BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049D18

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    275   2e-86   Citrus sinensis [apfelsine]
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    275   2e-86   Citrus sinensis [apfelsine]
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   275   2e-86   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   275   2e-86   Citrus sinensis [apfelsine]
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             272   3e-86   
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    274   3e-86   Vitis vinifera
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    274   3e-86   Vitis vinifera
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             274   5e-86   Citrus clementina [clementine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             274   5e-86   Citrus clementina [clementine]
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          273   2e-85   Eucalyptus grandis [rose gum]
emb|CDP19777.1|  unnamed protein product                                272   2e-85   Coffea canephora [robusta coffee]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                273   3e-85   Morus notabilis
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   271   5e-85   Citrus sinensis [apfelsine]
ref|NP_001242098.1|  uncharacterized protein LOC100813881               271   6e-85   
ref|NP_001240201.1|  uncharacterized protein LOC100809066               271   7e-85   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    271   8e-85   
gb|ACU18529.1|  unknown                                                 270   1e-84   Glycine max [soybeans]
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    270   1e-84   Populus euphratica
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    270   1e-84   Nicotiana tomentosiformis
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    270   1e-84   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    270   1e-84   
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   270   1e-84   Citrus sinensis [apfelsine]
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    269   2e-84   
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    269   2e-84   
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    270   2e-84   Glycine max [soybeans]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             269   3e-84   
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    271   5e-84   Glycine max [soybeans]
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     269   5e-84   Glycine soja [wild soybean]
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    271   6e-84   
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               268   1e-83   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     268   2e-83   Glycine soja [wild soybean]
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               261   2e-83   Gossypium arboreum [tree cotton]
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          268   2e-83   
gb|KJB80000.1|  hypothetical protein B456_013G076800                    266   3e-83   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    266   3e-83   Gossypium raimondii
gb|EPS71284.1|  hypothetical protein M569_03474                         265   7e-83   Genlisea aurea
gb|KJB79994.1|  hypothetical protein B456_013G076500                    265   7e-83   Gossypium raimondii
gb|KJB80004.1|  hypothetical protein B456_013G076900                    265   9e-83   Gossypium raimondii
gb|KJB80005.1|  hypothetical protein B456_013G076900                    265   1e-82   Gossypium raimondii
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    265   1e-82   Cicer arietinum [garbanzo]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    263   2e-82   Gossypium raimondii
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    264   2e-82   Nicotiana sylvestris
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          264   3e-82   
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    263   4e-82   Nicotiana sylvestris
gb|KJB79995.1|  hypothetical protein B456_013G076600                    263   4e-82   Gossypium raimondii
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               263   8e-82   Solanum lycopersicum
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         262   8e-82   Jatropha curcas
gb|AFK43607.1|  unknown                                                 257   9e-82   Lotus japonicus
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             261   1e-81   
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             262   2e-81   
ref|XP_002516727.1|  uv excision repair protein rad23, putative         261   3e-81   Ricinus communis
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   261   4e-81   Citrus sinensis [apfelsine]
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          261   4e-81   Sesamum indicum [beniseed]
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                260   6e-81   Erythranthe guttata [common monkey flower]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          261   6e-81   Tarenaya hassleriana [spider flower]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    263   1e-80   
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          259   1e-80   Populus euphratica
ref|XP_002529115.1|  uv excision repair protein rad23, putative         260   1e-80   Ricinus communis
gb|ABD96960.1|  hypothetical protein                                    261   1e-80   Tarenaya spinosa
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               258   3e-80   Prunus mume [ume]
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             258   4e-80   Prunus persica
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          258   5e-80   Sesamum indicum [beniseed]
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   259   5e-80   Citrus sinensis [apfelsine]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    258   6e-80   Nelumbo nucifera [Indian lotus]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               258   6e-80   Pyrus x bretschneideri [bai li]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    258   7e-80   Nelumbo nucifera [Indian lotus]
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          257   1e-79   
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          256   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          256   3e-79   Citrus sinensis [apfelsine]
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          249   4e-79   Nicotiana tomentosiformis
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             256   4e-79   Phaseolus vulgaris [French bean]
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    256   5e-79   Populus euphratica
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             256   5e-79   Populus trichocarpa [western balsam poplar]
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  255   5e-79   Citrus sinensis [apfelsine]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             256   5e-79   Phaseolus vulgaris [French bean]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                257   5e-79   Erythranthe guttata [common monkey flower]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          256   6e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               255   6e-79   Nicotiana sylvestris
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             255   6e-79   Citrus clementina [clementine]
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    255   7e-79   Populus euphratica
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    254   8e-79   Populus euphratica
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    254   8e-79   Populus euphratica
ref|XP_006383464.1|  ubiquitin family protein                           254   8e-79   
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             256   9e-79   
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          256   9e-79   Camelina sativa [gold-of-pleasure]
emb|CDP02781.1|  unnamed protein product                                254   1e-78   Coffea canephora [robusta coffee]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    254   1e-78   Populus euphratica
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               255   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          253   4e-78   Amborella trichopoda
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    253   6e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                257   9e-78   
gb|KEH44233.1|  RAD23 UV excision repair family protein                 252   1e-77   Medicago truncatula
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   2e-77   Populus euphratica
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          251   2e-77   Solanum tuberosum [potatoes]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               251   2e-77   Vitis vinifera
ref|XP_002305813.1|  ubiquitin family protein                           251   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   2e-77   Populus euphratica
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    249   2e-77   Populus euphratica
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               251   2e-77   
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             251   2e-77   
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   3e-77   Nicotiana tomentosiformis
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   3e-77   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   3e-77   Populus euphratica
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    250   3e-77   Populus euphratica
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    250   4e-77   Nicotiana sylvestris
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   5e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    249   5e-77   Nicotiana sylvestris
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    251   6e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             251   6e-77   Eutrema salsugineum [saltwater cress]
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    249   6e-77   Nicotiana tomentosiformis
dbj|BAC76393.1|  RAD23-like protein                                     248   9e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             250   1e-76   Capsella rubella
ref|NP_186903.1|  UV excision repair protein RAD23C                     250   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  250   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             248   3e-76   Prunus persica
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             248   4e-76   Prunus persica
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    248   4e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB02636.1|  RAD23-like                                              248   5e-76   Solanum tuberosum [potatoes]
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        248   5e-76   Nicotiana tabacum [American tobacco]
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          247   7e-76   Phoenix dactylifera
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    247   7e-76   Solanum lycopersicum
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                247   8e-76   Erythranthe guttata [common monkey flower]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          247   8e-76   Nelumbo nucifera [Indian lotus]
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          247   9e-76   
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                246   9e-76   Erythranthe guttata [common monkey flower]
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    247   1e-75   Solanum lycopersicum
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    246   1e-75   
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    246   1e-75   
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    247   1e-75   Phoenix dactylifera
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    247   1e-75   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    247   1e-75   Fragaria vesca subsp. vesca
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    246   1e-75   Phoenix dactylifera
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    246   1e-75   Solanum lycopersicum
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          246   3e-75   Elaeis guineensis
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    247   4e-75   Phoenix dactylifera
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    247   4e-75   Phoenix dactylifera
ref|NP_001274760.1|  uncharacterized protein LOC102577665               245   5e-75   Solanum tuberosum [potatoes]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    246   5e-75   Arabis alpina [alpine rockcress]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    246   7e-75   Arabis alpina [alpine rockcress]
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    245   8e-75   Elaeis guineensis
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    244   9e-75   Tarenaya hassleriana [spider flower]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    244   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          244   4e-74   Cucumis melo [Oriental melon]
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          242   8e-74   Elaeis guineensis
emb|CDX74251.1|  BnaA03g27960D                                          242   8e-74   
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       243   1e-73   Cucumis sativus [cucumbers]
emb|CDX91998.1|  BnaC03g33000D                                          242   1e-73   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               242   1e-73   Brassica rapa
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               242   1e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    242   3e-73   
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    242   3e-73   
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    240   5e-73   Elaeis guineensis
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             239   6e-73   Capsella rubella
emb|CAA72741.1|  RAD23, isoform I                                       239   7e-73   Daucus carota [carrots]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    239   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             239   1e-72   Eutrema salsugineum [saltwater cress]
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          238   1e-72   
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             238   2e-72   
ref|NP_198663.1|  ubiquitin receptor RAD23d                             238   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    238   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    238   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          237   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          237   8e-72   
emb|CDY01661.1|  BnaC04g30910D                                          236   1e-71   
gb|AAK59766.1|  unknown protein                                         236   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               236   1e-71   Brassica rapa
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               236   1e-71   Brassica rapa
emb|CDX74522.1|  BnaA04g08670D                                          236   1e-71   
emb|CDX67404.1|  BnaA07g14440D                                          236   2e-71   
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          236   2e-71   Pyrus x bretschneideri [bai li]
emb|CDY58121.1|  BnaCnng32650D                                          236   2e-71   Brassica napus [oilseed rape]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    234   5e-71   Tarenaya hassleriana [spider flower]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    234   5e-71   Tarenaya hassleriana [spider flower]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    234   9e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    234   1e-70   Camelina sativa [gold-of-pleasure]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    233   4e-70   Arabis alpina [alpine rockcress]
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    231   5e-69   Elaeis guineensis
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          230   7e-69   
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    226   3e-67   Elaeis guineensis
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          224   9e-67   Fragaria vesca subsp. vesca
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    221   5e-66   Cicer arietinum [garbanzo]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 221   8e-66   Medicago truncatula
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    218   4e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    218   5e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    219   5e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    219   7e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    218   8e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          218   9e-65   
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    219   1e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ07072.1|  hypothetical protein OsI_29318                          219   1e-64   Oryza sativa Indica Group [Indian rice]
gb|ABK24371.1|  unknown                                                 218   2e-64   Picea sitchensis
ref|NP_001061854.1|  Os08g0430200                                       217   7e-64   
gb|ACN40029.1|  unknown                                                 216   1e-63   Picea sitchensis
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          206   2e-63   
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          212   6e-62   Oryza brachyantha
gb|AEA86337.1|  putative DNA repair protein                             204   8e-62   Solanum nigrum
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    210   2e-61   Brachypodium distachyon [annual false brome]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    210   2e-61   Brachypodium distachyon [annual false brome]
gb|AFK37577.1|  unknown                                                 208   6e-61   Lotus japonicus
gb|ACH72675.1|  RAD23                                                   209   6e-61   Pinus sylvestris var. mongolica
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          207   1e-60   Amborella trichopoda
gb|ACG32894.1|  DNA repair protein RAD23                                207   2e-60   Zea mays [maize]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               206   2e-60   Gossypium arboreum [tree cotton]
gb|KJB69952.1|  hypothetical protein B456_011G053200                    206   5e-60   Gossypium raimondii
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       206   5e-60   Brachypodium distachyon [annual false brome]
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          205   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            202   1e-59   
gb|KJB34920.1|  hypothetical protein B456_006G091100                    204   2e-59   Gossypium raimondii
ref|NP_001149140.1|  LOC100282762                                       205   2e-59   Zea mays [maize]
ref|NP_001063134.1|  Os09g0407200                                       204   3e-59   
gb|KJB69954.1|  hypothetical protein B456_011G053200                    202   3e-59   Gossypium raimondii
gb|EAZ00429.1|  hypothetical protein OsI_22453                          205   3e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    204   3e-59   Setaria italica
ref|NP_001057334.1|  Os06g0264300                                       204   4e-59   
gb|KJB34921.1|  hypothetical protein B456_006G091100                    201   4e-59   Gossypium raimondii
ref|NP_001142065.1|  uncharacterized protein LOC100274222               204   5e-59   Zea mays [maize]
ref|NP_001266655.1|  DNA repair protein RAD23                           204   5e-59   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               202   1e-58   Nicotiana tomentosiformis
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          202   1e-58   Citrus sinensis [apfelsine]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               201   2e-58   Gossypium arboreum [tree cotton]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          202   3e-58   Brachypodium distachyon [annual false brome]
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          201   3e-58   Solanum tuberosum [potatoes]
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    201   4e-58   Setaria italica
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                202   5e-58   
gb|AAB65841.1|  osRAD23                                                 201   5e-58   Oryza sativa Japonica Group [Japonica rice]
gb|EMT30328.1|  Putative DNA repair protein RAD23                       202   5e-58   
dbj|BAJ98767.1|  predicted protein                                      201   7e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    200   9e-58   Eucalyptus grandis [rose gum]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    200   9e-58   Eucalyptus grandis [rose gum]
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    200   9e-58   Eucalyptus grandis [rose gum]
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    200   1e-57   Eucalyptus grandis [rose gum]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    199   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    199   3e-57   Nicotiana tomentosiformis
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    198   3e-57   Nicotiana tomentosiformis
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               198   3e-57   Fragaria vesca subsp. vesca
