp|P14938.1|FER3_RAPSA RecName: Full=Ferredoxin, leaf L-A [Raphanus sativus]
Length=96

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVK +TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD
Sbjct  1    ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q+  G+VLTC AYPTS+V IETH+E
Sbjct  61   QSFLDDDQIAEGFVLTCAAYPTSDVTIETHRE  92



>sp|P00230.1|FER1_PHYAN RecName: Full=Ferredoxin-1; AltName: Full=Ferredoxin I [Phytolacca 
acinosa]
Length=96

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV LVTP+G    DCPDD YVLD AEE G DLPYSCRAGSCSSCAGKV +GTVDQ D
Sbjct  1    ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCAGKVTAGTVDQED  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AG+VLTCVAYP  +V IETHKE
Sbjct  61   QSFLDDDQIEAGFVLTCVAYPKGDVTIETHKE  92



>prf||0602214A ferredoxin I
Length=96

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV LVTP+G    DCPDD YVLD AEE G DLPYSCRAGSCSSC GKV +GTVDQ D
Sbjct  1    ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCTGKVTAGTVDQED  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AG+VLTCVAYP  +V IETHKE
Sbjct  61   QSFLDDDQIEAGFVLTCVAYPKGDVTIETHKE  92



>pdb|1DOX|A Chain A, 1h And 15n Sequential Assignment, Secondary Structure 
And Tertiary Fold Of [2fe-2s] Ferredoxin From Synechocystis 
Sp. Pcc 6803
 pdb|1DOY|A Chain A, 1h And 15n Sequential Assignment, Secondary Structure 
And Tertiary Fold Of [2fe-2s] Ferredoxin From Synechocystis 
Sp. Pcc 6803
 pdb|2KAJ|A Chain A, Nmr Structure Of Gallium Substituted Ferredoxin
Length=96

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASY VKL+TP G+   +C DD Y+LD AEE G DLPYSCRAG+CS+CAGK+ +G+VDQSD
Sbjct  1    ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct  61   QSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE  92



>pdb|1GAQ|B Chain B, Crystal Structure Of The Complex Between Ferredoxin 
And Ferredoxin-Nadp+ Reductase
 pdb|3B2F|A Chain A, Maize Ferredoxin 1
 pdb|3B2F|B Chain B, Maize Ferredoxin 1
Length=98

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+Y VKL+TP G+ E   PDDVY+LDQAEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD
Sbjct  1    ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             S+LDD Q+  G+VLTC AYPTS+VVIETHKE
Sbjct  61   QSYLDDGQIADGWVLTCHAYPTSDVVIETHKE  92



>prf||1506385C ferredoxin LFdA
Length=97

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVK +TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD
Sbjct  1    ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q+  G+VLTC AYPTS+V IETH+E
Sbjct  61   QSFLDDDQIAEGFVLTCAAYPTSDVTIETHRE  92



>sp|P00238.1|FER_SCEQU RecName: Full=Ferredoxin [Scenedesmus quadricaudus]
Length=96

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV L TP+GD   +CPDD Y+LD AEE G DLPYSCRAG+CSSCAGKV +GTVDQSD
Sbjct  1    ATYKVTLKTPSGDQTIECPDDTYILDAAEEAGLDLPYSCRAGACSSCAGKVEAGTVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD QMD G+VLTCVAYPTS+  I THKE
Sbjct  61   QSFLDDSQMDGGFVLTCVAYPTSDCTIATHKE  92



>gb|AAB22616.1| apo-ferredoxin [Synechocystis sp., PCC 6803, Peptide, 96 aa]
Length=96

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASY VKL+TP G+   +C DD Y+LD AEE G DLPYSCRAG+CS+CAGK+ +G+VDQSD
Sbjct  1    ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct  61   QSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE  92



>ref|NP_001236409.1| uncharacterized protein LOC100500583 [Glycine max]
 gb|ACU15698.1| unknown [Glycine max]
 gb|KHN11461.1| Ferredoxin-3, chloroplastic [Glycine soja]
Length=154

