BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF049D08

Length=809
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAC98299.1|  LEXYL2                                                 328   3e-104   Solanum lycopersicum
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    329   4e-103   
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    328   7e-103   Nicotiana sylvestris
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    328   8e-103   Nicotiana tomentosiformis
emb|CBI20072.3|  unnamed protein product                                314   1e-102   Vitis vinifera
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    324   2e-101   Solanum tuberosum [potatoes]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      323   4e-101   Solanum lycopersicum
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    323   9e-101   Nicotiana tomentosiformis
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    322   1e-100   Sesamum indicum [beniseed]
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    323   1e-100   Solanum tuberosum [potatoes]
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    322   2e-100   Nicotiana sylvestris
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                319   1e-99    Erythranthe guttata [common monkey flower]
gb|KCW63063.1|  hypothetical protein EUGRSUZ_G00654                     315   2e-99    Eucalyptus grandis [rose gum]
gb|KCW63062.1|  hypothetical protein EUGRSUZ_G006531                    315   3e-99    Eucalyptus grandis [rose gum]
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    316   2e-98    Sesamum indicum [beniseed]
emb|CDO97479.1|  unnamed protein product                                315   3e-98    Coffea canephora [robusta coffee]
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    315   5e-98    Eucalyptus grandis [rose gum]
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    315   6e-98    Eucalyptus grandis [rose gum]
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    315   9e-98    Eucalyptus grandis [rose gum]
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         312   6e-97    Jatropha curcas
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    312   8e-97    Vitis vinifera
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    312   2e-96    Eucalyptus grandis [rose gum]
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    310   5e-96    Sesamum indicum [beniseed]
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    310   9e-96    Vitis vinifera
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    309   1e-95    Populus euphratica
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    309   2e-95    Eucalyptus grandis [rose gum]
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                308   2e-95    Erythranthe guttata [common monkey flower]
emb|CAN78858.1|  hypothetical protein VITISV_030325                     306   3e-95    Vitis vinifera
gb|KJB31996.1|  hypothetical protein B456_005G218000                    300   5e-95    Gossypium raimondii
ref|XP_007043027.1|  Beta-D-xylosidase 4                                306   3e-94    
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    305   3e-94    Fragaria vesca subsp. vesca
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    306   5e-94    Fragaria vesca subsp. vesca
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             305   8e-94    Prunus persica
gb|KJB31997.1|  hypothetical protein B456_005G218000                    300   2e-93    Gossypium raimondii
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    302   5e-93    Prunus mume [ume]
ref|XP_002298197.2|  beta-glucosidase family protein                    302   6e-93    
ref|XP_002303181.1|  beta-glucosidase family protein                    301   8e-93    
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           301   2e-92    Gossypium arboreum [tree cotton]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    301   2e-92    
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                301   2e-92    Erythranthe guttata [common monkey flower]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                301   2e-92    Erythranthe guttata [common monkey flower]
gb|ACL53913.1|  unknown                                                 290   3e-92    Zea mays [maize]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    300   3e-92    Gossypium raimondii
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    300   3e-92    
ref|NP_001054038.1|  Os04g0640700                                       299   6e-92    
ref|XP_002513707.1|  Beta-glucosidase, putative                         299   7e-92    Ricinus communis
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    299   1e-91    
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    298   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    298   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW59618.1|  putative O-Glycosyl hydrolase superfamily protein       290   2e-91    
emb|CAE03635.1|  OSJNBb0003B01.27                                       299   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    298   2e-91    
ref|NP_001146416.1|  uncharacterized protein LOC100279996               291   3e-91    
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    298   3e-91    Elaeis guineensis
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                298   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN39204.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           294   4e-91    Glycine soja [wild soybean]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    297   7e-91    Cucumis melo [Oriental melon]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    295   3e-90    
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    295   4e-90    
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    295   5e-90    Pyrus x bretschneideri [bai li]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    294   7e-90    Medicago truncatula
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    294   7e-90    Medicago sativa subsp. x varia
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    294   8e-90    Glycine max [soybeans]
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    294   8e-90    Populus euphratica
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                294   9e-90    
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    294   1e-89    Fragaria vesca subsp. vesca
ref|XP_008661823.1|  PREDICTED: uncharacterized protein LOC100279...    291   1e-89    Zea mays [maize]
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    293   1e-89    Citrus sinensis [apfelsine]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    294   1e-89    
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    293   3e-89    Populus euphratica
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              291   5e-89    Populus tremula x Populus alba [gray poplar]
ref|XP_010068199.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    286   5e-89    Eucalyptus grandis [rose gum]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    291   5e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             291   8e-89    Citrus clementina [clementine]
dbj|BAK03439.1|  predicted protein                                      289   9e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      291   1e-88    Morus notabilis
gb|KHN26728.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           288   1e-88    Glycine soja [wild soybean]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             290   2e-88    Phaseolus vulgaris [French bean]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    290   2e-88    
dbj|BAK01582.1|  predicted protein                                      288   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    289   5e-88    Cicer arietinum [garbanzo]
dbj|BAJ90420.1|  predicted protein                                      289   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          288   2e-87    Sorghum bicolor [broomcorn]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    288   2e-87    Gossypium raimondii
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    288   2e-87    Glycine max [soybeans]
dbj|BAJ90315.1|  predicted protein                                      288   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD94522.1|  beta-xylosidase - like protein                         273   2e-87    Arabidopsis thaliana [mouse-ear cress]
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    287   2e-87    Medicago sativa subsp. x varia
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        287   3e-87    Medicago truncatula
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           287   3e-87    Gossypium arboreum [tree cotton]
dbj|BAD94481.1|  beta-xylosidase                                        280   9e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          285   2e-86    Amborella trichopoda
gb|KHN33504.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           282   2e-86    Glycine soja [wild soybean]
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                284   5e-86    Brachypodium distachyon [annual false brome]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    283   8e-86    Cicer arietinum [garbanzo]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    283   9e-86    Glycine max [soybeans]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             283   9e-86    Eutrema salsugineum [saltwater cress]
gb|EMT32951.1|  Beta-D-xylosidase 4                                     286   2e-85    
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             282   2e-85    Phaseolus vulgaris [French bean]
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     281   4e-85    Setaria italica
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    281   6e-85    Beta vulgaris subsp. vulgaris [field beet]
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    280   2e-84    Hordeum vulgare [barley]
ref|XP_009407358.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    276   3e-84    
ref|NP_201262.1|  beta-D-xylosidase 4                                   279   5e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             278   1e-83    Eutrema salsugineum [saltwater cress]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     278   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                277   1e-83    Brassica rapa
ref|XP_002866623.1|  beta-xylosidase 4                                  278   1e-83    Arabidopsis lyrata subsp. lyrata
emb|CDY18705.1|  BnaA09g06900D                                          277   1e-83    Brassica napus [oilseed rape]
ref|NP_196535.1|  beta-xylosidase 3                                     276   3e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CDX69892.1|  BnaA10g22410D                                          276   4e-83    
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                276   4e-83    Brassica rapa
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     276   5e-83    Brassica rapa
emb|CDY51290.1|  BnaA06g23560D                                          276   5e-83    Brassica napus [oilseed rape]
gb|EPS65933.1|  hypothetical protein M569_08842                         276   5e-83    Genlisea aurea
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                276   5e-83    Brassica rapa