gb|EMS50196.1|  putative DNA repair protein RAD23                       203   4e-57   Triticum urartu
ref|XP_002303970.1|  DNA repair protein RAD23                           197   5e-57   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          198   5e-57   Populus euphratica
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             197   6e-57   Populus trichocarpa [western balsam poplar]
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              193   8e-57   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          197   1e-56   
gb|ACF79443.1|  unknown                                                 196   2e-56   Zea mays [maize]
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          196   2e-56   Sesamum indicum [beniseed]
ref|NP_001149553.1|  LOC100283179                                       197   2e-56   Zea mays [maize]
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          196   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    196   3e-56   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               196   3e-56   
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      196   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          196   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    193   4e-56   Nicotiana sylvestris
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   4e-56   
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             196   4e-56   Prunus persica
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         195   4e-56   Jatropha curcas
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          195   5e-56   Prunus mume [ume]
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    195   6e-56   
ref|NP_565216.2|  ubiquitin receptor RAD23b                             195   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    195   8e-56   Nicotiana sylvestris
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 196   8e-56   
ref|NP_850982.1|  ubiquitin receptor RAD23b                             195   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    194   8e-56   Nicotiana sylvestris
ref|XP_002299163.1|  DNA repair protein RAD23                           194   1e-55   
gb|ABG89119.1|  Rad23-3Ai                                               194   1e-55   synthetic construct
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             194   1e-55   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             194   1e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          194   1e-55   Populus euphratica
gb|EMT27109.1|  Putative DNA repair protein RAD23                       195   1e-55   
emb|CDO98260.1|  unnamed protein product                                194   2e-55   Coffea canephora [robusta coffee]
gb|EMS61794.1|  putative DNA repair protein RAD23                       195   2e-55   Triticum urartu
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          194   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    194   2e-55   Nicotiana sylvestris
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               194   2e-55   Gossypium arboreum [tree cotton]
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    193   2e-55   Nicotiana sylvestris
emb|CBI25247.3|  unnamed protein product                                194   3e-55   Vitis vinifera
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               194   3e-55   Vitis vinifera
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              188   4e-55   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             192   6e-55   Capsella rubella
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             192   7e-55   Arabidopsis lyrata subsp. lyrata
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   192   1e-54   Citrus sinensis [apfelsine]
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    192   1e-54   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          192   1e-54   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             191   2e-54   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              192   2e-54   
dbj|BAC76389.1|  RAD23-like protein                                     191   2e-54   
ref|NP_173070.1|  DNA repair protein RAD23A                             191   2e-54   
dbj|BAC76390.1|  RAD23-like protein                                     191   2e-54   
dbj|BAC76391.1|  RAD23-like protein                                     191   2e-54   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             191   3e-54   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             192   3e-54   
gb|ACU20959.1|  unknown                                                 190   3e-54   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      190   3e-54   
ref|NP_001240038.1|  uncharacterized protein LOC100819019               190   4e-54   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               190   5e-54   
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    190   5e-54   
emb|CDX81753.1|  BnaC08g38480D                                          189   7e-54   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              189   1e-53   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      189   1e-53   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   1e-53   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   1e-53   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    189   1e-53   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      189   1e-53   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    189   2e-53   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    188   2e-53   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    188   3e-53   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             188   3e-53   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              188   4e-53   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               187   6e-53   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    187   7e-53   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          187   7e-53   
ref|XP_003637292.1|  RAD23 protein                                      182   1e-52   
gb|ACJ83410.1|  unknown                                                 179   2e-52   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          186   2e-52   
gb|AEA86336.1|  putative DNA repair protein                             180   2e-52   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             186   2e-52   
emb|CDY33351.1|  BnaC05g12320D                                          185   2e-52   
ref|XP_001763027.1|  predicted protein                                  186   3e-52   
ref|XP_003637291.1|  RAD23 protein                                      184   6e-52   
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    184   7e-52   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          184   8e-52   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    184   1e-51   
emb|CDX79333.1|  BnaC06g19700D                                          184   1e-51   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               183   2e-51   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      183   2e-51   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    183   2e-51   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    183   3e-51   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    182   5e-51   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    182   5e-51   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     182   8e-51   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                181   8e-51   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          182   9e-51   
emb|CDX67983.1|  BnaA07g20230D                                          183   9e-51   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    181   1e-50   
emb|CDY35071.1|  BnaA06g10810D                                          181   1e-50   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         180   3e-50   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    180   5e-50   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       180   6e-50   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    179   6e-50   
ref|XP_001780766.1|  predicted protein                                  178   2e-49   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    177   6e-49   
emb|CAA72742.1|  RAD23 protein, isoform II                              176   1e-48   
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               166   2e-48   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    172   3e-47   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    172   4e-47   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    172   5e-47   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   6e-47   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   7e-47   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   7e-47   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    171   9e-47   
dbj|BAK04690.1|  predicted protein                                      171   9e-47   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    172   1e-46   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    172   1e-46   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     172   2e-46   
gb|EEC72612.1|  hypothetical protein OsI_06092                          169   5e-46   
ref|NP_001046083.1|  Os02g0179300                                       169   5e-46   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    169   7e-46   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          166   6e-45   
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    159   6e-45   
dbj|BAC76395.1|  RAD23-like protein                                     165   7e-45   
ref|NP_001148810.1|  LOC100282427                                       166   8e-45   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 166   1e-44   
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          157   2e-44   
gb|AAF68123.1|AC010793_18  F20B17.8                                     164   3e-44   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          164   5e-44   
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    155   6e-44   
ref|XP_001752264.1|  predicted protein                                  152   2e-42   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          155   2e-41   
ref|NP_974181.1|  ubiquitin receptor RAD23b                             151   2e-39   
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    147   2e-38   
gb|KJB69953.1|  hypothetical protein B456_011G053200                    145   1e-37   
gb|KJB80001.1|  hypothetical protein B456_013G076800                    145   2e-37   
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    145   3e-37   
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    144   6e-37   
ref|XP_003081625.1|  Nucleotide excision repair factor NEF2, RAD2...    136   1e-34   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    137   5e-34   
emb|CEF99377.1|  UBA-like                                               137   6e-34   
dbj|BAJ97496.1|  predicted protein                                      136   2e-33   
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             134   4e-33   
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...    131   5e-32   
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          130   1e-31   
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...    129   2e-31   
gb|KGL75456.1|  UV excision repair protein RAD23 B                      129   2e-31   
gb|ACG24239.1|  hypothetical protein                                    122   4e-31   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     129   5e-31   
ref|XP_001420144.1|  predicted protein                                  128   7e-31   
ref|XP_005708114.1|  nucleotide excision repair protein                 129   7e-31   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...    129   8e-31   
gb|EPS72838.1|  hypothetical protein M569_01918                         127   9e-31   
gb|EMT03590.1|  Putative DNA repair protein RAD23-1                     125   1e-30   
ref|XP_010284737.1|  PREDICTED: UV excision repair protein RAD23 ...    123   1e-30   
emb|CAB65692.1|  Rad23 Protein                                          120   1e-30   
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...    127   2e-30   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                126   3e-30   
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...    126   4e-30   
gb|KFU98476.1|  UV excision repair protein RAD23 B                      126   5e-30   
emb|CDQ90828.1|  unnamed protein product                                125   7e-30   
emb|CDQ83149.1|  unnamed protein product                                125   7e-30   
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...    125   8e-30   
ref|XP_009958718.1|  PREDICTED: UV excision repair protein RAD23 ...    121   8e-30   
ref|XP_009977358.1|  PREDICTED: UV excision repair protein RAD23 ...    121   9e-30   
emb|CAN62701.1|  hypothetical protein VITISV_007064                     125   1e-29   
ref|XP_009886968.1|  PREDICTED: UV excision repair protein RAD23 ...    124   1e-29   
gb|KGL96224.1|  UV excision repair protein RAD23 B                      124   2e-29   
ref|XP_009819016.1|  PREDICTED: UV excision repair protein RAD23 ...    123   3e-29   
ref|XP_005062233.1|  PREDICTED: UV excision repair protein RAD23 ...    123   3e-29   
ref|XP_005428092.1|  PREDICTED: UV excision repair protein RAD23 ...    123   3e-29   
ref|XP_010208101.1|  PREDICTED: UV excision repair protein RAD23 ...    123   3e-29   
ref|XP_009873289.1|  PREDICTED: UV excision repair protein RAD23 ...    123   4e-29   
ref|XP_010125653.1|  PREDICTED: UV excision repair protein RAD23 ...    123   4e-29   
gb|KFV42406.1|  UV excision repair protein RAD23 B                      123   4e-29   
ref|XP_001366912.1|  PREDICTED: UV excision repair protein RAD23 ...    123   4e-29   
ref|XP_009475490.1|  PREDICTED: UV excision repair protein RAD23 ...    123   4e-29   
ref|XP_010161922.1|  PREDICTED: UV excision repair protein RAD23 ...    119   4e-29   
gb|KFV48041.1|  UV excision repair protein RAD23 B                      123   5e-29   
gb|KFP54135.1|  UV excision repair protein RAD23 B                      123   5e-29   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...    123   5e-29   
ref|XP_009501627.1|  PREDICTED: UV excision repair protein RAD23 ...    122   5e-29   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...    123   5e-29   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...    123   5e-29   
gb|KFP28504.1|  UV excision repair protein RAD23 B                      123   5e-29   
ref|XP_009643344.1|  PREDICTED: UV excision repair protein RAD23 ...    122   5e-29   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...    123   6e-29   
gb|KFP45297.1|  UV excision repair protein RAD23 B                      123   6e-29   
ref|XP_010143171.1|  PREDICTED: UV excision repair protein RAD23 ...    122   6e-29   
gb|KFP78669.1|  UV excision repair protein RAD23 B                      123   6e-29   
ref|XP_009096530.1|  PREDICTED: UV excision repair protein RAD23 ...    122   7e-29   
ref|XP_008639793.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    122   7e-29   
ref|XP_008921937.1|  PREDICTED: UV excision repair protein RAD23 ...    122   7e-29   
ref|XP_002432231.1|  uv excision repair protein rad23, putative         122   7e-29   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...    123   8e-29   
gb|KFQ93153.1|  UV excision repair protein RAD23 B                      123   8e-29   
gb|KFP09954.1|  UV excision repair protein RAD23 B                      122   8e-29   
gb|KFW73791.1|  UV excision repair protein RAD23 B                      122   8e-29   
ref|XP_009563003.1|  PREDICTED: UV excision repair protein RAD23 ...    122   9e-29   
ref|XP_010011187.1|  PREDICTED: UV excision repair protein RAD23 ...    122   9e-29   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     123   9e-29   
ref|XP_009284591.1|  PREDICTED: UV excision repair protein RAD23 ...    122   9e-29   
ref|XP_009964886.1|  PREDICTED: UV excision repair protein RAD23 ...    124   1e-28   
ref|XP_009704807.1|  PREDICTED: UV excision repair protein RAD23 ...    122   1e-28   
ref|XP_010403981.1|  PREDICTED: UV excision repair protein RAD23 ...    122   1e-28   
gb|KFW80798.1|  UV excision repair protein RAD23 B                      122   1e-28   
ref|XP_010403980.1|  PREDICTED: UV excision repair protein RAD23 ...    122   1e-28   
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...    122   1e-28   
ref|XP_009579770.1|  PREDICTED: UV excision repair protein RAD23 ...    121   1e-28   
gb|KFV93588.1|  UV excision repair protein RAD23 B                      119   1e-28   
gb|KFM01514.1|  UV excision repair protein RAD23 B                      122   1e-28   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...    122   1e-28   
gb|KFQ43918.1|  UV excision repair protein RAD23 B                      122   2e-28   
gb|KFO78985.1|  UV excision repair protein RAD23 B                      122   2e-28   
ref|XP_010150954.1|  PREDICTED: UV excision repair protein RAD23 ...    119   2e-28   
ref|XP_010306604.1|  PREDICTED: UV excision repair protein RAD23 ...    116   2e-28   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...    122   2e-28   
gb|KFP68145.1|  UV excision repair protein RAD23 B                      122   2e-28   
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...    122   2e-28   
ref|XP_009996457.1|  PREDICTED: UV excision repair protein RAD23 ...    121   2e-28   
ref|XP_007510263.1|  predicted protein                                  122   2e-28   
gb|KFW08178.1|  UV excision repair protein RAD23 B                      121   2e-28   
ref|XP_008938608.1|  PREDICTED: UV excision repair protein RAD23 ...    120   2e-28   
ref|XP_003739932.1|  PREDICTED: UV excision repair protein RAD23 ...    120   3e-28   
ref|XP_009685841.1|  PREDICTED: UV excision repair protein RAD23 ...    120   3e-28   
ref|XP_008495758.1|  PREDICTED: UV excision repair protein RAD23 ...    120   3e-28   
gb|KFQ29720.1|  UV excision repair protein RAD23 B                      121   3e-28   
ref|XP_010724307.1|  PREDICTED: UV excision repair protein RAD23 ...    119   3e-28   
gb|KFU90019.1|  UV excision repair protein RAD23 B                      121   3e-28   
ref|XP_009487270.1|  PREDICTED: UV excision repair protein RAD23 ...    120   3e-28   
gb|KFQ83380.1|  UV excision repair protein RAD23 B                      120   4e-28   
ref|XP_005013373.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    121   4e-28   
ref|XP_009905224.1|  PREDICTED: UV excision repair protein RAD23 ...    120   4e-28   
gb|AAQ94603.1|  RAD23 homolog B                                         120   5e-28   
gb|KFP03775.1|  UV excision repair protein RAD23 B                      120   5e-28   
gb|KFQ54436.1|  UV excision repair protein RAD23 B                      120   5e-28   
ref|NP_956858.1|  UV excision repair protein RAD23 homolog B            120   5e-28   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...    120   5e-28   
gb|KFV87804.1|  UV excision repair protein RAD23 B                      120   5e-28   
ref|XP_006677785.1|  hypothetical protein BATDEDRAFT_16317              120   5e-28   
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    120   6e-28   
gb|KFV72415.1|  UV excision repair protein RAD23 B                      120   7e-28   
ref|XP_006631678.1|  PREDICTED: UV excision repair protein RAD23 ...    120   8e-28   
gb|AFM90454.1|  UV excision repair protein RAD23-like B isoform 5       120   8e-28   
ref|NP_001279327.1|  UV excision repair protein RAD23 homolog B-like    120   9e-28   
gb|AFM90973.1|  UV excision repair protein RAD23-like protein B i...    120   9e-28   
dbj|BAM18172.1|  UV excision repair protein rad23                       117   9e-28   
ref|XP_005502851.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
ref|XP_003431168.1|  PREDICTED: UV excision repair protein RAD23 ...    115   1e-27   
ref|XP_005240425.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-27   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...    120   1e-27   
gb|AFK10816.1|  UV excision repair protein RAD23-like protein           119   1e-27   
ref|XP_007178312.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
ref|XP_006906142.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
gb|EIE84327.1|  UV excision repair protein Rad23                        119   1e-27   
ref|XP_005968716.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
ref|XP_007462497.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
ref|XP_004949424.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
ref|XP_004949423.1|  PREDICTED: UV excision repair protein RAD23 ...    120   1e-27   
ref|XP_005459515.1|  PREDICTED: UV excision repair protein RAD23 ...    118   1e-27   
ref|XP_005446959.1|  PREDICTED: UV excision repair protein RAD23 ...    119   1e-27   
emb|CAF91196.1|  unnamed protein product                                118   1e-27   
gb|EMC77210.1|  UV excision repair protein RAD23 like protein B         119   1e-27   
ref|XP_004646749.1|  PREDICTED: UV excision repair protein RAD23 ...    119   2e-27   
ref|XP_005812723.1|  PREDICTED: UV excision repair protein RAD23 ...    119   2e-27   
ref|XP_001625753.1|  predicted protein                                  119   2e-27   
ref|XP_005684333.1|  PREDICTED: UV excision repair protein RAD23 ...    119   2e-27   