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGA  295
            SLR++ N      GLKS +  R++ MA YKVKL+ P G+  EF+ PDD Y+LD AE  G 
Sbjct  34   SLRSVKNVSKV-FGLKSSSF-RVSAMAVYKVKLIGPDGEENEFEAPDDTYILDSAENAGV  91

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSCRAG+CS+CAG+VVSG+VDQ+D SFLDD Q++ GY+LTCV+YP S+ VI THKE
Sbjct  92   ELPYSCRAGACSTCAGQVVSGSVDQADQSFLDDHQIEKGYLLTCVSYPKSDCVIHTHKE  150



>prf||0812212A ferredoxin
Length=96

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASY VKL+TP G+   +C DD Y+LD AEE G DLPYSCRAG+CS+CAGK+ +G+VDQSD
Sbjct  1    ASYTVKLITPDGENSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct  61   QSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE  92



>sp|P00227.1|FER_BRANA RecName: Full=Ferredoxin [Brassica napus]
Length=96

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKVK +TP G+ E +C DDVYVLD AEE G DLPYSCRAGSCSSCAGKVVSG VDQSD
Sbjct  1    ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q+  G+VLTC AYPTS+V IETHKE
Sbjct  61   ESFLDDDQIAEGFVLTCAAYPTSDVTIETHKE  92



>ref|XP_002311943.2| ferredoxin I family protein [Populus trichocarpa]
 gb|EEE89310.2| ferredoxin I family protein [Populus trichocarpa]
Length=155

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 93/126 (74%), Gaps = 6/126 (5%)
 Frame = -3

Query  492  KPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLD  316
            K   A GS+R +S       GLKS +  +++ MA YKVKL+ P G + EFD P D Y+LD
Sbjct  31   KSPGALGSVRNVSK----AFGLKSSSF-KVSAMAVYKVKLIAPDGCEHEFDAPGDTYILD  85

Query  315  QAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVV  136
             AE  G +LPYSCRAG+CS+CAG +VSG+VDQSD SFLD++QM+ GYVLTCV+YPTS+ V
Sbjct  86   SAENAGVELPYSCRAGACSTCAGMLVSGSVDQSDGSFLDEKQMEKGYVLTCVSYPTSDCV  145

Query  135  IETHKE  118
            I THKE
Sbjct  146  IHTHKE  151



>gb|KEH44304.1| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
Length=160

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGA  295
            SLR++ N      GLKS +  R++ MA YKVKL+ P G + EFD PDD Y+LD AE+ G 
Sbjct  40   SLRSVKNVSKT-FGLKSSSF-RVSAMAVYKVKLIGPDGTENEFDAPDDSYILDSAEDAGV  97

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSCRAG+CS+CAG+VV+G+VDQSD SFLD++Q++ GY+LTCV+YP S+ VI THKE
Sbjct  98   ELPYSCRAGACSTCAGQVVTGSVDQSDQSFLDEQQIEKGYLLTCVSYPKSDTVIYTHKE  156



>ref|WP_017713981.1| ferredoxin [Prochlorothrix hollandica]
Length=97

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MASYKV L T  GD     PDD Y+LD AEE G DLPYSCRAG+CS+CAGK+VSGTVDQS
Sbjct  1    MASYKVTLKTADGDKVLTVPDDKYILDHAEEEGLDLPYSCRAGACSTCAGKIVSGTVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q++AGYVLTCVAYPTS+ VIETHKE
Sbjct  61   DQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKE  93



>gb|AFK42562.1| unknown [Medicago truncatula]
 gb|KEH44305.1| 2Fe-2S ferredoxin superfamily protein [Medicago truncatula]
Length=156