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          275   6e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     275   6e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     276   7e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          276   9e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                275   1e-82    Camelina sativa [gold-of-pleasure]
emb|CAB89360.1|  beta-glucosidase-like protein                          265   1e-82    Arabidopsis thaliana [mouse-ear cress]
emb|CDY35825.1|  BnaC09g37570D                                          275   2e-82    Brassica napus [oilseed rape]
emb|CDY01780.1|  BnaC06g28200D                                          274   2e-82    
ref|XP_002873418.1|  beta-xylosidase 3                                  274   3e-82    Arabidopsis lyrata subsp. lyrata
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             274   3e-82    Capsella rubella
emb|CDX97115.1|  BnaC09g45100D                                          272   3e-82    
emb|CBI40687.3|  unnamed protein product                                273   6e-82    Vitis vinifera
emb|CDY31313.1|  BnaA02g34280D                                          273   1e-81    Brassica napus [oilseed rape]
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    273   1e-81    Arabis alpina [alpine rockcress]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            272   2e-81    Raphanus sativus
emb|CDX81229.1|  BnaC09g06400D                                          271   2e-81    
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    271   3e-81    Arabis alpina [alpine rockcress]
ref|NP_196532.2|  Glycosyl hydrolase family protein                     265   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     271   5e-81    Tarenaya hassleriana [spider flower]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                271   5e-81    Camelina sativa [gold-of-pleasure]
emb|CDY46812.1|  BnaC02g43200D                                          271   5e-81    Brassica napus [oilseed rape]
emb|CDY56487.1|  BnaCnng30450D                                          271   6e-81    Brassica napus [oilseed rape]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                270   7e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                267   1e-79    Brassica rapa
emb|CDX96113.1|  BnaA07g26180D                                          268   5e-79    
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                263   3e-78    
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                260   3e-77    Camelina sativa [gold-of-pleasure]
emb|CDY21595.1|  BnaC09g46970D                                          255   2e-74    Brassica napus [oilseed rape]
gb|ABK96385.1|  unknown                                                 235   8e-72    Populus trichocarpa x Populus deltoides
gb|EEE61783.1|  hypothetical protein OsJ_16354                          245   1e-71    Oryza sativa Japonica Group [Japonica rice]
gb|KCW63060.1|  hypothetical protein EUGRSUZ_G00652                     237   5e-71    Eucalyptus grandis [rose gum]
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              240   1e-69    Eucalyptus grandis [rose gum]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              238   7e-69    
dbj|BAJ51947.1|  putative beta-D-xylosidase                             226   7e-69    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_002316021.1|  beta-D-xylosidase family protein                   237   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              237   2e-68    
ref|XP_010652235.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    234   2e-68    Vitis vinifera
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               236   2e-68    Malus domestica [apple tree]
dbj|BAF79669.1|  beta-D-xylosidase                                      236   4e-68    Pyrus pyrifolia [sha li]
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         236   5e-68    Pyrus x bretschneideri [bai li]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    235   7e-68    
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              235   1e-67    
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              234   1e-67    Populus euphratica
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              234   1e-67    
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    234   2e-67    Vitis vinifera
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             234   2e-67    
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              234   2e-67    Populus euphratica
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        233   3e-67    Pyrus pyrifolia [sha li]
ref|XP_010094323.1|  Beta-D-xylosidase 1                                233   5e-67    Morus notabilis
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          233   6e-67    Amborella trichopoda
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         233   6e-67    Jatropha curcas
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              233   6e-67    
emb|CDO98788.1|  unnamed protein product                                233   6e-67    Coffea canephora [robusta coffee]
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            233   8e-67    Sesamum indicum [beniseed]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    231   3e-66    Ricinus communis
gb|KDO71842.1|  hypothetical protein CISIN_1g0062242mg                  221   7e-66    Citrus sinensis [apfelsine]
ref|XP_002311398.2|  beta-D-xylosidase family protein                   229   1e-65    
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            229   2e-65    Sesamum indicum [beniseed]
gb|KDO71849.1|  hypothetical protein CISIN_1g0062242mg                  221   2e-65    Citrus sinensis [apfelsine]
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            228   3e-65    Elaeis guineensis
dbj|BAF43576.1|  arabinofuranosidase/xylosidase homolog                 219   3e-65    Prunus persica
gb|KHN14659.1|  Beta-D-xylosidase 1                                     226   3e-65    Glycine soja [wild soybean]
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       228   4e-65    Solanum tuberosum [potatoes]
gb|KDO87030.1|  hypothetical protein CISIN_1g0041901mg                  223   6e-65    Citrus sinensis [apfelsine]
dbj|BAO45878.1|  beta-D-xylosidase                                      227   6e-65    Acacia mangium
ref|XP_010313018.1|  PREDICTED: slArf/Xyl1 protein isoform X1           225   7e-65    Solanum lycopersicum
gb|KHG28205.1|  putative beta-D-xylosidase 2 -like protein              222   1e-64    Gossypium arboreum [tree cotton]
ref|XP_004172482.1|  PREDICTED: beta-D-xylosidase 1-like                222   1e-64    
gb|KDO71843.1|  hypothetical protein CISIN_1g0062242mg                  221   1e-64    Citrus sinensis [apfelsine]
gb|KDO71845.1|  hypothetical protein CISIN_1g0062242mg                  221   1e-64    Citrus sinensis [apfelsine]
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             226   2e-64    Phaseolus vulgaris [French bean]
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                226   2e-64    Glycine max [soybeans]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            225   2e-64    Glycine soja [wild soybean]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            225   3e-64    Nicotiana tomentosiformis
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       225   3e-64    Morus notabilis
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       225   3e-64    Glycine max [soybeans]
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       225   4e-64    Solanum lycopersicum
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       225   4e-64    
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            225   4e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007051080.1|  Beta-xylosidase 2                                  225   4e-64    
gb|KJB49844.1|  hypothetical protein B456_008G140600                    224   5e-64    Gossypium raimondii
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            224   8e-64    Populus euphratica
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    224   9e-64    
ref|XP_002515300.1|  Beta-glucosidase, putative                         224   9e-64    Ricinus communis
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            224   1e-63    Populus euphratica
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            223   2e-63    Cucumis melo [Oriental melon]
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     223   2e-63    Beta vulgaris subsp. vulgaris [field beet]
sp|P83344.1|XYNB_PRUPE  RecName: Full=Putative beta-D-xylosidase;...    217   2e-63    Prunus persica
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             223   2e-63    Citrus clementina [clementine]
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              223   2e-63    Gossypium arboreum [tree cotton]
ref|XP_009609889.1|  PREDICTED: putative beta-D-xylosidase              218   2e-63    
gb|ACD93208.1|  beta xylosidase                                         223   3e-63    Camellia sinensis [black tea]
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            223   3e-63    Nelumbo nucifera [Indian lotus]
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              223   3e-63    Vitis vinifera
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              222   4e-63    Nelumbo nucifera [Indian lotus]
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           222   5e-63    Prunus salicina [Japanese plum]
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              222   5e-63    Prunus mume [ume]
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                222   5e-63    Cucumis sativus [cucumbers]
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            222   5e-63    Populus euphratica
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           222   5e-63    Prunus salicina [Japanese plum]
gb|KDO71844.1|  hypothetical protein CISIN_1g0062242mg                  216   6e-63    Citrus sinensis [apfelsine]
gb|ADV41671.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           219   7e-63    Actinidia deliciosa var. deliciosa
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            221   8e-63    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                221   8e-63    Erythranthe guttata [common monkey flower]
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       221   8e-63    Gossypium arboreum [tree cotton]
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             221   9e-63    Eutrema salsugineum [saltwater cress]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            221   1e-62    Glycine max [soybeans]
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            221   1e-62    Nicotiana sylvestris
ref|XP_003591420.1|  Beta xylosidase                                    221   2e-62    Medicago truncatula
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             220   2e-62    
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    220   3e-62    
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             220   3e-62    
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       220   3e-62    Setaria italica
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                220   3e-62    Phoenix dactylifera
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            220   3e-62    Tarenaya hassleriana [spider flower]