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  253  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  310

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  311  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  370

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  371  LEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  252  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  309

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  310  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  369

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  370  LEVFFACNKNEELAANYLLDHMHEFED  396



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  259  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  316

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  317  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  376

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  377  LEVFFACNKNEELAANYLLDHMHEFED  403



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  258  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  315

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  316  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  375

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  376  LEVFFACNKNEELAANYLLDHMHEFED  402



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 138/145 (95%), Gaps = 1/145 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S AGGA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  190  LDLFPQGLPNV-GSGAGGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  248

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVE GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  249  RLIQEHQDDFLRLINEPVESGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALV  308

Query  385  LEVFFACNKNEELAANYLLDHMHEF  311
            LEVFFACNKNEELAANYLLDHMHEF
Sbjct  309  LEVFFACNKNEELAANYLLDHMHEF  333



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG+PN+  SN  GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  253  LDLFPQGIPNV-GSNPAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  311

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALV
Sbjct  312  RLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALV  371

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  372  LEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG+PN+  SN  GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  252  LDLFPQGIPNV-GSNPAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  310

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALV
Sbjct  311  RLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALV  370

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  371  LEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  257  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  314

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  315  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  374

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  375  LEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  313

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  314  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  373

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  374  LEVFFACNKNEELAANYLLDHMHEFED  400



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 141/147 (96%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  S A GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPSV-GSGAAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  314

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEP+EGGEGNILGQLA+SMPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  315  RLIQEHQADFLRLINEPLEGGEGNILGQLASSMPQAVTVTPEEREAIERLEAMGFDRAIV  374

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HE+ED
Sbjct  375  LEVYFACNKNEELAANYLLDHIHEYED  401



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 137/147 (93%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SN  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  245  LDLFPQGLPNL-GSNPAGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  303

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEP+EGGEGNILGQLA +MPQ +QVT EEREAI RLE MGFDRA V
Sbjct  304  RLIQEHQADFLRLINEPIEGGEGNILGQLAGAMPQTIQVTAEEREAIRRLEEMGFDRATV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  364  LEVFFACNKNEELAANYLLDHMHEFEE  390



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 141/147 (96%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  275  LDLFPQGLPNV-GSNAG-AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  332

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  333  RLIQEHQADFLRLINEPVEGGEGNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALV  392

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  393  LEVYFACNKNEELAANYLLDHMHEFDD  419



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  253  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  310

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  311  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  370

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  371  LEVFFACNKNEELAANYLLDHMHEFED  397



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  255  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  313

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  314  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGTMPQAVTVTPEERQAIERLEAMGFDRATV  373

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  374  LEVYFACNKNEELAANYLLDHMHEFDE  400



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  247  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  305

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA++MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  306  RLIQEHQVDFLRLINEPVEGGEGNILGQLASAMPQAVTVTPEERQAIERLEAMGFDRATV  365

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  366  LEVYFACNKNEELAANYLLDHMHEFDE  392



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  314

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  315  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  374

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  375  LEVYFACNKNEELAANYLLDHMHEFDE  401



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  237  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  296  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  355

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  356  LEVYFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 136/145 (94%), Gaps = 1/145 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP I  S AGGA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  235  LDLFPQGLP-IVGSGAGGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  293

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R IQEHQ DFLRLINEPVE GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  294  RFIQEHQDDFLRLINEPVESGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALV  353

Query  385  LEVFFACNKNEELAANYLLDHMHEF  311
            LEVFFACNKNEELAANYLLDHMHEF
Sbjct  354  LEVFFACNKNEELAANYLLDHMHEF  378



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  250  LNLFPQGLPSM-GSNTGGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  308

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LV
Sbjct  309  RLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLV  368

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  369  LEVFFACNKNEELAANYLLDHMHEFEE  395



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  237  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  296  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  355

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  356  LEVYFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  238  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  296

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  297  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  357  LEVYFACNKNEELAANYLLDHMHEFDE  383



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHL  569
            LDLFPQ GLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHL
Sbjct  258  LDLFPQQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHL  315

Query  568  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            MRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRAL
Sbjct  316  MRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAL  375

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  376  VLEVFFACNKNEELAANYLLDHMHEFED  403



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  232  LNLFPQGLPSM-GSNTGGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  290

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LV
Sbjct  291  RLIQEHQADFLRLINEPVEGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  351  LEVFFACNKNEELAANYLLDHMHEFEE  377



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +    GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  239  LDLFPQGLPNMGAGGGAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  299  RLIQEHQADFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEFED
Sbjct  359  LQVFFACNKNEELAANYLLDHMHEFED  385



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  314

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI++HQADFLRLINEP EGGEGNILGQ+A+ MPQAV VTPEER+AIERLEAMGFDRA+V
Sbjct  315  RLIRDHQADFLRLINEPAEGGEGNILGQMASGMPQAVTVTPEERQAIERLEAMGFDRAIV  374

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  375  LEVYFACNKNEELAANYLLDHMHEFEE  401



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHL  569
            LDLFPQ GLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHL
Sbjct  256  LDLFPQQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHL  313

Query  568  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            MRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRAL
Sbjct  314  MRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAL  373

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  374  VLEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  323  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  381

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  382  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  441

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  442  LEVYFACNKNEELAANYLLDHMHEFDE  468



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  271  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  329

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  330  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  389

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  390  LEVYFACNKNEELAANYLLDHMHEFDE  416



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   271 bits (692),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  324  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  382

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA V
Sbjct  383  RLIQEHQVDFLRLINEPVEGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATV  442

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  443  LEVYFACNKNEELAANYLLDHMHEFDE  469



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  262  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  320

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI++HQADFLRLINEP EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+V
Sbjct  321  RLIRDHQADFLRLINEPAEGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIV  380

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  381  LEVYFACNKNEELAANYLLDHMHEFEE  407



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  264  LDLFPQGLPNV-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  322

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI++HQADFLRLINEP EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+V
Sbjct  323  RLIRDHQADFLRLINEPAEGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIV  382

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  383  LEVYFACNKNEELAANYLLDHMHEFEE  409



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  77   LDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLM  135

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  136  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  195

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  196  LQVFFACNKNEELAANYLLDHMHDFQD  222



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG P++  SNAGGANTL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  288  LDLFPQGFPSV-GSNAGGANTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLV  346

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGG GNIL QLA +MPQA+QVTPEEREAIERLEAMGFDRALV
Sbjct  347  RLIQEHQADFLRLINEPVEGGAGNILEQLAGAMPQAIQVTPEEREAIERLEAMGFDRALV  406

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  407  LEVFFACNKNEELAANYLLDHIHEFEE  433



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  237  LDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLM  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  296  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  355

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  356  LQVFFACNKNEELAANYLLDHMHDFQD  382



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  239  LDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  298  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  358  LQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+ S+  GGANTLEFLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  243  LNLFPQGLPNLGSNVGGGANTLEFLRNTPQFQALRAMVQANPQILQPMLQELGKQNPQLV  302

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVEGGEG++LGQLA  MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  303  RLIQDHQADFLRLINEPVEGGEGDLLGQLAGGMPQAVTVTPEEREAIERLEAMGFDRALV  362

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH HEFED
Sbjct  363  LEVYFACNKNEELAANYLLDHGHEFED  389



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  239  LDLFPQGLPNMGASGAG-AGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  298  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  358  LQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A TL+FLRNS QFQAL+AMVQANPQILQPMLQELGKQNP+LM
Sbjct  239  LDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPNLM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  298  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  358  LQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A TL+FLRNS QFQAL+AMVQANPQILQPMLQELGKQNP+LM
Sbjct  240  LDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPNLM  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  299  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  359  LQVFFACNKNEELAANYLLDHMHDFQD  385



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPNI  S A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  254  LDLFPQGLPNI-GSGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  312

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI++HQADFLRLINEP+EGGEGN+LGQ+A  MPQAV VTPEER+AIERLEAMGFDRA+V
Sbjct  313  RLIRDHQADFLRLINEPMEGGEGNLLGQMAGGMPQAVTVTPEERQAIERLEAMGFDRAIV  372

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEF++
Sbjct  373  LEVYFACNKNEELAANYLLDHIHEFDE  399



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+L+
Sbjct  195  LDLFPQGLPNMGASGAG-AGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLV  253

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  254  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  313

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  314  LQVFFACNKNEELAANYLLDHMHDFQD  340



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  249  LNLFPQGLPSL-GSNTGGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  307

Query  565  RLIQEHQADFLRLINEPVE-GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVE GGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  L
Sbjct  308  RLIQEHQADFLRLINEPVEGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDL  367

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  368  VLEVFFACNKNEELAANYLLDHIHEFEE  395



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 139/148 (94%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN  GANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  252  LNLFPQGLPSV-GSNTAGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  310

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVEGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  L
Sbjct  311  RLIQEHQADFLRLINEPVEGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDL  370

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  371  VLEVFFACNKNEELAANYLLDHMHEFEE  398



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN GGANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  231  LNLFPQGLPSL-GSNTGGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  289

Query  565  RLIQEHQADFLRLINEPVE-GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVE GGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  L
Sbjct  290  RLIQEHQADFLRLINEPVEGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDL  349

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  350  VLEVFFACNKNEELAANYLLDHIHEFEE  377



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ +S AG A +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+L+
Sbjct  239  LDLFPQGLPNMGASGAG-AGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLV  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA V
Sbjct  298  RLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  358  LQVFFACNKNEELAANYLLDHMHDFQD  384



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN  GANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  263  LNLFPQGLPSV-GSNTAGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  321

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVEGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  L
Sbjct  322  RLIQEHQADFLRLINEPVEGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDL  381

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  382  VLEVFFACNKNEELAANYLLDHIHEFEE  409



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S+ + G  TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  239  LDLFPQGLPSMGSNASAG--TLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLM  296

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  297  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  355

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  356  LEVFFACNKNEELAANYLLDHMHEFEE  382



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   257 bits (656),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S   GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  81   LDLFPQGLPNV-GSGPAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  139

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQ+HQ DFLRLINEPVEGGEGNILGQ A A+MPQAV VTPEEREAIERLEAMGFDRA 
Sbjct  140  RLIQDHQVDFLRLINEPVEGGEGNILGQPAGAAMPQAVSVTPEEREAIERLEAMGFDRAT  199

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  200  VLEVYFACNKNEELAANYLLDHMHEFDE  227



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPNI  S A  A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  207  LDLFPQGLPNI-GSGAAEAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  265

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALV
Sbjct  266  RLIQEHQDDFLRLINEPVEGGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALV  325

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEFED
Sbjct  326  LEVYFACNKNEELAANYLLDHIHEFED  352



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPNI  S A  A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  251  LDLFPQGLPNI-GSGAAEAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  309

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALV
Sbjct  310  RLIQEHQDDFLRLINEPVEGGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALV  369

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEFED
Sbjct  370  LEVYFACNKNEELAANYLLDHIHEFED  396



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 139/147 (95%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP I S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  238  LDLFPQGLPTIGSTTSAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG +GN+LGQLA+++PQ+V VTPEEREAIERLEAMGFDRA+V
Sbjct  296  RLIQEHQADFLRLINEPVEG-DGNLLGQLASAVPQSVSVTPEEREAIERLEAMGFDRAIV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMH+FE+
Sbjct  355  LEVFFACNKNEELAANYLLDHMHDFEE  381



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 136/147 (93%), Gaps = 6/147 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A TL+FLRNSQQFQALR MVQANPQILQ    ELGKQNPHLM
Sbjct  258  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQFQALRTMVQANPQILQ----ELGKQNPHLM  311

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  312  RLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALV  371

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  372  LEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 138/147 (94%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  237  LDLFPQGLPNMGSNASAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  294

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  295  RLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALV  353

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  354  LEVFFACNKNEELAANYLLDHMHEFDD  380