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGA  295
            SLR++ N      GLKS +  R++ MA YKVKL+ P G + EFD PDD Y+LD AE+ G 
Sbjct  36   SLRSVKNVSKT-FGLKSSSF-RVSAMAVYKVKLIGPDGTENEFDAPDDSYILDSAEDAGV  93

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSCRAG+CS+CAG+VV+G+VDQSD SFLD++Q++ GY+LTCV+YP S+ VI THKE
Sbjct  94   ELPYSCRAGACSTCAGQVVTGSVDQSDQSFLDEQQIEKGYLLTCVSYPKSDTVIYTHKE  152



>ref|XP_006445732.1| hypothetical protein CICLE_v10016676mg [Citrus clementina]
 ref|XP_006485193.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485194.1| PREDICTED: ferredoxin-3, chloroplastic-like isoform X2 [Citrus 
sinensis]
 gb|ESR58972.1| hypothetical protein CICLE_v10016676mg [Citrus clementina]
Length=149

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS R++S       GLK  +  + + MA YKVKL+ P G+  EFD PDD Y++D AE+ G
Sbjct  31   GSTRSVSK----AFGLKCSSF-KASAMAVYKVKLIGPNGEENEFDAPDDAYIIDSAEDTG  85

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++VSG+VDQSD SFLDD+QM+ G+VLTCVAYPTS+ VI THKE
Sbjct  86   MELPYSCRAGACSTCAGQMVSGSVDQSDGSFLDDKQMEKGFVLTCVAYPTSDCVIYTHKE  145



>gb|ACJ84066.1| unknown [Medicago truncatula]
Length=156

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGA  295
            SLR++ N      GLKS +  R++ MA YKVKL+ P G + EFD PDD Y+LD AE+ G 
Sbjct  36   SLRSVKNVSKT-FGLKSSSF-RVSAMAVYKVKLIGPDGTENEFDAPDDSYILDSAEDAGV  93

Query  294  DLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            +LPYSC AG+CS+CAG+VV+G+VDQSD SFLD++Q++ GY+LTCV+YP S+ VI THKE
Sbjct  94   ELPYSCGAGACSTCAGQVVTGSVDQSDQSFLDEQQIEKGYLLTCVSYPKSDTVIYTHKE  152



>pdb|3W5V|B Chain B, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5V|D Chain D, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
Length=98

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+Y VKL+TP G+ E   PDDVY+LDQAEE G DLPYSCRAGSCSSCAGKVVSG+VDQSD
Sbjct  1    ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             S+LDD Q+  G+VLTC AYPTS+VVIETHKE
Sbjct  61   QSYLDDGQICDGWVLTCHAYPTSDVVIETHKE  92



>ref|XP_011024187.1| PREDICTED: ferredoxin, root R-B1-like isoform X2 [Populus euphratica]
 ref|XP_011024188.1| PREDICTED: ferredoxin, root R-B1-like isoform X2 [Populus euphratica]
Length=155

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 94/132 (71%), Gaps = 7/132 (5%)
 Frame = -3

Query  510  TSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPD  334
            T  L   P A G ++     F     GLKS +  +++ MA YKVKL+ P G + EFD PD
Sbjct  26   TCALIKSPGALGSAMSVSKAF-----GLKSSSF-KVSAMAVYKVKLIMPDGCEHEFDAPD  79

Query  333  DVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY  154
            D Y+LD AE  G +LPYSCRAG+CS+CAG +VSG+VDQSD SFLD++QM+ GYVLTC++Y
Sbjct  80   DTYILDSAENAGVELPYSCRAGACSTCAGMMVSGSVDQSDGSFLDEKQMEKGYVLTCISY  139

Query  153  PTSNVVIETHKE  118
            PTS+ VI THKE
Sbjct  140  PTSDSVIHTHKE  151



>ref|XP_011032872.1| PREDICTED: ferredoxin, root R-B1-like [Populus euphratica]
 ref|XP_011032873.1| PREDICTED: ferredoxin, root R-B1-like [Populus euphratica]
Length=155