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       220   3e-62    Cucumis sativus [cucumbers]
gb|KHN12900.1|  Beta-D-xylosidase 1                                     219   3e-62    Glycine soja [wild soybean]
gb|AAP83934.1|  auxin-induced beta-glucosidase                          219   4e-62    Oxybasis rubra [pigweed]
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                219   5e-62    
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             219   6e-62    
ref|XP_006306830.1|  hypothetical protein CARUB_v10008371mg             216   8e-62    
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             218   1e-61    Prunus persica
gb|KJB72795.1|  hypothetical protein B456_011G198200                    218   1e-61    Gossypium raimondii
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                218   2e-61    Cicer arietinum [garbanzo]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         217   2e-61    Jatropha curcas
gb|KJB09457.1|  hypothetical protein B456_001G143600                    217   3e-61    Gossypium raimondii
gb|KJB38535.1|  hypothetical protein B456_006G259500                    217   3e-61    Gossypium raimondii
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             217   4e-61    Capsella rubella
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            216   5e-61    Camelina sativa [gold-of-pleasure]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              216   6e-61    Fragaria vesca subsp. vesca
dbj|BAC41913.1|  putative beta-xylosidase                               215   8e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            216   1e-60    Brassica rapa
gb|KCW58371.1|  hypothetical protein EUGRSUZ_H010551                    214   1e-60    Eucalyptus grandis [rose gum]
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                215   1e-60    Solanum tuberosum [potatoes]
emb|CDX89954.1|  BnaA10g01280D                                          215   1e-60    
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            215   1e-60    Camelina sativa [gold-of-pleasure]
ref|NP_196618.1|  putative beta-D-xylosidase 6                          215   1e-60    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02134.1|  xylosidase                                             204   1e-60    Arabidopsis thaliana [mouse-ear cress]
gb|AAS17751.2|  beta xylosidase                                         215   1e-60    Fragaria x ananassa
ref|XP_003594795.1|  Beta xylosidase                                    215   2e-60    Medicago truncatula
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             215   2e-60    Phaseolus vulgaris [French bean]
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          214   2e-60    Nicotiana sylvestris
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     214   3e-60    Sesamum indicum [beniseed]
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                214   4e-60    Erythranthe guttata [common monkey flower]
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            214   4e-60    Eucalyptus grandis [rose gum]
emb|CDY15255.1|  BnaC05g01340D                                          214   5e-60    Brassica napus [oilseed rape]
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             213   6e-60    
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            213   7e-60    Fragaria vesca subsp. vesca
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             212   2e-59    
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                212   2e-59    Arabidopsis lyrata subsp. lyrata
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            212   3e-59    Nelumbo nucifera [Indian lotus]
ref|XP_001784462.1|  predicted protein                                  211   3e-59    
ref|NP_563659.1|  probable beta-D-xylosidase 2                          211   3e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                211   4e-59    
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            211   4e-59    
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         211   4e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            211   4e-59    
ref|XP_003625957.1|  Beta-xylosidase                                    210   1e-58    Medicago truncatula
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             209   2e-58    Eutrema salsugineum [saltwater cress]
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    209   2e-58    Arabis alpina [alpine rockcress]
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            209   2e-58    Camelina sativa [gold-of-pleasure]
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    209   3e-58    Arabis alpina [alpine rockcress]
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6            209   4e-58    Tarenaya hassleriana [spider flower]
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            208   4e-58    
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             207   8e-58    
ref|XP_010442400.1|  PREDICTED: beta-D-xylosidase 1-like                204   2e-57    
emb|CDX97026.1|  BnaC09g45990D                                          206   2e-57    
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     206   3e-57    
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             206   3e-57    
emb|CBI22910.3|  unnamed protein product                                206   3e-57    
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                206   3e-57    
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            206   3e-57    
emb|CDX69822.1|  BnaA10g21710D                                          205   4e-57    
gb|EPS60429.1|  hypothetical protein M569_14372                         205   6e-57    
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    205   6e-57    
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             205   6e-57    
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            205   8e-57    
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            204   1e-56    
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             204   1e-56    
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     204   2e-56    
ref|XP_007141155.1|  hypothetical protein PHAVU_008G171800g             194   2e-56    
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       204   2e-56    
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    203   2e-56    
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            204   2e-56    
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            202   4e-56    
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       202   5e-56    
gb|KGN48676.1|  hypothetical protein Csa_6G497270                       201   5e-56    
gb|KHN43468.1|  Putative beta-D-xylosidase 2                            202   8e-56    
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    202   8e-56    
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            202   1e-55    
ref|XP_002865732.1|  beta-xylosidase 1                                  201   1e-55    
ref|XP_002527213.1|  Thermostable beta-glucosidase B, putative          196   1e-55    
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    201   1e-55    
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            201   1e-55    
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       201   2e-55    
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       201   2e-55    
ref|XP_009390582.1|  PREDICTED: probable beta-D-xylosidase 7            200   2e-55    
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            201   3e-55    
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            201   3e-55    
gb|KCW59657.1|  hypothetical protein EUGRSUZ_H02409                     199   4e-55    
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             200   4e-55    
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6            200   4e-55    
gb|KHG29436.1|  putative beta-D-xylosidase 5 -like protein              194   4e-55    
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             200   4e-55    
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       200   5e-55    
ref|XP_003612944.1|  Beta-D-xylosidase                                  200   5e-55    
gb|KJB44020.1|  hypothetical protein B456_007G230000                    199   6e-55    
emb|CDY49607.1|  BnaA09g03310D                                          199   6e-55    
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       199   7e-55    
gb|EEE61389.1|  hypothetical protein OsJ_15562                          199   8e-55    
ref|NP_001053392.1|  Os04g0530700                                       199   8e-55    
emb|CAJ86207.1|  B1011H02.4                                             199   8e-55    
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          199   8e-55    
ref|XP_010531790.1|  PREDICTED: probable beta-D-xylosidase 7            197   9e-55    
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    199   1e-54    
gb|ACG29242.1|  auxin-induced beta-glucosidase                          197   1e-54    
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            199   1e-54    
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like       199   1e-54    
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       199   1e-54    
gb|AFI25186.1|  putative beta-D-xylosidase                              199   1e-54    
dbj|BAG28345.1|  arabinofuranosidase                                    198   1e-54    
gb|ADE76904.1|  unknown                                                 190   1e-54    
emb|CDY71910.1|  BnaAnng39260D                                          190   2e-54    
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6            198   2e-54    
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       198   2e-54    
emb|CDY05634.1|  BnaC02g39030D                                          198   2e-54    
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    198   2e-54    
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  198   2e-54    
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440          198   2e-54    
gb|KHN24914.1|  Putative beta-D-xylosidase 7                            196   3e-54    
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             197   3e-54    
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    197   3e-54    
emb|CDX85405.1|  BnaC07g27160D                                          197   3e-54    
gb|KDP32160.1|  hypothetical protein JCGZ_12621                         197   3e-54    
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     197   5e-54    
gb|KHN38910.1|  Putative beta-D-xylosidase 6                            195   5e-54    
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  197   6e-54    
emb|CBI25718.3|  unnamed protein product                                196   7e-54    
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            196   8e-54    
emb|CDY33913.1|  BnaA02g30740D                                          196   1e-53    
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                196   1e-53    
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                196   1e-53    
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            196   1e-53    
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            196   1e-53    