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNA  A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  237  LDLFPQGLPNMGGSNAS-AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVEG EGNILGQLA +MPQ V VTPEEREAIERLEAMGFDRALV
Sbjct  296  RLIQDHQADFLRLINEPVEG-EGNILGQLAEAMPQTVNVTPEEREAIERLEAMGFDRALV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  355  LEVFFACNKNEELAANYLLDHMHEFDD  381



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S+   GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  262  LDLFPQGLPNVGSNT--GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  319

Query  565  RLIQEHQADFLRLINEPVEGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVEGGE GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRAL
Sbjct  320  RLIQEHQADFLRLINEPVEGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRAL  379

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDH+HEF++
Sbjct  380  VLEVFFACNKNEELAANYLLDHIHEFDE  407



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 139/147 (95%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN   SNAG A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  344  LDLFPQGLPNT-GSNAG-AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  401

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDR +V
Sbjct  402  RLIQEHQADFLRLINEPVEG-EGNLLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRNIV  460

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  461  LEVFFACNKNEELAANYLLDHMHEFEE  487



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPNI S  A    TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  243  LDLFPQGLPNIGSGTAE-VGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEGGEGNI G LAA+MPQ+V VTPEEREAIERL AMGFD ALV
Sbjct  302  RLIQEHQDDFLRLINEPVEGGEGNISGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALV  361

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEFED
Sbjct  362  LEVYFACNKNEELAANYLLDHIHEFED  388



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 138/150 (92%), Gaps = 3/150 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGAN---TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  575
            LDLFPQGLPN+ S  AG      TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP
Sbjct  260  LDLFPQGLPNMGSGGAGAGAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  319

Query  574  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  395
            +L+RLIQEHQ DFLRLINEPVEGGEGNI+GQLAA+MPQAV VTPEEREAIERLEAMGFDR
Sbjct  320  NLVRLIQEHQTDFLRLINEPVEGGEGNIMGQLAAAMPQAVTVTPEEREAIERLEAMGFDR  379

Query  394  ALVLEVFFACNKNEELAANYLLDHMHEFED  305
             LVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  380  GLVLEVFFACNKNEELAANYLLDHMHEFED  409



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S+   GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  290  LDLFPQGLPNVGSNT--GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  347

Query  565  RLIQEHQADFLRLINEPVEGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVEGGE GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRAL
Sbjct  348  RLIQEHQADFLRLINEPVEGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRAL  407

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDH+HEF++
Sbjct  408  VLEVFFACNKNEELAANYLLDHIHEFDE  435



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  241  LDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  299  QLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  359  LEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  241  LDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  299  QLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  359  LEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  237  LDLFPQGLPNMGSNASAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  294

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  295  RLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALV  353

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  354  LEVFFACNKNEELAANYLLDHMHEFDE  380



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 140/175 (80%), Gaps = 30/175 (17%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQ----------------------------FQ  650
            LDLFPQGLPN+  SNAG A TL+FLRNSQQ                            FQ
Sbjct  258  LDLFPQGLPNM-GSNAG-AGTLDFLRNSQQVSMMFYLFASLLFICDVFWYSYFRLLFQFQ  315

Query  649  ALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAAS  470
            ALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++
Sbjct  316  ALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASA  375

Query  469  MPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  376  MPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  430



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 134/147 (91%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S  A GA TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  246  LDLFPQGLPSMGS--AAGAGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLM  303

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALV
Sbjct  304  RLIQEHQADFLRLINEPVEGGEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDH+HEFED
Sbjct  361  LEVFFACNKNEELAANYLLDHIHEFED  387



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  247  LDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  304

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  305  QLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALV  364

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  365  LEVYFACNKNEELAANYLLDHMHEFEE  391



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 134/147 (91%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S  A GA TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  245  LDLFPQGLPSMGS--AAGAGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLM  302

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALV
Sbjct  303  RLIQEHQADFLRLINEPVEGGEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALV  359

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDH+HEFED
Sbjct  360  LEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  243  LDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  301  QLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  361  LEVYFACNKNEELAANYLLDHMHEFEE  387



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 136/148 (92%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S+   GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  238  LDLFPQGLPNVGSNT--GAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  295

Query  565  RLIQEHQADFLRLINEPVEGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVEGGE GNI  QL  +MPQA+QVTPEEREAIERLEAMGF+R L
Sbjct  296  RLIQEHQADFLRLINEPVEGGEGGNISSQLGGAMPQAIQVTPEEREAIERLEAMGFERGL  355

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  356  VLEVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  S A GA +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+
Sbjct  245  LDLFPQGLPDV-GSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLV  303

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+V
Sbjct  304  RLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  364  LEVFFACNKNEELAANYLLDHMHEFED  390



>ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis]
Length=194

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  51   LDLFPQGLPNV-GSNAGSGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  108

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  109  RLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALV  167

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  168  LEVYFACNKNEELAANYLLDHMHEFDE  194



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  + A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPNV-GAGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  314

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI++HQADFLRLINEPVEGGEGNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+V
Sbjct  315  RLIRDHQADFLRLINEPVEGGEGNILGQLAGGMPQAVSVTAEERQAIERLEAMGFDRAIV  374

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEF++
Sbjct  375  LEVYFACNKNEELAANYLLDHIHEFDE  401



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  313

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  314  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  372

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  373  LEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  256  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  313

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  314  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  372

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  373  LEVFFACNKNEELAANYLLDHMHEFDE  399



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  S A GA +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+
Sbjct  222  LDLFPQGLPDV-GSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLV  280

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+V
Sbjct  281  RLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIV  340

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  341  LEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  + A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  254  LDLFPQGLPNV-GAGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  312

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI++HQADFLRLINEPVEGGEGNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+V
Sbjct  313  RLIRDHQADFLRLINEPVEGGEGNILGQLAGGMPQAVTVTAEERQAIERLEAMGFDRAIV  372

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEF++
Sbjct  373  LEVYFACNKNEELAANYLLDHIHEFDE  399



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  SNAGG N L+FLRNSQQFQALRA+VQANPQILQPMLQELGKQNP L+
Sbjct  300  LDLFPQGLPSM-GSNAGGGNNLDFLRNSQQFQALRAVVQANPQILQPMLQELGKQNPQLV  358

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVEG +GN+LGQLA +MPQ+V VT EEREAIERLEAMGFDRALV
Sbjct  359  RLIQDHQADFLRLINEPVEG-DGNVLGQLAEAMPQSVAVTAEEREAIERLEAMGFDRALV  417

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  418  LEVFFACNKNEELAANYLLDHMHEFDD  444



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  272  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  329

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+
Sbjct  330  RLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFE  389

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  390  RALVLEVFFACNKNEELAANYLLDHMHEFEE  420



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  244  LDLFPQGLPNV-GSNAGSGN-LDFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLM  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  302  RLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  361  LEVYFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  S A GA +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+
Sbjct  245  LDLFPQGLPDV-GSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLV  303

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPV+GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+V
Sbjct  304  RLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  364  LEVFFACNKNEELAANYLLDHMHEFED  390



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  255  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  312

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  313  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  371

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  372  LEVFFACNKNEELAANYLLDHMHEFDE  398



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  238  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  296  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  355  LEVFFACNKNEELAANYLLDHMHEFDE  381



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  239  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  296

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  297  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  355

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  356  LEVFFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  241  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  299  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  358  LEVFFACNKNEELAANYLLDHMHEFDE  384



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   256 bits (653),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  269  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  326

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA M  PQA+QVTPEEREAIERLEAMGFD
Sbjct  327  RLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTPEEREAIERLEAMGFD  386

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  387  RALVLEVFFACNKNEELAANYLLDHMHEFEE  417



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   256 bits (653),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  271  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  328

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+
Sbjct  329  RLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFE  388

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  389  RALVLEVFFACNKNEELAANYLLDHMHEFEE  419



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+  ++ + G  +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  244  LDLFPQGLPSGGTNASAG--SLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFD ALV
Sbjct  302  RLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDPALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  361  LEVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  221  LDLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  278

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALV
Sbjct  279  RLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALV  337

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  338  LEVFFACNKNEELAANYLLDHMHEFDE  364



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  274  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  331

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+
Sbjct  332  RLIQDHQADFLRLINEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFE  391

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  392  RALVLEVFFACNKNEELAANYLLDHMHEFEE  422



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 135/148 (91%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+    A GA TL+FLRNSQQFQALR M QANPQILQPMLQELGKQNP LM
Sbjct  244  LDLFPQGLPNM--GGAAGAGTLDFLRNSQQFQALRDMFQANPQILQPMLQELGKQNPQLM  301

Query  565  RLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINE P EG EGN+LGQLA++MPQAV VTPEEREAIERLEA+GFDRAL
Sbjct  302  RLIQEHQADFLRLINEQPAEGAEGNLLGQLASAMPQAVTVTPEEREAIERLEALGFDRAL  361

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHM+EFE+
Sbjct  362  VLEVFFACNKNEELAANYLLDHMNEFEE  389



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LD+FPQGLPN+ S   GG  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +M
Sbjct  247  LDIFPQGLPNVGSHAGGG--SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIM  304

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ +FLRLINEP EG EGN+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  305  RLIQEHQGEFLRLINEPAEGTEGNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALV  364

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEFED
Sbjct  365  LQVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S+   GA TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  405  LDLFPQGLPSMGSNV--GAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  462

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  463  RLIQEHQADFLRLINEPVEG-EGNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALV  521

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  522  LEVYFACNKNEELAANYLLDHMHEFDD  548



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 140/148 (95%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPNI  + A GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  250  LDLFPQGLPNI-GAGAAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  308

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLI++HQADFLRLINEP+EGGEG N+LGQ+AA MPQ+V VTPEER+AIERLEAMGFDRA+
Sbjct  309  RLIRDHQADFLRLINEPMEGGEGNNLLGQMAAGMPQSVTVTPEERQAIERLEAMGFDRAI  368

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  369  VLEVFFACNKNEELAANYLLDHMHEFDE  396



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  243  LDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  301  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  359

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  360  LEVYFACNKNEELAANYLLDHMHEFDE  386



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGL N   SNAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  247  LDLFPQGLTNA-GSNAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  304

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  305  RLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  364  LEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 4/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S+ + G  TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  239  LDLFPQGLPSMGSNASAG--TLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  296

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVE GEGN+LGQL  ++PQAV +TPEERE+IERLEAMGFDRALV
Sbjct  297  RLIQEHQADFLRLINEPVE-GEGNVLGQL-GTVPQAVTITPEERESIERLEAMGFDRALV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  355  LEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 137/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG  +   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  242  LDLFPQGHHST-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  299

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  300  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  359  LEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  242  LDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  299

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  300  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  359  LEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  194  LDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  251

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  252  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  310

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  311  LEVYFACNKNEELAANYLLDHMHEFDE  337



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGL N   SNAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  246  LDLFPQGLTNA-GSNAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  303

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  304  RLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALV  362

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDH+HEF++
Sbjct  363  LEVYFACNKNEELAANYLLDHLHEFDE  389



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++   GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  224  LDLFPQGLPNVGANP--GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  281

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+
Sbjct  282  RLIQDHQADFLRLINEPVEGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFE  341

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  342  RALVLEVFFACNKNEELAANYLLDHMHEFEE  372



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  240  LDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  298  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEF++
Sbjct  357  LQVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  248  LDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  305

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  306  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  364

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  365  LEVYFACNKNEELAANYLLDHMHEFDE  391



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  247  LDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  304

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  305  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  364  LEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  230  LDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLM  287

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  288  RLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIV  346

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEV+FACNKNEELAANYLLDHMHEF++
Sbjct  347  LEVYFACNKNEELAANYLLDHMHEFDE  373



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  244  LDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  302  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEF++
Sbjct  361  LQVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAGG  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +M
Sbjct  265  LDLFPQGLPNV-GSNAGGG-SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIM  322

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ +FLRLINEP EG EGN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALV
Sbjct  323  RLIQEHQGEFLRLINEPAEGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALV  382

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEFED
Sbjct  383  LQVFFACNKNEELAANYLLDHMHEFED  409



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  226  LDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  283

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  284  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  342

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEF++
Sbjct  343  LQVFFACNKNEELAANYLLDHMHEFDE  369



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAGG  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +M
Sbjct  264  LDLFPQGLPNV-GSNAGGG-SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIM  321

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ +FLRLINEP EG EGN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALV
Sbjct  322  RLIQEHQGEFLRLINEPAEGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALV  381

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEFED
Sbjct  382  LQVFFACNKNEELAANYLLDHMHEFED  408



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++   GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  268  LDLFPQGLPNVGANP--GAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  325

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+
Sbjct  326  RLIQDHQADFLRLINEPVEGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFE  385

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  386  RALVLEVFFACNKNEELAANYLLDHMHEFEE  416



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  222  LDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  279

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  280  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  338

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEF++
Sbjct  339  LQVFFACNKNEELAANYLLDHMHEFDE  365



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  189  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  246

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+
Sbjct  247  RLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFE  306

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  307  RALVLEVFFACNKNEELAANYLLDHMHEFEE  337



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  279  LNLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  336

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LG +AA +  PQA+QVTPEEREAIERLE MGFD
Sbjct  337  RLIQDHQADFLRLINEPVEGGGESGNLLGHMAAGIPQPQAIQVTPEEREAIERLEGMGFD  396

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  397  RALVLEVFFACNKNEELAANYLLDHMHEFEE  427



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  271  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  328

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+
Sbjct  329  RLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFE  388

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  389  RALVLEVFFACNKNEELAANYLLDHMHEFEE  419