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 93/126 (74%), Gaps = 6/126 (5%)
 Frame = -3

Query  492  KPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLD  316
            K   A GS+R +S       GLKS +  +++ MA YKVKL+ P G + EFD P D Y+LD
Sbjct  31   KSPGALGSVRNVSK----AFGLKSSSF-KVSAMAVYKVKLIAPDGCEHEFDAPGDTYILD  85

Query  315  QAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVV  136
             AE  G +LPYSCRAG+CS+CAG +VSG+VDQSD SFLD++QM+ GYVLTCV+YPTS+ V
Sbjct  86   SAENAGVELPYSCRAGACSTCAGMMVSGSVDQSDGSFLDEKQMEKGYVLTCVSYPTSDCV  145

Query  135  IETHKE  118
            I THKE
Sbjct  146  IHTHKE  151



>ref|XP_004146259.1| PREDICTED: ferredoxin-2, chloroplastic-like [Cucumis sativus]
 ref|XP_004159875.1| PREDICTED: ferredoxin-2, chloroplastic-like [Cucumis sativus]
 gb|KGN57598.1| hypothetical protein Csa_3G222800 [Cucumis sativus]
Length=146

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -3

Query  513  STSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPD  334
            +TSF+   P   G S +   N   +  GLK  + G    M +YKVKL+TP G+   +C  
Sbjct  13   ATSFIRRNPTG-GVSFKPFPNMGESLYGLK--HRGGRLAMKAYKVKLITPDGEKTVECDA  69

Query  333  DVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY  154
            D+Y+LD AEE G DLPYSCRAG+CSSC GKVVSG +DQSD SFLDDEQ+  G+VLTCVA 
Sbjct  70   DLYILDAAEESGLDLPYSCRAGACSSCVGKVVSGKLDQSDQSFLDDEQVAEGWVLTCVAR  129

Query  153  PTSNVVIETHKE  118
            P S++VIETHKE
Sbjct  130  PESDLVIETHKE  141



>ref|WP_002796877.1| ferredoxin [Microcystis aeruginosa]
 dbj|BAG03475.1| ferredoxin I [Microcystis aeruginosa NIES-843]
 emb|CCI24385.1| Ferredoxin [Microcystis aeruginosa PCC 9809]
Length=98

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+YKV L+TP G+ E + PDD Y+LD AEE G DLPYSCRAG+CS+CAGK+ SGTVDQS
Sbjct  1    MATYKVTLITPDGNHEIEVPDDEYILDIAEEQGVDLPYSCRAGACSTCAGKLESGTVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q++AGYVLTCVAYPTS+ VI TH+E
Sbjct  61   DQSFLDDDQIEAGYVLTCVAYPTSDCVILTHQE  93



>ref|XP_002966767.1| hypothetical protein SELMODRAFT_230918 [Selaginella moellendorffii]
 ref|XP_002977982.1| hypothetical protein SELMODRAFT_233062 [Selaginella moellendorffii]
 gb|EFJ20639.1| hypothetical protein SELMODRAFT_233062 [Selaginella moellendorffii]
 gb|EFJ32794.1| hypothetical protein SELMODRAFT_230918 [Selaginella moellendorffii]
Length=98

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+YKV L TP G+   + PDD YVLD AEE G D+PYSCRAG+C SC GK+VSGTVDQS
Sbjct  1    MATYKVTLKTPKGEEVLEVPDDTYVLDAAEEAGIDVPYSCRAGACCSCVGKIVSGTVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q   GYVLTCVAYPTS+VVIETHKE
Sbjct  61   DGSFLDDDQKAGGYVLTCVAYPTSDVVIETHKE  93



>ref|WP_015212869.1| ferredoxin (2Fe-2S) [Anabaena cylindrica]
 gb|AFZ56216.1| ferredoxin (2Fe-2S) [Anabaena cylindrica PCC 7122]
Length=97