gb|EYU26836.1|  hypothetical protein MIMGU_mgv1a024762mg                194   1e-53    
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       196   1e-53    
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       196   1e-53    
ref|NP_188596.1|  putative beta-D-xylosidase 5                          195   2e-53    
ref|NP_001068441.1|  Os11g0673200                                       196   2e-53    
gb|EYU33327.1|  hypothetical protein MIMGU_mgv1a001678mg                195   2e-53    
ref|XP_011011484.1|  PREDICTED: probable beta-D-xylosidase 7            194   2e-53    
gb|ABA95273.1|  Beta-D-xylosidase, putative, expressed                  196   2e-53    
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            195   2e-53    
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7            195   2e-53    
ref|XP_002885319.1|  beta-1,4-xylosidase                                196   2e-53    
dbj|BAB02547.1|  beta-1,4-xylosidase                                    196   2e-53    
gb|KJB29304.1|  hypothetical protein B456_005G093200                    195   2e-53    
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         195   2e-53    
gb|KHN26079.1|  Putative beta-D-xylosidase 7                            193   3e-53    
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    195   3e-53    
gb|EAY81823.1|  hypothetical protein OsI_36995                          195   3e-53    
ref|XP_006653619.1|  PREDICTED: probable beta-D-xylosidase 6-like       194   3e-53    
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    194   4e-53    
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             194   4e-53    
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            194   4e-53    
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                194   4e-53    
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              194   4e-53    
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7            194   5e-53    
dbj|BAJ94317.1|  predicted protein                                      194   5e-53    
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          194   5e-53    
ref|XP_009391117.1|  PREDICTED: probable beta-D-xylosidase 7            194   5e-53    
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       194   7e-53    
gb|KJB59942.1|  hypothetical protein B456_009G282000                    192   8e-53    
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            193   8e-53    
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g             193   8e-53    
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          193   9e-53    
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6            193   9e-53    
ref|XP_008346038.1|  PREDICTED: probable beta-D-xylosidase 7            189   9e-53    
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    193   1e-52    
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g             193   1e-52    
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          193   1e-52    
gb|KJB77632.1|  hypothetical protein B456_012G147500                    192   2e-52    
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         192   2e-52    
ref|XP_010914750.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    192   2e-52    
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    195   2e-52    
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    192   2e-52    
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                192   2e-52    
emb|CDY00033.1|  BnaC09g02680D                                          192   3e-52    
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        195   3e-52    
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        195   3e-52    
gb|KJB59940.1|  hypothetical protein B456_009G282000                    192   3e-52    
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        195   3e-52    
ref|XP_002535159.1|  Thermostable beta-glucosidase B, putative          187   3e-52    
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            191   4e-52    
ref|XP_002448225.1|  hypothetical protein SORBIDRAFT_06g023450          191   4e-52    
gb|KHN09132.1|  Putative beta-D-xylosidase 7                            190   4e-52    
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7            191   4e-52    
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                191   5e-52    
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              191   5e-52    
gb|AES97966.2|  glycoside hydrolase family 3 protein                    191   6e-52    
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                191   7e-52    
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          191   7e-52    
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         191   8e-52    
ref|XP_002299457.1|  hypothetical protein POPTR_0001s10850g             190   1e-51    
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              190   1e-51    
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            190   1e-51    
ref|XP_003615006.1|  Xylan 1 4-beta-xylosidase                          189   1e-51    
ref|XP_001775759.1|  predicted protein                                  190   1e-51    
ref|XP_010105119.1|  putative beta-D-xylosidase 6                       190   1e-51    
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             190   1e-51    
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg                190   1e-51    
ref|XP_006383491.1|  hypothetical protein POPTR_0005s16650g             190   1e-51    
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             189   2e-51    
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5            190   2e-51    
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...    190   2e-51    
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             189   2e-51    
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    189   2e-51    
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    189   3e-51    
ref|XP_003615019.1|  hypothetical protein MTR_5g062650                  189   3e-51    
emb|CDP02677.1|  unnamed protein product                                189   3e-51    
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       189   3e-51    
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            189   3e-51    
gb|ACF84224.1|  unknown                                                 185   3e-51    
gb|KJB29303.1|  hypothetical protein B456_005G093200                    189   3e-51    
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            189   3e-51    
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            189   3e-51    
gb|KJB16244.1|  hypothetical protein B456_002G219200                    186   3e-51    
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             189   4e-51    
ref|XP_002527511.1|  Beta-glucosidase, putative                         189   4e-51    
ref|XP_008371868.1|  PREDICTED: probable beta-D-xylosidase 7            188   5e-51    
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   188   5e-51    
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   188   6e-51    
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             188   6e-51    
gb|EPS73741.1|  hypothetical protein M569_01013                         188   6e-51    
gb|KHG02566.1|  putative beta-D-xylosidase 7                            188   6e-51    
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       188   6e-51    
gb|KHG02565.1|  putative beta-D-xylosidase 7                            188   7e-51    
gb|EMS60786.1|  putative beta-D-xylosidase 6                            187   9e-51    
ref|XP_003580200.2|  PREDICTED: probable beta-D-xylosidase 6            187   9e-51    
gb|ACN26782.1|  unknown                                                 185   9e-51    
emb|CDP01027.1|  unnamed protein product                                191   9e-51    
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   187   1e-50    
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg             187   1e-50    
gb|EPS70883.1|  hypothetical protein M569_03875                         187   1e-50    
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             187   1e-50    
gb|AAD09291.1|  beta-glucosidase                                        176   1e-50    
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            187   2e-50    
gb|EYU23222.1|  hypothetical protein MIMGU_mgv1a021704mg                187   2e-50    
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  187   2e-50    
gb|EYU23225.1|  hypothetical protein MIMGU_mgv1a002689mg                186   2e-50    
emb|CDY58860.1|  BnaCnng33860D                                          186   2e-50    
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                186   2e-50    
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          186   3e-50    
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                186   3e-50    
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       186   3e-50    
ref|XP_009373165.1|  PREDICTED: probable beta-D-xylosidase 7            186   3e-50    
ref|XP_007035964.1|  Glycosyl hydrolase family protein                  186   4e-50    
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899             186   4e-50    
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            186   4e-50    
gb|KHG05631.1|  putative beta-D-xylosidase 7 -like protein              185   4e-50    
gb|KJB16242.1|  hypothetical protein B456_002G219200                    186   5e-50    
gb|KJB16243.1|  hypothetical protein B456_002G219200                    186   5e-50    
ref|XP_002975008.1|  hypothetical protein SELMODRAFT_103038             185   5e-50    
ref|XP_002452540.1|  hypothetical protein SORBIDRAFT_04g027700          185   6e-50    
gb|EYU33329.1|  hypothetical protein MIMGU_mgv1a001598mg                185   6e-50    
emb|CAJ65923.1|  xylan 1,4-beta-xylosidase                              185   6e-50    
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             185   7e-50    
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       185   8e-50    
gb|KDO78121.1|  hypothetical protein CISIN_1g047862mg                   185   9e-50    
ref|NP_001130324.1|  putative O-Glycosyl hydrolase superfamily pr...    185   9e-50    
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       185   9e-50    
ref|XP_006468194.1|  PREDICTED: probable beta-D-xylosidase 5-like       185   1e-49    
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            184   1e-49    
gb|KJB59094.1|  hypothetical protein B456_009G239100                    185   1e-49    
emb|CDP01028.1|  unnamed protein product                                184   2e-49    
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    184   2e-49    
gb|EEC74020.1|  hypothetical protein OsI_08964                          184   2e-49    
ref|NP_001048140.1|  Os02g0752200                                       184   2e-49    
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       184   2e-49    
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            184   2e-49    
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    184   2e-49    
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       184   2e-49    
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            184   3e-49    
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            183   3e-49    