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+      GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  270  LDLFPQGLPNV--GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  327

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+
Sbjct  328  RLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFE  387

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  388  RALVLEVFFACNKNEELAANYLLDHMHEFEE  418



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 137/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+ +  AG  N L+FLR+SQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  242  LNLFPQGLPNVGAGGAGAGN-LDFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPNLM  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+V
Sbjct  301  RLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  359  LEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 135/147 (92%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+ +      N L+FLR+SQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  242  LNLFPQGLPNVGAGAGAAGN-LDFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPNLM  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+V
Sbjct  301  RLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  359  LEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 134/148 (91%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LD+FPQGLPN+ S   GG  +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +M
Sbjct  247  LDIFPQGLPNVGSHAGGG--SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIM  304

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQ +FLRLINEP EG EG N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRAL
Sbjct  305  RLIQEHQGEFLRLINEPAEGTEGSNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRAL  364

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  365  VLQVFFACNKNEELAANYLLDHMHEFED  392



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 133/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SN G  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  241  LDLFPQGLPNV-GSNVGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  299  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEE+AANYLLDHMHEF++
Sbjct  358  LQVFFACNKNEEMAANYLLDHMHEFDE  384



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  244  LDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVE  EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  302  RLIQEHQADFLRLINEPVES-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEF++
Sbjct  361  LQVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  SNAG A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +M
Sbjct  240  LDLFPQGLPSM-GSNAG-AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQA+FLRL+NEP EG E ++LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  298  RLIQEHQAEFLRLLNEPTEGAESDLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  358  LEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  238  LDLFPQGLPNV-GANAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  296  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  355  LQVYFACNKNEEMAANYLLDHMHEFDE  381



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG P +  SNAGGAN L+FLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  229  LDLFPQGFPTM-GSNAGGANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLV  287

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADF+RLINEP+EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+AL
Sbjct  288  RLIQEHQADFVRLINEPIEGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQAL  347

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  348  VLEVFFACNKNEELAANYLLDHMHEFEE  375



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 6/147 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++   G  TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  243  LDLFPQGLPNVGAT--AGTGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLM  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVE GEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALV
Sbjct  301  RLIQEHQADFLRLINEPVE-GEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  357  LEVFFACNKNEELAANYLLDHIHEFEE  383



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   247 bits (630),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+ +  AG  N L+FLR SQQFQALRAMVQANPQILQPMLQELGKQNP+LM
Sbjct  241  LNLFPQGLPNVGAGGAGAGN-LDFLRGSQQFQALRAMVQANPQILQPMLQELGKQNPNLM  299

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+V
Sbjct  300  RLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  358  LEVFFACNKNEELAANYLLDHMHEFEE  384



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG P +  SNAGGAN L+FLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  230  LDLFPQGFPTM-GSNAGGANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLV  288

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADF+RLINEP+EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+AL
Sbjct  289  RLIQEHQADFVRLINEPIEGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQAL  348

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  349  VLEVFFACNKNEELAANYLLDHMHEFEE  376



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  240  LDLFPQGLPNV-GANAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  298  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  357  LQVYFACNKNEEMAANYLLDHMHEFDE  383



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S    GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +M
Sbjct  229  LDLFPQGLPNVRS----GASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVM  284

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  285  RLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALV  343

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  344  LEVFFACNKNEELAANYLLDHMHEFED  370



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S    GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +M
Sbjct  226  LDLFPQGLPNVRS----GASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVM  281

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  282  RLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALV  340

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  341  LEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S    GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +M
Sbjct  250  LDLFPQGLPNVRS----GASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVM  305

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  306  RLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALV  364

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  365  LEVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 4/151 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGG----ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  578
            LDLFPQGLPN+ ++   G       L+FLR+S QFQALRAMVQANP ILQPMLQELGKQN
Sbjct  251  LDLFPQGLPNLGAAAGAGAGTGVGDLDFLRDSPQFQALRAMVQANPHILQPMLQELGKQN  310

Query  577  PHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  398
            P L+RLIQ+HQADFLRLINEPVEGGEG++LGQL A+MPQA+ VTPEEREAIERLEAMGFD
Sbjct  311  PQLVRLIQQHQADFLRLINEPVEGGEGDVLGQLDAAMPQAITVTPEEREAIERLEAMGFD  370

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  371  RALVLEVFVACNRNEELAANYLLDHMHEFED  401



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 4/151 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGG----ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  578
            LDLFPQGLPN+ ++   G       L+FLR+S QFQALRAMVQANP ILQPMLQELGKQN
Sbjct  250  LDLFPQGLPNLGAAAGAGAGTGVGDLDFLRDSPQFQALRAMVQANPHILQPMLQELGKQN  309

Query  577  PHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  398
            P L+RLIQ+HQADFLRLINEPVEGGEG++LGQL A+MPQA+ VTPEEREAIERLEAMGFD
Sbjct  310  PQLVRLIQQHQADFLRLINEPVEGGEGDVLGQLDAAMPQAITVTPEEREAIERLEAMGFD  369

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  370  RALVLEVFVACNRNEELAANYLLDHMHEFED  400



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ S    GA++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +M
Sbjct  247  LDLFPQGLPNVRS----GASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVM  302

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI+EHQA+FLRLINEP EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  303  RLIREHQAEFLRLINEPAEG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALV  361

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  362  LEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  222  LDLFPQGLPNV-GANAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  279

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  280  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  338

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+V+FACNKNEE+AANYLLDHMHEF++
Sbjct  339  LQVYFACNKNEEMAANYLLDHMHEFDE  365



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAGG  +L+FLRNS QFQA +A+VQANPQIL+PMLQELGKQNP +M
Sbjct  247  LDLFPQGLPNM-GSNAGGG-SLDFLRNSPQFQAFKALVQANPQILRPMLQELGKQNPLVM  304

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ +FL LINEP EGGE N+LGQLAA+MPQA+ VTPEE EAIERLEAMGFDRALV
Sbjct  305  RLIQEHQDEFLCLINEPAEGGESNLLGQLAAAMPQALTVTPEECEAIERLEAMGFDRALV  364

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  365  LEVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  SNAG A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +M
Sbjct  306  LDLFPQGLPSM-GSNAG-AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVM  363

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  364  RLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALV  423

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  424  LEVFFACNKNEELAANYLLDHMHEFED  450



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  SNAG A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +M
Sbjct  307  LDLFPQGLPSM-GSNAG-AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVM  364

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  365  RLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALV  424

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  425  LEVFFACNKNEELAANYLLDHMHEFED  451



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SN G  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  239  LDLFPQGLPNV-GSNVGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLM  296

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  297  RLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALV  355

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFAC KNEE+AANYLLDHMHEF++
Sbjct  356  LQVFFACXKNEEMAANYLLDHMHEFDE  382



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++ + G  TL+FLRNSQQFQ LRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  277  LDLFPQGLPNVGANPSAG--TLDFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLM  334

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+
Sbjct  335  RLIQDHQADFLRLINEPVEGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFE  394

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNK+EELAANYLLDH+HEFE+
Sbjct  395  RALVLEVFFACNKDEELAANYLLDHIHEFEE  425



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 138/151 (91%), Gaps = 6/151 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++ + G  TL+FLRNSQQFQ LRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  287  LDLFPQGLPNVGANPSAG--TLDFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLM  344

Query  565  RLIQEHQADFLRLINEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFD  398
            RLIQ+HQADFLRLINEPVEGG   GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+
Sbjct  345  RLIQDHQADFLRLINEPVEGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFE  404

Query  397  RALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RALVLEVFFACNK+EELAANYLLDH+HEFE+
Sbjct  405  RALVLEVFFACNKDEELAANYLLDHIHEFEE  435



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S+ + G  +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +M
Sbjct  251  LDLFPQGLPSMGSNASAG--SLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVM  308

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  309  RLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALV  368

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  369  LEVFFACNKNEELAANYLLDHMHEFED  395



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  243  LNLFPQGLPT--AGADAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  301  RLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALV  359

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDH+HEFED
Sbjct  360  LEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  240  LNLFPQGLPT--AGADAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALV
Sbjct  298  RLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDH+HEFED
Sbjct  357  LEVFFACNKNEELAANYLLDHIHEFED  383



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 2/146 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPNI  S A G+ +L+FLRNS QFQALRAMV+ANPQILQPMLQELGKQNP L+
Sbjct  275  LDLFPQGLPNI-GSGAVGSGSLDFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLI  333

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV
Sbjct  334  RLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLV  392

Query  385  LEVFFACNKNEELAANYLLDHMHEFE  308
            +EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  393  VEVFFACNKNEEMAANYLLDHIHEFE  418



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++ S+ + G  +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +M
Sbjct  240  LDLFPQGLPSMGSNASAG--SLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVM  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQA+FLRL+NEP EG E ++LGQ A+ MPQA+ VTPEEREAIERLEAMGFDRALV
Sbjct  298  RLIQEHQAEFLRLLNEPAEGAESDLLGQFASPMPQALTVTPEEREAIERLEAMGFDRALV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  358  LEVFFACNKNEELAANYLLDHMHEFED  384



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 5/149 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++  GG  TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  256  LDLFPQGLPNVGANPGGG--TLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  313

Query  565  RLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            RLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RA
Sbjct  314  RLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERA  372

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED  305
            LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  373  LVLEVFFACNKNEELAANYLLDHMHEFEE  401



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 2/146 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  S A G+ +L+FLRNS QFQALRAMV+ANPQILQPMLQELGKQNP L+
Sbjct  273  LDLFPQGLPNL-GSGAVGSGSLDFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLI  331

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV
Sbjct  332  RLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLV  390

Query  385  LEVFFACNKNEELAANYLLDHMHEFE  308
            +EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  391  VEVFFACNKNEEMAANYLLDHIHEFE  416



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 5/149 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++  GG  TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  258  LDLFPQGLPNVGANPGGG--TLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  315

Query  565  RLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            RLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RA
Sbjct  316  RLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERA  374

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED  305
            LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  375  LVLEVFFACNKNEELAANYLLDHMHEFEE  403



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 5/149 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+ ++  GG  TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LM
Sbjct  256  LDLFPQGLPNVGANPGGG--TLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLM  313

Query  565  RLIQEHQADFLRLINEPVEGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            RLIQEHQADFLRLINEPVEGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RA
Sbjct  314  RLIQEHQADFLRLINEPVEGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERA  372

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED  305
            LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  373  LVLEVFFACNKNEELAANYLLDHMHEFEE  401



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 133/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  SNAG A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  259  LDLFPQGLPNV-GSNAG-AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  316

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINEPVE GEGN+L QL ++MP +V VTPEEREAIERLE MGF RA V
Sbjct  317  RLIQDHQADFLRLINEPVE-GEGNLLSQLTSAMPASVSVTPEEREAIERLEGMGFRRATV  375

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+V+FACNKNEELAANYLLDHM EFE+
Sbjct  376  LQVYFACNKNEELAANYLLDHMDEFEN  402



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHL  569
            LDLFPQ GLP++  SNAG A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +
Sbjct  306  LDLFPQQGLPSM-GSNAG-AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQV  363

Query  568  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRAL
Sbjct  364  MRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRAL  423

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  424  VLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHL  569
            LDLFPQ GLP++  SNAG A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +
Sbjct  307  LDLFPQQGLPSM-GSNAG-AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQV  364

Query  568  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            MRLIQ+HQA+FLRL+NEP EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRAL
Sbjct  365  MRLIQDHQAEFLRLLNEPAEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRAL  424

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  425  VLEVFFACNKNEELAANYLLDHMHEFED  452



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHL  569
            LDLFPQ GLP++ S+ + G  +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +
Sbjct  251  LDLFPQQGLPSMGSNASAG--SLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQV  308

Query  568  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRAL
Sbjct  309  MRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRAL  368

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  369  VLEVFFACNKNEELAANYLLDHMHEFED  396



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  241  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  298

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  299  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  358  LEVFFACNKNEELAANYLLDHMHEFED  384



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 6/146 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  SNA GA  L+FLR +QQFQALRAMVQ+NPQILQPMLQELGKQNPHLM
Sbjct  243  LDLFPQGLPDM-GSNAAGAGNLDFLRTNQQFQALRAMVQSNPQILQPMLQELGKQNPHLM  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFL+LINEP+EGGE N+LG      PQA+ VTPEER+AIERLEAMGFDR LV
Sbjct  302  RLIQEHQADFLQLINEPMEGGE-NLLGH----GPQAISVTPEERDAIERLEAMGFDRELV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFE  308
            LEVFFACNKNEELAANYLLDHMHEFE
Sbjct  357  LEVFFACNKNEELAANYLLDHMHEFE  382



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  233  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  290

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  291  RLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  349

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  350  LEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  245  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  302

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  303  RLIQEHQADFLRLINEPVEGEE-NVIEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  361

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  362  LEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+    AGGA  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+
Sbjct  237  LNLFPQGLPNV---GAGGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLV  293

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF RA+V
Sbjct  294  RLIGTHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFARAIV  351

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEFED
Sbjct  352  LQVFFACNKNEELAANYLLDHMHEFED  378



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +  A GA  L+FLRNSQ+FQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  233  LNLFPQGMPA--ADAAAGAGNLDFLRNSQKFQALRAMVQANPQILQPMLQELGKQNPQLV  290

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  291  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  349

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  350  LEVFFACNKNEELAANYLLDHMHEFED  376



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  234  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  291

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+V
Sbjct  292  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  351  LEVFFACNKNEELAANYLLDHMHEFED  377