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+Y V L TP G+   +C DD Y+LD AEE G DLPYSCRAG+CS+CAGK++SGTVDQS
Sbjct  1    MATYTVILKTPDGEQTIECGDDTYILDAAEEAGLDLPYSCRAGACSTCAGKIISGTVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q++A YVLTCVAYPTSNV IETHKE
Sbjct  61   DQSFLDDDQIEAQYVLTCVAYPTSNVTIETHKE  93



>ref|XP_002316497.1| ferredoxin I family protein [Populus trichocarpa]
 ref|XP_006378818.1| hypothetical protein POPTR_0010s24560g [Populus trichocarpa]
 gb|ABK95610.1| unknown [Populus trichocarpa]
 gb|EEF02668.1| ferredoxin I family protein [Populus trichocarpa]
 gb|ERP56615.1| hypothetical protein POPTR_0010s24560g [Populus trichocarpa]
Length=155

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = -3

Query  489  PAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQ  313
            P A G ++     F     GLKS +  +++ MA YKVKL+ P G + EFD PDD Y+LD 
Sbjct  33   PGALGSAMSVSKAF-----GLKSSSF-KVSAMAVYKVKLIMPDGCEHEFDAPDDTYILDS  86

Query  312  AEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVI  133
            AE  G +LPYSCRAG+CS+CAG +VSG+VDQSD SFLD++QM+ GYVLTC++YPTS+ VI
Sbjct  87   AENAGVELPYSCRAGACSTCAGMMVSGSVDQSDGSFLDEKQMEKGYVLTCISYPTSDSVI  146

Query  132  ETHKE  118
             THKE
Sbjct  147  HTHKE  151



>sp|P00220.1|FER_MEDSA RecName: Full=Ferredoxin [Medicago sativa]
Length=97

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASYKVKLVTP G  EF+CPDDVY+LD AEE G  LPYSCRAGSCSSCAGKV +G V+QSD
Sbjct  1    ASYKVKLVTPEGTQEFECPDDVYILDHAEEEGIVLPYSCRAGSCSSCAGKVAAGEVNQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++ G+VLTCVAY  S+V IETHKE
Sbjct  61   GSFLDDDQIEEGWVLTCVAYAKSDVTIETHKE  92



>sp|P00223.1|FER_ARCLA RecName: Full=Ferredoxin [Arctium lappa]
 prf||0901304A ferredoxin
Length=97

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV L+TP G  EF+ PDDVY+LD A E   DLPYSCRAGSCSSCAGKV +G+VDQSD
Sbjct  1    ATYKVTLITPEGKQEFEVPDDVYILDHAAEEVGDLPYSCRAGSCSSCAGKVTAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             S+LDD+QM+AG+VLTCVAYPTS+V IETHKE
Sbjct  61   GSYLDDDQMEAGWVLTCVAYPTSDVTIETHKE  92



>ref|WP_004160242.1| Ferredoxin [Microcystis aeruginosa]
 emb|CCI15397.1| Ferredoxin [Microcystis aeruginosa PCC 9806]
Length=98

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+YKV L+TP G  E D  DD Y+LD AEE G DLPYSCRAG+CS+CAGK+VSG+VDQS
Sbjct  1    MATYKVTLITPDGKHEIDVKDDEYILDAAEEGGLDLPYSCRAGACSTCAGKLVSGSVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+Q++AG++LTCVAYPTS+ VIETH+E
Sbjct  61   DQSFLDDDQIEAGFILTCVAYPTSDCVIETHQE  93



>ref|XP_010089821.1| Ferredoxin-3 [Morus notabilis]
 gb|EXB38437.1| Ferredoxin-3 [Morus notabilis]
Length=153

 Score =   119 bits (297),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS R  S     + GLK+    + + MA+YKVKL+   G + EF+ PDD Y+LD AE  G
Sbjct  35   GSTRNASK----KFGLKAAQSFKAS-MATYKVKLICEDGTEHEFEAPDDCYILDSAENAG  89