>dbj|BAC98299.1| LEXYL2 [Solanum lycopersicum]
Length=633

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 189/230 (82%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PKVTSILW GFPGEAGG A+ADV+FGYHNP GRLP TWYPQS+ D V M +
Sbjct  404  MDVKFAVDNPKVTSILWVGFPGEAGGAALADVVFGYHNPGGRLPMTWYPQSYVDKVDMTN  463

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DPKTG+PGR+YRFY GPT+F FG GLSYT+++H +V+A   VS+ L++GH CRST
Sbjct  464  MNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYTQYKHHLVKAPKFVSIPLEEGHACRST  523

Query  448  KCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            KC+S+DA  EQ C +  LDIHL V+NVG + G H+VLLF+SPP++HNAP+K L+ FQK+ 
Sbjct  524  KCKSIDAVNEQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPPSVHNAPQKHLLDFQKIH  583

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+ I
Sbjct  584  LTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTLRI  633



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   329 bits (843),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 189/230 (82%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PKVTSILW GFPGEAGG A+ADV+FGYHNP GRLP TWYPQS+ D V M +
Sbjct  549  MDVKFAVDNPKVTSILWVGFPGEAGGAALADVVFGYHNPGGRLPMTWYPQSYVDKVDMTN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DPKTG+PGR+YRFY GPT+F FG GLSYT+++H +V+A   VS+ L++GH CRST
Sbjct  609  MNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYTQYKHHLVKAPKFVSIPLEEGHACRST  668