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  232  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  289

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  290  RLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  348

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  349  LEVFFACNKNEELAANYLLDHMHEFED  375



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  230  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  287

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  288  RLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  346

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  347  LEVFFACNKNEELAANYLLDHMHEFED  373



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+    AGGA  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+
Sbjct  243  LNLFPQGLPNM---GAGGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLV  299

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF RA+V
Sbjct  300  RLIGAHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFARAIV  357

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEELAANYLLDHMHEFED
Sbjct  358  LQVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 3/148 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  SNAGG  +L+FL+NS QF+AL+A+VQANPQ LQPMLQELGKQNP ++
Sbjct  246  LDLFPQGLPDV-GSNAGGG-SLDFLQNSPQFRALQALVQANPQFLQPMLQELGKQNPQIL  303

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQ +FLRLINEP EG EG NILGQL   MPQA+ VTPEE EAIERLEAMGFDRAL
Sbjct  304  RLIQEHQGEFLRLINEPAEGTEGGNILGQLPTGMPQALSVTPEEHEAIERLEAMGFDRAL  363

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  364  VLQVFFACNKNEELAANYLLDHMHEFED  391



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  234  LDLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  291

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  292  RLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  351  LEVFFACNKNEELAANYLLDHMHEFEE  377



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  234  LNLFPQGMPA--ADAGAGAGNLDFLRNSHQFQALRAMVQANPQILQPMLQELGKQNPQLV  291

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+V
Sbjct  292  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  351  LEVFFACNKNEELAANYLLDHMHEFED  377



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  238  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  296  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  355  LEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  234  LDLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  291

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  292  RLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  351  LEVFFACNKNEELAANYLLDHMHEFEE  377



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  236  LDLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  293

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  294  RLIQEHQADFLRLINEPVEGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  352

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  353  LEVFFACNKNEELAANYLLDHMHEFEE  379



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  238  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  295

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  296  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  354

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  355  LEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ LPN+    AG A  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+
Sbjct  242  LNLFPQELPNV-GVGAGAAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLV  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLI EHQADFLRLINEP EGGEGN+LG   A++PQA+ ++PEEREAIERLEAMGF RA+V
Sbjct  301  RLIGEHQADFLRLINEPAEGGEGNVLGD--AAVPQAIAISPEEREAIERLEAMGFARAIV  358

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            L+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  359  LQVFFACNKNEELTANYLLDHMHEFED  385



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  240  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  297

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  298  RLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  356

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  357  LEVFFACNKNEELAANYLLDHMHEFEE  383



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 129/147 (88%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP     +  GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  234  LNLFPQGLPTTGMDD--GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  291

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINE  EG E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + 
Sbjct  292  RLIQDHQADFLRLINEQGEGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIA  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVF ACNKNEELAANYLLDH+HEFED
Sbjct  351  LEVFIACNKNEELAANYLLDHIHEFED  377



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 129/147 (88%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP     +  GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LM
Sbjct  235  LNLFPQGLPTTGMDD--GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLM  292

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQADFLRLINE  EG E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + 
Sbjct  293  RLIQDHQADFLRLINEQGEGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIA  351

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVF ACNKNEELAANYLLDH+HEFED
Sbjct  352  LEVFIACNKNEELAANYLLDHIHEFED  378



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQF+ALR MVQANPQILQPMLQELGKQNP L+
Sbjct  237  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLV  294

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  295  RLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  353

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  354  LEVFFACNKNEELAANYLLDHMHEFED  380



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQF+ALR MVQANPQILQPMLQELGKQNP L+
Sbjct  235  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLV  292

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ DFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+V
Sbjct  293  RLIQEHQTDFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMV  351

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEFED
Sbjct  352  LEVFFACNKNEELAANYLLDHMHEFED  378



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+
Sbjct  248  LNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLV  305

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQADFLRLINEPVE GE N++ QL A+MPQAV VTPEEREAIERLEAMGF+RA+V
Sbjct  306  RLIQEHQADFLRLINEPVE-GEENVIEQLEAAMPQAVTVTPEEREAIERLEAMGFERAMV  364

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNEELAANYLLDHMHEF++
Sbjct  365  LEVFFACNKNEELAANYLLDHMHEFDE  391



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 134/173 (77%), Gaps = 28/173 (16%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQ--------------  608
            LDLFPQGLP++ S+ + G  +L+FLRNS QF+AL+ +VQANPQILQ              
Sbjct  251  LDLFPQGLPSMGSNASAG--SLDFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLY  308

Query  607  ------------PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMP  464
                        PMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MP
Sbjct  309  FSLTLFSIFFSQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMP  368

Query  463  QAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            QA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  369  QALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  421



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 3/146 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  245  LDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLM  302

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV
Sbjct  303  QLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALV  362

Query  385  LEVFFACNKNEELAA-NYLLDHMHEF  311
             EV+FACNKNEELA+  +L    H+F
Sbjct  363  PEVYFACNKNEELASIPFLCLGWHKF  388



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 134/174 (77%), Gaps = 29/174 (17%)
 Frame = -2

Query  745  LDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQ-------------  608
            LDLFPQ GLP++ S+ + G  +L+FLRNS QF+AL+ +VQANPQILQ             
Sbjct  251  LDLFPQQGLPSMGSNASAG--SLDFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLL  308

Query  607  -------------PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASM  467
                         PMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +M
Sbjct  309  YFSLTLFSIFFSQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAM  368

Query  466  PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            PQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  369  PQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  422



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQGLP++  +NAG  N L+FLRNS QFQALR MVQANPQILQPML ELGKQNPHLM
Sbjct  244  LDLFPQGLPSV-GANAGAGN-LDFLRNSPQFQALRTMVQANPQILQPMLLELGKQNPHLM  301

Query  565  RLIQEHQADFLRLINEPV--EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            +LIQ HQADFLRLINEPV   G    +    +A+MPQAV VTPEEREAIERLEAMGF+RA
Sbjct  302  QLIQAHQADFLRLINEPVEGGGEGNLLGQLGSAAMPQAVTVTPEEREAIERLEAMGFERA  361

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED  305
            LVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  362  LVLEVYFACNKNEELAANYLLDHMHEFEE  390



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 4/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFP+G+PN+ +++  G   LEFLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM
Sbjct  235  LNLFPEGIPNLGANDNAG--DLEFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLM  292

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
             LIQEHQADFLRLINEP  GGE N+  QL A++PQ + +TPEE EAI+RLE MGFDR LV
Sbjct  293  ELIQEHQADFLRLINEP--GGEENLESQLGAAVPQTITITPEEHEAIQRLEDMGFDRDLV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  351  LEVFFACNKNEDLAANYLLDHQNEFDD  377



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 4/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+PN+ ++   G   LEFLRNSQQFQALR MVQANPQILQPMLQELGKQNP+LM
Sbjct  228  LNLFPQGIPNLGANENAG--DLEFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPNLM  285

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
             LIQEHQADFLRLINEP  GGE N+ GQL A  PQ + +TPEE EAI+RLE MGFDR LV
Sbjct  286  ELIQEHQADFLRLINEP--GGEENLEGQLGALAPQTITITPEENEAIQRLEDMGFDRDLV  343

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  344  LEVFFACNKNEDLAANYLLDHQNEFDD  370



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  730  QGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  551
             GL N+  S+A  +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQE
Sbjct  216  SGLLNV-GSDAAPSGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQE  274

Query  550  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  371
            HQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++F
Sbjct  275  HQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYF  334

Query  370  ACNKNEELAANYLLDHMHEF  311
            ACNKNEEL ANYLLDHMHEF
Sbjct  335  ACNKNEELTANYLLDHMHEF  354



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  730  QGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  551
             GL N+  S+A  +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQE
Sbjct  219  SGLLNV-GSDAAPSGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQE  277

Query  550  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  371
            HQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++F
Sbjct  278  HQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYF  337

Query  370  ACNKNEELAANYLLDHMHEF  311
            ACNKNEEL ANYLLDHMHEF
Sbjct  338  ACNKNEELTANYLLDHMHEF  357



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  730  QGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  551
             GL N+  S+A  +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQE
Sbjct  235  SGLLNV-GSDAAPSGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQE  293

Query  550  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  371
            HQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++F
Sbjct  294  HQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYF  353

Query  370  ACNKNEELAANYLLDHMHEF  311
            ACNKNEEL ANYLLDHMHEF
Sbjct  354  ACNKNEELTANYLLDHMHEF  373



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  730  QGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  551
             GL N+  S+A  +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQE
Sbjct  254  SGLLNV-GSDAAPSGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQE  312

Query  550  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  371
            HQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++F
Sbjct  313  HQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYF  372

Query  370  ACNKNEELAANYLLDHMHEF  311
            ACNKNEEL ANYLLDHMHEF
Sbjct  373  ACNKNEELTANYLLDHMHEF  392



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  730  QGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  551
             GL N+  S+A  +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQE
Sbjct  238  SGLLNV-GSDAAPSGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQE  296

Query  550  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  371
            HQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++F
Sbjct  297  HQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYF  356

Query  370  ACNKNEELAANYLLDHMHEF  311
            ACNKNEEL ANYLLDHMHEF
Sbjct  357  ACNKNEELTANYLLDHMHEF  376



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 2/126 (2%)
 Frame = -2

Query  682  LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG  503
            L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP EGG
Sbjct  236  LDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGG  295

Query  502  EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH  323
            EGN LG   A++PQA+ +TPEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDH
Sbjct  296  EGNALGD--AAVPQAIAITPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYLLDH  353

Query  322  MHEFED  305
            MHEFED
Sbjct  354  MHEFED  359



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -2

Query  730  QGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  551
             GL N+  S+A  +  L+FLRNS+QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQE
Sbjct  257  SGLLNV-GSDAAPSGALDFLRNSEQFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQE  315

Query  550  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  371
            HQ +F +L+NEPVEG EGN+LGQLA +MPQA+QVTPEE   IERLEAMGF+R+ VLE++F
Sbjct  316  HQTEFDQLLNEPVEGKEGNLLGQLAGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYF  375

Query  370  ACNKNEELAANYLLDHMHEF  311
            ACNKNEEL ANYLLDHMHEF
Sbjct  376  ACNKNEELTANYLLDHMHEF  395



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NAGG N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP ++
Sbjct  255  LDLFPQVLPNA-SANAGGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQIL  312

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQE+QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LV
Sbjct  313  QLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLV  372

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  373  LEVFFACNKDEQLAANYLLDHMNEFDD  399



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+ ++  GGA  L+FLRN+ QFQALR MVQANPQILQPMLQEL KQNP LM
Sbjct  249  LNLFPQGLPNLGATAGGGA--LDFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLM  306

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQA+FL LINE  EG   ++LGQ AA MPQ++ VTPEEREAIERLEAMGFDRALV
Sbjct  307  RLIQDHQAEFLHLINEETEG---DLLGQFAAEMPQSINVTPEEREAIERLEAMGFDRALV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC+KNEELAANYLL+H  ++ED
Sbjct  364  IEAFLACDKNEELAANYLLEHAADYED  390



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NAGG N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP ++
Sbjct  255  LDLFPQVLPNA-SANAGGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQIL  312

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQE+QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LV
Sbjct  313  QLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLV  372

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNK+E LAANYLLDHM+EF+D
Sbjct  373  LEVFFACNKDELLAANYLLDHMNEFDD  399



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 125/161 (78%), Gaps = 14/161 (9%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTL--------------EFLRNSQQFQALRAMVQANPQILQ  608
            LDLFPQGLPN+ +    GA                 +FLRN+ QFQALR MVQANPQILQ
Sbjct  243  LDLFPQGLPNLGAGAGAGAGAGLGAGAGAGAGAGALDFLRNNPQFQALRTMVQANPQILQ  302

Query  607  PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREA  428
            PMLQEL KQNP LMRLIQ+HQADFLRL+NEPVEG EG+   QLA +MPQA+ VTPEEREA
Sbjct  303  PMLQELSKQNPQLMRLIQDHQADFLRLVNEPVEGAEGDFFNQLAGAMPQAINVTPEEREA  362

Query  427  IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            IERLEAMGFDRALV+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  363  IERLEAMGFDRALVIEAFLACDKNEQLAANYLLEHAGDYED  403



>ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=111

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  637  MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQA  458
            MVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQA
Sbjct  1    MVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQA  60

Query  457  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            V VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  61   VTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  111



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+P+  ++   GA  L+ LR   QFQAL A+VQANPQILQPMLQELGKQNP ++
Sbjct  260  LNLFPQGVPSAGANPGAGAGALDALRQLPQFQALLALVQANPQILQPMLQELGKQNPQIL  319

Query  565  RLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQE+QA+FLRL+NE P  G  GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R L
Sbjct  320  RLIQENQAEFLRLVNESPDSGTGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNREL  379

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEVFFACNK+EELAANYLLDH HEFED
Sbjct  380  VLEVFFACNKDEELAANYLLDHGHEFED  407



>gb|AEA86337.1| putative DNA repair protein [Solanum nigrum]
Length=166

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 112/121 (93%), Gaps = 2/121 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLP++  SN  GANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  47   LNLFPQGLPSV-GSNTAGANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  105

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            RLIQEHQADFLRLINEPVEGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  L
Sbjct  106  RLIQEHQADFLRLINEPVEGGEGTNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDL  165