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+ SGTVDQSD SFLDD+QMD GY+LTCV+YPTS++VI THKE
Sbjct  90   VELPYSCRAGACSTCAGKLASGTVDQSDGSFLDDKQMDEGYLLTCVSYPTSDIVIHTHKE  149



>prf||0406240A ferredoxin I
Length=96

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV LVTP+G    DCPDD YVLD AEE G DLPYSCRAGSCSSC GKV +GTVDQ D
Sbjct  1    ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCTGKVTAGTVDQED  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AG+VLTCVA+P  +V IETHKE
Sbjct  61   QSFLDDDQIEAGFVLTCVAFPKGDVTIETHKE  92



>gb|EPS71446.1| hypothetical protein M569_03315, partial [Genlisea aurea]
Length=126

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = -3

Query  435  LGLKSGNMG---RMTCMA-SYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYscra  271
             G K  N G   R + MA +YKVKLV P G + EFD PDDVY+LD AE  G +LPYSCRA
Sbjct  12   FGFKVRNPGGGFRASAMAATYKVKLVGPDGTESEFDAPDDVYILDSAENAGIELPYSCRA  71

Query  270  gscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            G+CS+CAGK+V+G+VDQSD SFLDD QM  GYVLTCV+YPTS+VVI THKE
Sbjct  72   GACSTCAGKMVAGSVDQSDGSFLDDGQMGNGYVLTCVSYPTSDVVIHTHKE  122



>sp|P00229.1|FER1_PHYAM RecName: Full=Ferredoxin-1; AltName: Full=Ferredoxin I [Phytolacca 
americana]
Length=96

 Score =   117 bits (292),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+YKV LVTP+G    DCPDD YVLD AEE G DLPYSCRAGSCSSC GKV +GTVDQ D
Sbjct  1    ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCTGKVTAGTVDQED  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AG+VLTCVA+P  +V IETHKE
Sbjct  61   QSFLDDDQIEAGFVLTCVAFPKGDVTIETHKE  92



>ref|XP_009592968.1| PREDICTED: ferredoxin, root R-B1-like [Nicotiana tomentosiformis]
 ref|XP_009592970.1| PREDICTED: ferredoxin, root R-B1-like [Nicotiana tomentosiformis]
Length=151

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS R+ S       GLK+    R +  A YKVKLV P G + EF+ P D Y+LD AE  G
Sbjct  32   GSARSFSK----AFGLKASCGFRASASAVYKVKLVCPDGVEHEFEAPSDTYILDAAENAG  87

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+VSG+VDQSD SFLDD QM+ GY+LTCV+YPTS+ VI THKE
Sbjct  88   VELPYSCRAGACSTCAGKIVSGSVDQSDGSFLDDNQMEEGYLLTCVSYPTSDCVIHTHKE  147



>ref|XP_009599754.1| PREDICTED: ferredoxin, root R-B2-like [Nicotiana tomentosiformis]
 ref|XP_009599755.1| PREDICTED: ferredoxin, root R-B2-like [Nicotiana tomentosiformis]
 ref|XP_009599756.1| PREDICTED: ferredoxin, root R-B2-like [Nicotiana tomentosiformis]
 ref|XP_009599757.1| PREDICTED: ferredoxin, root R-B2-like [Nicotiana tomentosiformis]
Length=150

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = -3

Query  528  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DF  352
            A S+ S++F   K   + GS+++IS       GLKS +  +++ MA+YKVKLV P G + 
Sbjct  15   APSIRSSAFT--KSQCSLGSVKSISK----AFGLKSSSSFKVSAMAAYKVKLVGPDGNET  68