Query  448  KCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            KC+S+DA  EQ C +  LDIHL V+NVG + G H+VLLF+SPP++HNAP+K L+ FQK+ 
Sbjct  669  KCKSIDAVNEQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPPSVHNAPQKHLLDFQKIH  728

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+ I
Sbjct  729  LTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTLRI  778



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   328 bits (841),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 190/230 (83%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PKVTSI+W GFPGE GGGA+AD+IFGY+NPSGRLP TWYPQS+AD V M +
Sbjct  550  MDVQFAVDNPKVTSIVWIGFPGEDGGGALADIIFGYYNPSGRLPMTWYPQSYADKVDMTN  609

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DPKTG+PGR+YRFY GPT+F FG GLSY+ ++H +VQA   VS+ L++GH CRST
Sbjct  610  MNMRADPKTGFPGRSYRFYNGPTVFNFGDGLSYSNYKHHLVQAPKYVSIPLEEGHACRST  669

Query  448  KCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            +C+S+DA  EQ+C++   DIHL VKNVG +SG H+V LF+SPP++HNAP+K L+ FQK+ 
Sbjct  670  RCKSIDAVNEQSCSNLGYDIHLRVKNVGKMSGSHTVFLFTSPPSVHNAPQKHLLEFQKIH  729

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHIG LKHSLTV I
Sbjct  730  LTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLKHSLTVRI  779



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   328 bits (841),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 190/230 (83%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PKVTSI+W GFPGE GGGA+AD+IFGY+NPSGRLP TWYPQS+AD V M +
Sbjct  549  MDVQFAVDNPKVTSIVWIGFPGEDGGGALADIIFGYYNPSGRLPMTWYPQSYADKVDMTN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DPKTG+PGR+YRFY GPT+F FG GLSY+ ++H +VQA   VS+ L++GH CRST
Sbjct  609  MNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYSDYKHHLVQAPKYVSIPLEEGHACRST  668

Query  448  KCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            +C+S+DA  EQ+C++   DIHL VKNVG +SG H+V LF+SPP++HNAP+K L+ FQK+ 
Sbjct  669  RCKSIDAVNEQSCSNLGFDIHLRVKNVGKMSGSHTVFLFTSPPSVHNAPQKHLLEFQKIH  728

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHIG LKHSLTV I
Sbjct  729  LTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLKHSLTVRI  778



>emb|CBI20072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 183/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ D V M +
Sbjct  105  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPTTWYPQSYVDKVPMTN  164

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H ++QA  SVS+ +++GH C S+
Sbjct  165  MNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLIQAPKSVSIPIEEGHSCHSS  224

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV +
Sbjct  225  KCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFV  284

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  285  TAKAEALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  333



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PKVTSILW GFPGEAGG A+ADV+FGY NPSGRLP TWYPQS+ D V M +
Sbjct  549  MDVKFAVDNPKVTSILWVGFPGEAGGAALADVVFGYFNPSGRLPMTWYPQSYVDKVDMTN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DPKTG+PGR+YRFY GPT+F FG GLSYT+++H +V+A   VS+ L++GH CRST
Sbjct  609  MNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYTQYKHHLVKAPKFVSIPLEEGHACRST  668

Query  448  KCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            KC+S+D+  EQ C +   DIHL V+NVG + G H+VLLF+SPP++HNAP+K L+ FQK+ 
Sbjct  669  KCKSIDSVNEQGCNNLGFDIHLKVQNVGKMRGSHTVLLFTSPPSVHNAPQKHLLDFQKIH  728

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+ I
Sbjct  729  LTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTLRI  778



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   323 bits (829),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 186/229 (81%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PK+TSILW GFPGEAGG A+ADVIFGY+NPSGRLP TWYPQS+AD V M D
Sbjct  542  MDVQFAVDNPKITSILWVGFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADVVPMTD  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP+P T YPGRTYRFYTGPT+F FG+GLSY++F+H + +A   VSL L + H CR +
Sbjct  602  MNMRPNPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHHLDKAPQFVSLPLGEKHTCRLS  661

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC++VDA  Q+C++   DIHL VKNVG +SG H + LF+SPP++HNAP+K L+GF+KV L
Sbjct  662  KCKTVDAVGQSCSNMGFDIHLRVKNVGKISGSHIIFLFTSPPSVHNAPKKHLLGFEKVHL  721

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +P  + VV FNV+VCKHLSV DE GNRKVALG HVLHIG LKHSLTV I
Sbjct  722  TPQGEGVVKFNVNVCKHLSVHDELGNRKVALGPHVLHIGDLKHSLTVRI  770



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 189/229 (83%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PK+TSILW GFPGEAGG A+ADVIFGY+NPSGRLP TWYPQS+AD+V M  
Sbjct  553  MDVQFAVDNPKITSILWVGFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADAVPMTI  612

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP T YPGRTYRFYTGPT+F FG+GLSY++F+H + QA   VS+ L++ H CRST
Sbjct  613  MNMRPDPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHRLDQAPTFVSIPLEEKHTCRST  672

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+S+D  EQ+C++   ++HL VKN+G +SG H++ LF+SPP++HNAP+K L+GF+KV L
Sbjct  673  KCKSIDTVEQSCSNLGFNVHLRVKNMGKISGSHTIFLFNSPPSVHNAPQKHLLGFEKVHL  732

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +P E+ VV FNVDVCKHLS  DE GN+KVALG HVLHIG LKHS TV+I
Sbjct  733  TPQEEGVVKFNVDVCKHLSGHDELGNKKVALGQHVLHIGDLKHSFTVKI  781



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA  DPKVTSILW GFPGEAGG AIADVIFGY+NPSGRLP TWYPQS+AD V+M D
Sbjct  540  MDVQFAKDDPKVTSILWVGFPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYADKVNMTD  599

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP+P TGYPGRTYRFY GPT+F FG GLSY+ F H++V+A   VS+ L++GH CRS+
Sbjct  600  MHMRPNPDTGYPGRTYRFYKGPTVFSFGDGLSYSTFNHNLVRAPKLVSVPLEEGHVCRSS  659

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  + TC +   DIH+ VKNVG +SG H+V LFSSPP +HNAP+K L+GFQK+ L
Sbjct  660  MCKSIDVVDHTCKNLGFDIHVRVKNVGHMSGSHTVFLFSSPPQVHNAPQKHLLGFQKLHL  719