Query  388  V  386
            V
Sbjct  166  V  166



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NA G N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP ++
Sbjct  243  LDLFPQVLPNA-SANAAGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQIL  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQE+QA+FLRLINEP EG EGN+L Q  A +PQ V VTP E EAI+RLE MGFDR LV
Sbjct  301  QLIQENQAEFLRLINEPAEGAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  361  LEVFFACNKDEQLAANYLLDHMNEFDD  387



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NA G N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP ++
Sbjct  244  LDLFPQVLPNA-SANAAGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQIL  301

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQE+QA+FLRLINEP EG EGN+L Q  A +PQ V VTP E EAI+RLE MGFDR LV
Sbjct  302  QLIQENQAEFLRLINEPAEGAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLV  361

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVFFACNK+E+LAANYLLDHM+EF+D
Sbjct  362  LEVFFACNKDEQLAANYLLDHMNEFDD  388



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 123/147 (84%), Gaps = 7/147 (5%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQG+PN+ + +  G   L+FLRN+QQFQALRAMVQANPQILQPMLQELGKQNPHLM
Sbjct  237  LNLFPQGIPNMGAEDNAG--DLDFLRNNQQFQALRAMVQANPQILQPMLQELGKQNPHLM  294

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            +LIQEHQ+DFL LINEP EG E      LAA M QA+ VTPEE EAI+RLE MGFDR LV
Sbjct  295  QLIQEHQSDFLNLINEP-EGEE----NPLAAGMTQAITVTPEEDEAIQRLEDMGFDRDLV  349

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            LEVF ACN+NE+LAANYLLDH +EF+D
Sbjct  350  LEVFIACNRNEDLAANYLLDHQNEFDD  376



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 5/147 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQGLPN+ ++       L+FLRN+ QFQALR MVQANPQILQPMLQEL KQNP LM
Sbjct  249  LNLFPQGLPNLGAAAG--GGALDFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQLM  306

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+HQA+FL LINE  +G   ++LGQ AA MPQ++ VTPEEREAIERLEAMGFDRALV
Sbjct  307  RLIQDHQAEFLHLINEETDG---DLLGQFAAEMPQSINVTPEEREAIERLEAMGFDRALV  363

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC+KNEELAANYLL+H  ++ED
Sbjct  364  IEAFLACDKNEELAANYLLEHAADYED  390



>ref|XP_006845449.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQG P   S    G  +L+FLRN++QFQ LR MVQANPQILQPMLQEL KQNP L+
Sbjct  226  LNMFPQGSPT--SGAIAGGGSLDFLRNNEQFQTLRHMVQANPQILQPMLQELSKQNPQLL  283

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQA+FL+LINEP EG EG++ GQ    MPQ++ VTPEEREAIERLEAMGFDRALV
Sbjct  284  RLIQEHQAEFLQLINEPAEGAEGDLFGQAEQDMPQSITVTPEEREAIERLEAMGFDRALV  343

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELA NYLL++  ++ED
Sbjct  344  IEAFLACDRNEELAINYLLENPGDYED  370



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 11/155 (7%)
 Frame = -2

Query  745  LDLFPQGLPN-------IPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELG  587
            L+LFPQG+P+       +P   A G+  L+ LR   QFQAL  +VQANPQILQPMLQELG
Sbjct  248  LNLFPQGVPSGGANPGVVP---AAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELG  304

Query  586  KQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEA  410
            KQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE 
Sbjct  305  KQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEG  364

Query  409  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            MGF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  365  MGFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AGG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  218  LNMFPQ--ETLSGAAAGGDGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  275

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP+EG EG+I  Q    MP AV VTP E+EAIERLEAMGFDRALV
Sbjct  276  RLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAVNVTPAEQEAIERLEAMGFDRALV  335

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  336  IEAFLACDRNEELAANYLLENGGDFED  362



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AGG  +L+FLRN+QQFQALR MVQ+NPQILQPMLQELGKQNP L+
Sbjct  218  LNMFPQ--ETLSGAAAGGDGSLDFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLL  275

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  276  RLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALV  335

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  336  IEAFLACDRNEELAANYLLENGGDFED  362



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NA G   L+ LRN+ QF++L ++VQANPQILQP+LQELGKQNP ++
Sbjct  245  LDLFPQALPNA-SANAAGEGNLDVLRNNAQFRSLLSLVQANPQILQPLLQELGKQNPQIL  303

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            +LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE EAI RLE MGFDRAL
Sbjct  304  QLIQDNQAEFLRLINEPAEGDEDENLLDQFAEGVPQTIAVTPEENEAILRLEGMGFDRAL  363

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  364  VLEVYFACNKDETLAANYLLDHMNEFDD  391



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N PS+ AGG  +L+FLRNSQQFQALR+MVQANPQILQPMLQEL KQNP L+
Sbjct  235  LNLFPQETLN-PSAAAGG--SLDFLRNSQQFQALRSMVQANPQILQPMLQELSKQNPQLL  291

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  292  RLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALV  351

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELA NYLL++  +FED
Sbjct  352  IEAFLACDRNEELAVNYLLENAGDFED  378



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AGG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  157  LNMFPQE--TLSGAPAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  214

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQ +FL+LINEPV+G EG++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV
Sbjct  215  RLIQEHQTEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALV  274

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  275  IEAFLACDRNEELAANYLLENAGDFED  301



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AGG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  229  LNMFPQ--ETLSGAAAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  286

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  287  RLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALV  346

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  347  IEAFLACDRNEELAANYLLENSGDFED  373



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 11/155 (7%)
 Frame = -2

Query  745  LDLFPQGLPN-------IPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELG  587
            L+LFPQG+P+       +P   A G+  L+ LR   QFQAL  +VQANPQILQPMLQELG
Sbjct  248  LNLFPQGVPSGGANPGVVP---AAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELG  304

Query  586  KQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEA  410
            KQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE 
Sbjct  305  KQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEG  364

Query  409  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            MGF+  LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  365  MGFNHELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S++A G   L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP ++
Sbjct  242  LDLFPQALPNA-STDAAGLGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQNPQIL  300

Query  565  RLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            +LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLEAMGFDRAL
Sbjct  301  QLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEENEAILRLEAMGFDRAL  360

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VL+VFFACNK+E+LAANYLLDHM+EF+D
Sbjct  361  VLDVFFACNKDEQLAANYLLDHMNEFDD  388



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  700  AGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLIN  521
            AGG  +L+FLRN+QQFQALR MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LIN
Sbjct  186  AGGDGSLDFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLIN  245

Query  520  EPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  341
            EP+EG EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAA
Sbjct  246  EPLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAA  305

Query  340  NYLLDHMHEFED  305
            NYLL++  +FED
Sbjct  306  NYLLENGGDFED  317



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 127/155 (82%), Gaps = 8/155 (5%)
 Frame = -2

Query  745  LDLFPQGLPNIPSS------NAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGK  584
            L+LFPQG+P+  S+         GA  L+ LR   QFQAL A+VQANPQILQPMLQELGK
Sbjct  257  LNLFPQGIPSAGSNPGAAAGAGAGAGALDALRQLPQFQALLALVQANPQILQPMLQELGK  316

Query  583  QNPHLMRLIQEHQADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEEREAIERLEA  410
            QNP ++RLIQE+QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEEREAI+RLEA
Sbjct  317  QNPQILRLIQENQAEFLRLVNESPDSGTAGGNILGQLAAAMPQALTVTPEEREAIQRLEA  376

Query  409  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            MGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  377  MGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 5/152 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANT----LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  578
            L+LFPQG+P+  ++ A GA      L+ LR   QFQAL  +VQANPQILQPMLQELGKQN
Sbjct  256  LNLFPQGVPSGGANPAAGAGAGAGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQN  315

Query  577  PHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGF  401
            P ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA+MPQAVQVTPEEREAI+RLE MGF
Sbjct  316  PQILRLIQENQAEFLRLVNESPEGGAGGNILGQLAAAMPQAVQVTPEEREAIQRLEGMGF  375

Query  400  DRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            +R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  376  NRELVLEVFFACNKDEELAANYLLDHGHEFDE  407



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 127/155 (82%), Gaps = 8/155 (5%)
 Frame = -2

Query  745  LDLFPQGLPNIPSS------NAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGK  584
            L+LFPQG+P+  S+         GA  L+ LR   QFQAL A+VQANPQILQPMLQELGK
Sbjct  257  LNLFPQGIPSAGSNPGAAAGAGAGAGALDALRQLPQFQALLALVQANPQILQPMLQELGK  316

Query  583  QNPHLMRLIQEHQADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEEREAIERLEA  410
            QNP ++RLIQE+QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEEREAI+RLEA
Sbjct  317  QNPQILRLIQENQAEFLRLVNESPDSGAAGGNILGQLAAAMPQALTVTPEEREAIQRLEA  376

Query  409  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            MGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  377  MGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AGG  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  161  LNMFPQ--ETLSGAAAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  218

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  219  RLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALV  278

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  279  IEAFLACDRNEELAANYLLENSGDFED  305



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 7/153 (5%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAG-----GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQ  581
            L+LFPQG+P+   SN G     G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQ
Sbjct  251  LNLFPQGVPSG-GSNPGVVPGAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQ  309

Query  580  NPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMG  404
            NP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE MG
Sbjct  310  NPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGMG  369

Query  403  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            F+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  370  FNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 7/153 (5%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAG-----GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQ  581
            L+LFPQG+P+   SN G     G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQ
Sbjct  251  LNLFPQGVPS-GGSNPGVIPGAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQ  309

Query  580  NPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMG  404
            NP ++RLIQE+QA+FLRL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE MG
Sbjct  310  NPQILRLIQENQAEFLRLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGMG  369

Query  403  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            F+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  370  FNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|XP_009615678.1| PREDICTED: ubiquitin receptor RAD23b [Nicotiana tomentosiformis]
Length=367

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N+  +N  G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  223  LNLFPQ--ENVAGANGAGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLL  280

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R IQEH  +FL+LINEPV+G +G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV
Sbjct  281  RSIQEHHQEFLQLINEPVDGSDGDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALV  340

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL+H  ++ED
Sbjct  341  IEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + A G  +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  233  LNMFPQ--ETLSGAPASGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  290

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEHQA+FL+LINEPV+G EG++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV
Sbjct  291  RLIQEHQAEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALV  350

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  351  IEAFLACDRNEELAANYLLENAGDFED  377



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AGG  +L+FLRN+QQFQALR+MVQ+NPQILQPML ELGKQNP L+
Sbjct  229  LNMFPQ--ETLSGAAAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLLELGKQNPQLL  286

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  287  RLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALV  346

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  347  IEAFLACDRNEELAANYLLENSGDFED  373



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 126/159 (79%), Gaps = 18/159 (11%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGAN----------TLEFLRNSQQFQALRAMVQANPQILQPMLQ  596
            L+LFPQG+P       GG+N           L+ LR   QFQAL A+VQANPQILQPMLQ
Sbjct  259  LNLFPQGVPT------GGSNPGAGVGAGAGALDALRALPQFQALLALVQANPQILQPMLQ  312

Query  595  ELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQ-AVQVTPEEREAIE  422
            ELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILGQLAA+MPQ AV VTPEERE+I+
Sbjct  313  ELGKQNPQILRLIQENQAEFLRLVNETPESGAAGNILGQLAAAMPQAAVTVTPEERESIQ  372

Query  421  RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            RLEAMGF+R LVLEVFFACN++EELAANYLLDH HE+ED
Sbjct  373  RLEAMGFNRELVLEVFFACNRDEELAANYLLDHGHEYED  411



>ref|XP_006341431.1| PREDICTED: ubiquitin receptor RAD23b-like [Solanum tuberosum]
Length=367

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N+  + + G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  223  LNLFPQ--ENVAGAGSAGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLL  280

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R IQEH  +FL+LINEPV+G +G++  Q    +P  V VTPEE+E IERLEAMGFDRALV
Sbjct  281  RSIQEHDQEFLQLINEPVDGSDGDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALV  340

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL+H  ++ED
Sbjct  341  IEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 125/150 (83%), Gaps = 6/150 (4%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NAG  N L+ LRN+ QFQ L ++VQANPQILQP+LQELGKQNP +M
Sbjct  238  LDLFPQALPNA-SANAGAGN-LDVLRNNAQFQTLLSLVQANPQILQPLLQELGKQNPQVM  295

Query  565  RLIQEHQADFLRLINEPVEGGEG---NILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  395
            +LIQE+QA+F+RLINEP+EG E    N+L Q+A +  + + VTPEE EAI RLE MGFDR
Sbjct  296  QLIQENQAEFMRLINEPLEGDEENEMNMLDQIADAA-ETIAVTPEENEAILRLEGMGFDR  354

Query  394  ALVLEVFFACNKNEELAANYLLDHMHEFED  305
            ALVLEVFFACNKNE+LAANYLLDHMHEF++
Sbjct  355  ALVLEVFFACNKNEQLAANYLLDHMHEFDN  384



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  685  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  506
            +L+FLRN+QQFQ LR+MVQANPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINEP+EG
Sbjct  295  SLDFLRNNQQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPLEG  354

Query  505  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  326
             EG+I  Q    MP A+ VTPEE+EAIERLEAMGFDRALV+E + AC++NEELAANYLL+
Sbjct  355  SEGDIFDQPEQDMPHAINVTPEEQEAIERLEAMGFDRALVIEAYLACDRNEELAANYLLE  414

Query  325  HMHEFED  305
            H  +FED
Sbjct  415  HAGDFED  421



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S++A G   L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP ++
Sbjct  242  LDLFPQALPNA-STDAAGLGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQNPQIL  300