Query  351  EFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYV  172
            E +  DD Y+LD AEE G +LPYSCRAGSC +CAGK+VSGTVDQS+ +FLDD+QM+ GY+
Sbjct  69   EIEVSDDQYILDAAEEAGVELPYSCRAGSCCTCAGKLVSGTVDQSEGAFLDDDQMEKGYL  128

Query  171  LTCVAYPTSNVVIETHKE  118
            LTC++YP S+ VI THKE
Sbjct  129  LTCISYPRSDCVIHTHKE  146



>ref|XP_010688135.1| PREDICTED: ferredoxin, root R-B1-like [Beta vulgaris subsp. vulgaris]
Length=150

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELG  298
            GS+++IS       GLKS    R T MA YKVKL+ P G   EFD PDD Y+LD AE  G
Sbjct  32   GSVKSISK----SFGLKSSCF-RTTAMAVYKVKLIGPDGQVSEFDAPDDCYILDSAENEG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+ +GTVDQSD SFLDD QMD GY+LTCV+YP S+ VI THKE
Sbjct  87   VELPYSCRAGACSTCAGKLETGTVDQSDGSFLDDGQMDNGYLLTCVSYPRSDCVIHTHKE  146



>pdb|2PVG|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin 
And Ferredoxin:thioredoxin Reductase
 pdb|2PVO|D Chain D, Crystal Srtucture Of The Ternary Complex Between Thioredoxin 
F, Ferredoxin, And Ferredoxin: Thioredoxin Reductase
Length=96

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            ASY VKL+TP G+   +C DD Y+LD AEE G +LPYSCRAG+CS+CAGK+ +G+VDQSD
Sbjct  1    ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct  61   QSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE  92



>ref|XP_009805054.1| PREDICTED: ferredoxin, root R-B1-like [Nicotiana sylvestris]
 ref|XP_009805055.1| PREDICTED: ferredoxin, root R-B1-like [Nicotiana sylvestris]
Length=151

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS R+IS       GLK+    R +  A YKVKLV P G + EF+ P D Y+LD AE  G
Sbjct  32   GSARSISK----AFGLKASCAFRASASAVYKVKLVCPDGVEHEFEAPSDTYILDAAENAG  87

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAGK+VSG+VDQSD SFLDD Q++ GY+LTCV+YP+S+ VI THKE
Sbjct  88   VELPYSCRAGACSTCAGKIVSGSVDQSDGSFLDDNQIEEGYLLTCVSYPSSDCVIHTHKE  147



>ref|XP_011000933.1| PREDICTED: ferredoxin, root R-B1-like [Populus euphratica]
 ref|XP_011000934.1| PREDICTED: ferredoxin, root R-B1-like [Populus euphratica]
 ref|XP_011000935.1| PREDICTED: ferredoxin, root R-B1-like [Populus euphratica]
Length=150

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS+R++S       G K     + + MA YKVKL+TP G + EF+ PDDVY+LD AE  G
Sbjct  32   GSVRSVSK----SFGFKCSPNYKAS-MAVYKVKLITPEGTEHEFEAPDDVYILDAAENAG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             DLPYSCRAG+CS+CAGKV SG+VDQSD SFLD+ QM  GY+LTC++YPTS+ VI THKE
Sbjct  87   IDLPYSCRAGACSTCAGKVASGSVDQSDGSFLDENQMGEGYLLTCISYPTSDCVIHTHKE  146



>ref|XP_006445731.1| hypothetical protein CICLE_v10016676mg [Citrus clementina]
 gb|ESR58971.1| hypothetical protein CICLE_v10016676mg [Citrus clementina]
Length=213

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELG  298
            GS R++S       GLK  +  + + MA YKVKL+ P G+  EFD PDD Y++D AE+ G
Sbjct  95   GSTRSVSK----AFGLKCSSF-KASAMAVYKVKLIGPNGEENEFDAPDDAYIIDSAEDTG  149