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P  + +V FNVDVCKHLSVVDE GNRKVALG H+LH+G LKHSL + +
Sbjct  720  EPQGEGLVRFNVDVCKHLSVVDEKGNRKVALGEHLLHVGSLKHSLNLRV  768



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 187/229 (82%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PK+TSILW GFPGEAGG A+ADVIFGY+NPSGRLP TWYPQS+AD V M +
Sbjct  578  MDVQFAVDNPKITSILWVGFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADVVPMTN  637

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP+P T YPGRTYRFYTGPT+F FG+GLSY++F+H + +A   VSL L + H CR +
Sbjct  638  MNMRPNPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHHLDKAPQFVSLPLGEKHTCRLS  697

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC++VDA  Q+C++   DIHL VKNVG +SG H++ LF+SPP++HNAP+K L+GF+KV L
Sbjct  698  KCKTVDAVGQSCSNMGFDIHLRVKNVGKISGSHTIFLFTSPPSVHNAPKKHLLGFEKVHL  757

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +P  + VV FNVDVCKHLSV DE GNRKVALG HVLHIG LKHSLTV I
Sbjct  758  TPQGEGVVKFNVDVCKHLSVHDELGNRKVALGPHVLHIGDLKHSLTVRI  806



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FAV +PK+TSILW GFPGEAGG A+ADVIFGY+NPSGRLP TWYPQS+AD+V M  
Sbjct  556  MDVQFAVDNPKITSILWVGFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADAVPMTI  615

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP T YPGRTYRFYTGPT+F FG+GLSY++F+H + QA   VS+ L++ H CRST
Sbjct  616  MNMRPDPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHRLDQAPTFVSIPLEEKHTCRST  675

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+S+D  EQ+C++   ++HL VKN+G +SG H++ LF+SPP++HNAP+K L+GF+KV L
Sbjct  676  KCKSIDTVEQSCSNVGFNVHLRVKNMGKISGSHTIFLFNSPPSVHNAPQKHLLGFKKVHL  735

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +  E+ VV FNVDVCKHLSV DE GN+KVALG HVLHIG LKHS TV I
Sbjct  736  TAQEEGVVKFNVDVCKHLSVHDELGNKKVALGQHVLHIGDLKHSFTVRI  784



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 188/230 (82%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA  DPK+TSILW GFPGEAGG AIADVIFGY+NPSGRLP TWYPQS+ + V+M D
Sbjct  538  MDVQFAKDDPKITSILWVGFPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVEKVNMTD  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGR+YRFY GPT+F FGYGLSY++F H +V+A  SVS+ L++ H CRS+
Sbjct  598  MNMRADPTRGYPGRSYRFYKGPTVFSFGYGLSYSQFDHKLVKAPTSVSMDLEEDHVCRSS  657

Query  448  KCESVDAAEQTCA-SSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             C S+DAA ++C  ++A+++HL+VKNVG + G H+VLLFSSPP +H APRKQL+GF+KV 
Sbjct  658  TCRSIDAAGRSCKNNAAIEVHLSVKNVGRMGGAHTVLLFSSPPEVHGAPRKQLLGFEKVH  717

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L P  + VV FNVDVCKHLS+VDE GNRKVALG HVLH+G+LKHSL V I
Sbjct  718  LVPQGEGVVRFNVDVCKHLSLVDEKGNRKVALGEHVLHVGNLKHSLNVII  767



>gb|KCW63063.1| hypothetical protein EUGRSUZ_G00654 [Eucalyptus grandis]
Length=621

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 186/229 (81%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+AD+IFG HNPSGRLP TWYPQS+AD+V M +
Sbjct  393  MDVSFAKDNDKITSILWVGYPGEAGGAAMADLIFGDHNPSGRLPMTWYPQSYADTVPMTN  452

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTGPTL+ FG GLSY+ F HS+VQA   +S+ L++GH CRS+
Sbjct  453  MTMRPDPAMGYPGRTYRFYTGPTLYSFGDGLSYSSFNHSLVQAPRVMSVPLEEGHVCRSS  512

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP++H AP+KQL+GF+KV L
Sbjct  513  ACESLEATGETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPSVHRAPQKQLLGFEKVFL  572

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VDVCK LSVVDE G+RKVALG++VLH+G LKH+L+V+I
Sbjct  573  ASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKHALSVQI  621



>gb|KCW63062.1| hypothetical protein EUGRSUZ_G006531, partial [Eucalyptus grandis]
Length=642

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+ADVIFG HNPSGRLP TWYPQS+AD+V M +
Sbjct  401  MDVSFAKDNDKITSILWVGYPGEAGGAAMADVIFGDHNPSGRLPMTWYPQSYADAVPMTN  460

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFYTGPT++KFG GLSY+ F HS+VQA   VS+ L++GH CRS 
Sbjct  461  MNMRPDPATGYPGRTYRFYTGPTVYKFGDGLSYSNFSHSLVQAPQVVSVPLEEGHVCRSL  520

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L
Sbjct  521  ACESLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFL  580

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VD+CK L VVDE G +KVALG HVLHIG LKH+L+V+I
Sbjct  581  ASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHIGDLKHALSVQI  629



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 183/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA  DPK+TSILW GFPGEAGG AIADVI+GY+NP GRLP TWYPQS+ + V M +
Sbjct  540  MDVQFAKDDPKITSILWVGFPGEAGGAAIADVIYGYYNPCGRLPMTWYPQSYVEQVDMTN  599

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFYTGPT+FKFG GLSY++F H +V A   +S+ L++GH C+S+
Sbjct  600  MNMRPDPATGYPGRTYRFYTGPTVFKFGDGLSYSQFDHQLVTAPKLISIPLEEGHVCKSS  659

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C S+DA E++C ++A+++HL VKNVG  SG H+VLLFSSPP +HNA +K L+GF+K+ L
Sbjct  660  TCWSIDAVERSCKNAAVNVHLRVKNVGNYSGSHTVLLFSSPPQVHNAAQKHLLGFEKLHL  719

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +P  +  V F++DVCKHLSVVDE G RKVALG HVLH+G L HSL V I
Sbjct  720  TPQAEGQVRFDIDVCKHLSVVDENGARKVALGEHVLHVGSLTHSLNVMI  768