Query  565  RLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            +LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLE MGFDRAL
Sbjct  301  QLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEEDEAILRLEPMGFDRAL  360

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VL+VFFACNK+E+LAANYLLDHM+EF D
Sbjct  361  VLDVFFACNKDEQLAANYLLDHMNEFAD  388



>gb|EMT30328.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=456

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NA G   L+ LRN+ QF++L ++VQANPQILQP+LQELGKQNP ++
Sbjct  287  LDLFPQALPNA-SANAAGEGNLDVLRNNAQFRSLLSLVQANPQILQPLLQELGKQNPQIL  345

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            +LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE EAI RLE MGFDRAL
Sbjct  346  QLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEENEAILRLEGMGFDRAL  405

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  406  VLEVYFACNKDETLAANYLLDHMNEFDD  433



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 5/152 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEF----LRNSQQFQALRAMVQANPQILQPMLQELGKQN  578
            L+LFPQG+P+  ++   G          LR   QFQAL A+VQANPQILQPMLQELGKQN
Sbjct  261  LNLFPQGVPSGGANAGAGVGAGAGALDALRQLPQFQALLALVQANPQILQPMLQELGKQN  320

Query  577  PHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGF  401
            P ++RLIQE+QA+FLRL+NE P  G  GNILG LAA MPQAVQVTPEEREAI+RLE+MGF
Sbjct  321  PQILRLIQENQAEFLRLVNETPESGAGGNILGALAAQMPQAVQVTPEEREAIQRLESMGF  380

Query  400  DRALVLEVFFACNKNEELAANYLLDHMHEFED  305
            +R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  381  NRELVLEVFFACNRDEELAANYLLDHGHEFEE  412



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  685  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  506
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  261  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  320

Query  505  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  326
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  321  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  380

Query  325  HMHEFED  305
            H  +FED
Sbjct  381  HAGDFED  387



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  685  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  506
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  248  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  307

Query  505  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  326
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  308  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  367

Query  325  HMHEFED  305
            H  +FED
Sbjct  368  HAGDFED  374



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  685  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  506
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  247  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  306

Query  505  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  326
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  307  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  366

Query  325  HMHEFED  305
            H  +FED
Sbjct  367  HAGDFED  373



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  685  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  506
            TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G
Sbjct  262  TLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDG  321

Query  505  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  326
             EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  322  SEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  381

Query  325  HMHEFED  305
            H  +FED
Sbjct  382  HAGDFED  388



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N   S A G  +L+FLRN+QQFQALR+MVQANPQILQPMLQEL KQNP L+
Sbjct  244  LNLFPQETLN---SGAVGDGSLDFLRNNQQFQALRSMVQANPQILQPMLQELSKQNPQLL  300

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  301  RLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALV  360

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELA NYLL++  +FED
Sbjct  361  IEAFLACDRNEELAVNYLLENAGDFED  387



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N+  +      +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  222  LNLFPQE--NVAGAGGAALGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  279

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV
Sbjct  280  RMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALV  339

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL+H  ++ED
Sbjct  340  IEAFLACDRNEELAANYLLEHAGDYED  366



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N+  +      +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  223  LNLFPQE--NVAGAGGAALGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLL  280

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV
Sbjct  281  RMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALV  340

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL+H  ++ED
Sbjct  341  IEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AG   +L+FLRN+ QFQ LR+MVQANPQILQPMLQELGKQNP L+
Sbjct  227  LNMFPQEA--LSGAGAGALGSLDFLRNNHQFQTLRSMVQANPQILQPMLQELGKQNPQLL  284

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  285  RLIQEHHAEFLQLINEPLEGSEGDMFDQPDQEMPHAINVTPAEQEAIERLEAMGFDRALV  344

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL++  +FED
Sbjct  345  IEAFLACDRNEELAANYLLENAGDFED  371



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NA G   L+ LRN+ QF++L ++VQANPQILQP+LQELGKQNP ++
Sbjct  245  LDLFPQALPNA-SANAAGEGNLDVLRNNAQFRSLLSLVQANPQILQPLLQELGKQNPQIL  303

Query  565  RLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  389
            +LIQ++QA+FLRLINEP EG E  N+L Q A  +PQ + VTPEE EAI RLE MGFDRAL
Sbjct  304  QLIQDNQAEFLRLINEPAEGDEDENLLEQFAEGVPQTIAVTPEENEAILRLEGMGFDRAL  363

Query  388  VLEVFFACNKNEELAANYLLDHMHEFED  305
            VLEV+FACNK+E LAANYLLDHM+EF+D
Sbjct  364  VLEVYFACNKDETLAANYLLDHMNEFDD  391



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FP+ +        GG  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  212  LNMFPETISGGGGGAGGGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLL  271

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  272  RIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALV  331

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NE+LAANYLL++  +FED
Sbjct  332  IEAFLACDRNEQLAANYLLENAGDFED  358



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FP+ +        GG  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  226  LNMFPETISGGGGGAGGGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLL  285

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  286  RIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALV  345

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NE+LAANYLL++  +FED
Sbjct  346  IEAFLACDRNEQLAANYLLENAGDFED  372



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FP+ +        GG  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  226  LNMFPETISGGGGGAGGGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLL  285

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R+IQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV
Sbjct  286  RIIQEHHAEFLQLINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALV  345

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NE+LAANYLL++  +FED
Sbjct  346  IEAFLACDRNEQLAANYLLENAGDFED  372



>tpg|DAA40043.1| TPA: hypothetical protein ZEAMMB73_722140 [Zea mays]
Length=225

 Score =   193 bits (490),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 5/149 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NAG  N L+ LRN+ QFQ L  +VQANPQILQP+LQELGKQNP +M
Sbjct  71   LDLFPQSLPNA-SANAGTGN-LDVLRNNVQFQNLLGLVQANPQILQPLLQELGKQNPQVM  128

Query  565  RLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            +LIQE+QA+F+R+INEP+EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRA
Sbjct  129  QLIQENQAEFMRMINEPLEGDEENEMMLDQMADAA-ETIAVTPEENEAILRLEGMGFDRA  187

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED  305
            LVLEVFFACNKNE+L ANYLLDHMHEF++
Sbjct  188  LVLEVFFACNKNEQLTANYLLDHMHEFDN  216



>ref|XP_008342756.1| PREDICTED: ubiquitin receptor RAD23b-like [Malus domestica]
Length=369

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AG   +L+FLRN++QFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  222  LNMFPQ--ETLSGAGAGALGSLDFLRNNRQFQALRSMVQSNPQILQPMLQELGKQNPQLL  279

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDR  395
            RLIQEH  +FL+LINEPVEG EG+I  Q       +P A+ VTP E+EAIERLEAMGFDR
Sbjct  280  RLIQEHHTEFLQLINEPVEGSEGDIFDQADGPDQDLPHAINVTPAEQEAIERLEAMGFDR  339

Query  394  ALVLEVFFACNKNEELAANYLLDHMHEFED  305
            ALV+E F AC++NEELAANYLL++  +FED
Sbjct  340  ALVIEAFLACDRNEELAANYLLENAGDFED  369



>gb|ACF79443.1| unknown [Zea mays]
 tpg|DAA40040.1| TPA: hypothetical protein ZEAMMB73_722140 [Zea mays]
Length=365

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 5/149 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NAG  N L+ LRN+ QFQ L  +VQANPQILQP+LQELGKQNP +M
Sbjct  211  LDLFPQSLPNA-SANAGTGN-LDVLRNNVQFQNLLGLVQANPQILQPLLQELGKQNPQVM  268

Query  565  RLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            +LIQE+QA+F+R+INEP+EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRA
Sbjct  269  QLIQENQAEFMRMINEPLEGDEENEMMLDQMADAA-ETIAVTPEENEAILRLEGMGFDRA  327

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED  305
            LVLEVFFACNKNE+L ANYLLDHMHEF++
Sbjct  328  LVLEVFFACNKNEQLTANYLLDHMHEFDN  356



>ref|XP_011082656.1| PREDICTED: ubiquitin receptor RAD23b-like [Sesamum indicum]
Length=361

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ    +  +   G  +L+FLRN+QQFQALR++VQANPQILQPMLQELGKQNP L+
Sbjct  217  LNLFPQ--ETVSGAAGAGLGSLDFLRNNQQFQALRSLVQANPQILQPMLQELGKQNPSLL  274

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQE+  +FL+LINEPV+G EG+I  Q    MP AV VTP E+EAIER+EAMGFDRALV
Sbjct  275  RLIQENHQEFLQLINEPVDGSEGDIFDQAEQEMPHAVSVTPAEQEAIERMEAMGFDRALV  334

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELA NYLL++  +FED
Sbjct  335  IEAFLACDRNEELAVNYLLENAGDFED  361



>ref|NP_001149553.1| LOC100283179 [Zea mays]
 gb|ACF84553.1| unknown [Zea mays]
 gb|ACG35819.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA40041.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=390

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 5/152 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            LDLFPQ LPN  S+NAG  N L+ LRN+ QFQ L  +VQANPQILQP+LQELGKQNP +M
Sbjct  236  LDLFPQSLPNA-SANAGTGN-LDVLRNNVQFQNLLGLVQANPQILQPLLQELGKQNPQVM  293

Query  565  RLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  392
            +LIQE+QA+F+R+INEP+EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRA
Sbjct  294  QLIQENQAEFMRMINEPLEGDEENEMMLDQMADAA-ETIAVTPEENEAILRLEGMGFDRA  352

Query  391  LVLEVFFACNKNEELAANYLLDHMHEFED*CG  296
            LVLEVFFACNKNE+L ANYLLDHMHEF++  G
Sbjct  353  LVLEVFFACNKNEQLTANYLLDHMHEFDNDDG  384



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AG   +L+FLRN++QFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  227  LNMFPQ--ETLSGAGAGALGSLDFLRNNRQFQALRSMVQANPQILQPMLQELGKQNPQLL  284

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDR  395
            RLIQEH  +FL+LINEP+EG EG+I  Q       MP A+ VTP E+EAIERLEAMGFDR
Sbjct  285  RLIQEHHTEFLQLINEPLEGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIERLEAMGFDR  344

Query  394  ALVLEVFFACNKNEELAANYLLDHMHEFED  305
            ALV+E F AC++NEELAANYLL++  ++ED
Sbjct  345  ALVIEAFLACDRNEELAANYLLENAGDYED  374



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  679  EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  500
            +FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG E
Sbjct  249  DFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSE  308

Query  499  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  320
            G+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++ 
Sbjct  309  GDIFDQAEQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENA  368

Query  319  HEFED  305
             +FED
Sbjct  369  GDFED  373



>ref|XP_004235877.1| PREDICTED: ubiquitin receptor RAD23b [Solanum lycopersicum]
Length=366

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L+LFPQ   N+      G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+
Sbjct  222  LNLFPQ--ENVAGGGGAGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLL  279

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            R IQEH  +FL+LINEPV+G +G++  Q    +P  V VTPEE+E IERLEAMGFDRALV
Sbjct  280  RSIQEHDQEFLQLINEPVDGSDGDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALV  339

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E F AC++NEELAANYLL+H  ++ED
Sbjct  340  IEAFLACDRNEELAANYLLEHAGDYED  366



>ref|XP_010695313.1| PREDICTED: probable ubiquitin receptor RAD23a [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695314.1| PREDICTED: probable ubiquitin receptor RAD23a [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695315.1| PREDICTED: probable ubiquitin receptor RAD23a [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ   ++  + AGG  +L+FLRN+QQFQALR MVQ NPQILQPMLQELGKQNP L+
Sbjct  228  LNMFPQ--ESLSDAAAGGLGSLDFLRNNQQFQALRNMVQTNPQILQPMLQELGKQNPELL  285

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALV  386
            RLIQ+H A+FL+L+NEP++G EG+I  Q    MP A+ VT EE+EAIERLEAMGFDRALV
Sbjct  286  RLIQDHHAEFLQLLNEPLDGSEGDIFDQPEQDMPHAISVTQEEQEAIERLEAMGFDRALV  345

Query  385  LEVFFACNKNEELAANYLLDHMHEFED  305
            +E + AC ++EELAANYLL+H  E ED
Sbjct  346  IEAYLACERDEELAANYLLEHADENED  372



>ref|XP_009354240.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
 ref|XP_009370969.1| PREDICTED: ubiquitin receptor RAD23b [Pyrus x bretschneideri]
Length=369

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -2

Query  745  LDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLM  566
            L++FPQ    +  + AG   +L+FLRN++QFQALR+MVQ+NPQILQPMLQELGKQNP L+
Sbjct  222  LNMFPQ--ETLSGAGAGALGSLDFLRNNRQFQALRSMVQSNPQILQPMLQELGKQNPQLL  279

Query  565  RLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDR  395
            RLIQEH  +FL+LINEPVEG EG+I  Q       +P A+ VTP E+EAIERLEAMGFDR
Sbjct  280  RLIQEHHTEFLQLINEPVEGSEGDIFDQPDGPDQDLPHAINVTPAEQEAIERLEAMGFDR  339

Query  394  ALVLEVFFACNKNEELAANYLLDHMHEFED  305
            ALV+E F AC++NEELAANYLL++  +FED
Sbjct  340  ALVIEAFLACDRNEELAANYLLENAGDFED  369



>ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana 
sylvestris]
Length=296

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  685  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  506
            +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G
Sbjct  170  SLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDG  229

Query  505  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  326
             +G++  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+
Sbjct  230  SDGDLFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLE  289

Query  325  HMHEFED  305
            H  ++ED
Sbjct  290  HAGDYED  296



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195