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++VSG+VDQSD SFLDD+QM+ G+VLTCVAYPTS+ VI THKE
Sbjct  150  MELPYSCRAGACSTCAGQMVSGSVDQSDGSFLDDKQMEKGFVLTCVAYPTSDCVIYTHKE  209



>ref|WP_019493669.1| ferredoxin [Calothrix sp. PCC 7103]
Length=97

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  396  MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQS  217
            MA+YKV LV   G    DC DD Y+LD AEE G DLPYSCRAG+CS+CAGK+ +GTVDQS
Sbjct  1    MATYKVTLVGEEGTTTIDCADDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGTVDQS  60

Query  216  DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
            D SFLDD+QM+ GYVLTCVAYPTS+  IETHKE
Sbjct  61   DQSFLDDDQMEGGYVLTCVAYPTSDCTIETHKE  93



>gb|KDP43389.1| hypothetical protein JCGZ_26489 [Jatropha curcas]
Length=156

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 4/120 (3%)
 Frame = -3

Query  471  SLRAISNFRPAQLGLKSGNMGRMTCMAS-YKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            SL +  N   A  GLKS +  +++ MA+ YKVKL+TP G + EFD PDD Y+LD AE  G
Sbjct  35   SLGSAKNLSKA-FGLKSSSF-KVSAMANVYKVKLITPEGVEHEFDAPDDTYILDSAENAG  92

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+CS+CAG++VSG+VDQSD SFL +EQM+ GYVLTCV+YPTS+ VI THKE
Sbjct  93   IELPYSCRAGACSTCAGQLVSGSVDQSDGSFLSEEQMEKGYVLTCVSYPTSDSVIRTHKE  152



>pdb|3W5U|B Chain B, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5U|D Chain D, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5U|F Chain F, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5U|H Chain H, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
Length=98

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -3

Query  393  ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYscragscsscaGKVVSGTVDQSD  214
            A+Y VKL+TP G+ E   PDDVY+LDQAEE G DLPYSCRAGSCSSCAGKVVSG+VDQ D
Sbjct  1    ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQCD  60

Query  213  NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             S+LDD Q+  G+VLTC AYPTS+VVIETHKE
Sbjct  61   QSYLDDGQIADGWVLTCHAYPTSDVVIETHKE  92



>gb|KJB54269.1| hypothetical protein B456_009G085400 [Gossypium raimondii]
 gb|KJB54270.1| hypothetical protein B456_009G085400 [Gossypium raimondii]
Length=150

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 91/120 (76%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELG  298
            GS+++IS       GLK  +  R T MA+YK+KLV   G+  EF+ PDD Y+LD AEE G
Sbjct  32   GSVKSISK----SFGLKCSSNFR-TSMATYKIKLVGTKGEVNEFEAPDDKYILDAAEEAG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             +LPYSCRAG+C +CAGK++SG+VDQSD SFLDD+QM+ GY+LTCVAYPTS+  I THKE
Sbjct  87   VELPYSCRAGACCTCAGKMISGSVDQSDGSFLDDKQMEEGYLLTCVAYPTSDCEIHTHKE  146



>ref|XP_002312819.1| ferredoxin family protein [Populus trichocarpa]
 gb|EEE86774.1| ferredoxin family protein [Populus trichocarpa]
Length=150

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 6/120 (5%)
 Frame = -3

Query  474  GSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELG  298
            GS+R++S       GLK     + + MA YKVKL+TP G + EF+ PDDVY+LD AE  G
Sbjct  32   GSVRSVSK----SFGLKCSPNYKAS-MAVYKVKLITPEGTEHEFEAPDDVYILDAAENAG  86

Query  297  ADLPYscragscsscaGKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE  118
             DLPYSCRAG+CS+CAGK  SG+VDQSD SFLD+ QM  GY+LTC++YPTS+ VI THKE
Sbjct  87   IDLPYSCRAGACSTCAGKAASGSVDQSDGSFLDENQMGEGYLLTCISYPTSDCVIHTHKE  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690