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   315 bits (806),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 183/230 (80%), Gaps = 2/230 (1%)
 Frame = -2

Query  805  DVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMIDM  626
            DV FA   PK+TSILW GFPGEAGG AIADVIFG HNPSGRLP TWYPQS+ D VSM DM
Sbjct  477  DVQFAKDSPKITSILWVGFPGEAGGAAIADVIFGLHNPSGRLPMTWYPQSYVDKVSMTDM  536

Query  625  RMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRSTK  446
             MRPDP TGYPGRTYRFY G T++ FG GL Y+ F HS+VQA   VS+ L++GH CRS+ 
Sbjct  537  HMRPDPATGYPGRTYRFYKGQTVYSFGDGLGYSTFTHSLVQAPKVVSVPLEEGHVCRSSS  596

Query  445  --CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
              C+S+DA EQ+C +   +IHL V+NVGT+SG H+VLLFSSPP++HNA +K L+GFQK+ 
Sbjct  597  STCKSIDAVEQSCKNLGFNIHLRVRNVGTMSGSHTVLLFSSPPSVHNAAQKHLLGFQKLH  656

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P  + +V FNVDVCKHLS+VDE GNRKVA+G HVLH G LKH+LTV I
Sbjct  657  LAPQTEGLVKFNVDVCKHLSMVDELGNRKVAVGEHVLHAGDLKHTLTVRI  706



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   315 bits (808),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 186/229 (81%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+AD+IFG HNPSGRLP TWYPQS+AD+V M +
Sbjct  549  MDVSFAKDNDKITSILWVGYPGEAGGAAMADLIFGDHNPSGRLPMTWYPQSYADTVPMTN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTGPTL+ FG GLSY+ F HS+VQA   +S+ L++GH CRS+
Sbjct  609  MTMRPDPAMGYPGRTYRFYTGPTLYSFGDGLSYSSFNHSLVQAPRVMSVPLEEGHVCRSS  668

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP++H AP+KQL+GF+KV L
Sbjct  669  ACESLEATGETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPSVHRAPQKQLLGFEKVFL  728

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VDVCK LSVVDE G+RKVALG++VLH+G LKH+L+V+I
Sbjct  729  ASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKHALSVQI  777



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   315 bits (808),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+ADVIFG HNPSGRLP TWYPQS+AD+V M +
Sbjct  548  MDVSFAKDNDKITSILWVGYPGEAGGAAMADVIFGDHNPSGRLPMTWYPQSYADAVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFYTGPT++ FG GLSY+ F H++VQ    VS+ L++GH CRS+
Sbjct  608  MNMRPDPATGYPGRTYRFYTGPTVYLFGDGLSYSNFSHTLVQVPQLVSVPLEEGHVCRSS  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H APRK L+GF+KV L
Sbjct  668  ACESLEATNEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPRKHLLGFEKVFL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VDVCK L VVDE G RKVALG+H+LH+G LKH+L+V+I
Sbjct  728  ASQSEAQVQFKVDVCKDLGVVDELGCRKVALGMHILHVGDLKHALSVQI  776



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   315 bits (807),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+ADVIFG HNPSGRLP TWYPQS+AD+V M +
Sbjct  548  MDVSFAKDNDKITSILWVGYPGEAGGAAMADVIFGDHNPSGRLPMTWYPQSYADAVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFYTGPT++KFG GLSY+ F HS+VQA   VS+ L++GH CRS 
Sbjct  608  MNMRPDPATGYPGRTYRFYTGPTVYKFGDGLSYSNFSHSLVQAPQVVSVPLEEGHVCRSL  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L
Sbjct  668  ACESLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VD+CK L VVDE G +KVALG HVLHIG LKH+L+V+I
Sbjct  728  ASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHIGDLKHALSVQI  776



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   312 bits (800),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIAD+IFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  542  MDVSFAKSNDKITSILWVGYPGEAGGAAIADIIFGYYNPSGRLPMTWYPQSYVDKVPMTN  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGR+YRFYTG T++ FG GLSY+KF   +VQA   V++ L++GH C+ST
Sbjct  602  MNMRPDPSSGYPGRSYRFYTGETVYSFGDGLSYSKFEQQLVQAPKLVTVPLEEGHACQST  661

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC SVDA ++TC + A DIHL VKN+G + G H+V LFS+PP++HN+P+K LV F+KV L
Sbjct  662  KCISVDAVDRTCQNLAFDIHLKVKNMGRIRGSHTVFLFSTPPSVHNSPQKHLVDFEKVSL  721

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                   V F VD+CKHLSVVDE GNRK+ALG H+LH+G+LKHS+T+ I
Sbjct  722  DAQTHSTVQFKVDICKHLSVVDEFGNRKIALGEHILHVGNLKHSMTLRI  770



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   312 bits (800),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ D V M +
Sbjct  546  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +VQA  SVS+ +++GH C S+
Sbjct  606  MNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQAPKSVSIPIEEGHSCHSS  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA +++C +   DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV +
Sbjct  666  KCKSVDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFV  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  726  TAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  774



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 185/229 (81%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+ADVIFG HNPSGRLP TWYPQS+AD+V M +
Sbjct  548  MDVSFAKDNDKITSILWVGYPGEAGGAAMADVIFGDHNPSGRLPMTWYPQSYADAVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFYTGPT++ FG GLSY+ F HS+VQA   VS+ L++GH CRS+
Sbjct  608  MNMRPDPATGYPGRTYRFYTGPTVYSFGDGLSYSNFSHSLVQAPQLVSVPLEEGHVCRSS  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L
Sbjct  668  ACKSLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VDVCK LSVVDE G+ KVALG HVLH+G LKH+L+V+I
Sbjct  728  ASQSEAQVQFKVDVCKDLSVVDELGHWKVALGTHVLHVGDLKHALSVQI  776



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   310 bits (794),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA  +PK+TSILW GFPGEAGG AIADVIFG +NPSGRL  TWYPQS+ + V M D
Sbjct  540  MDVQFAKYNPKITSILWVGFPGEAGGAAIADVIFGQYNPSGRLTMTWYPQSYVEKVEMTD  599

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFY GPT+F FG GLSY++F H +V A   VS+ L++GH C+S+
Sbjct  600  MNMRPDPARGYPGRTYRFYNGPTVFNFGDGLSYSQFNHQLVTAPTLVSIPLEEGHVCQSS  659

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C S++  EQ+C ++++D+HL VKNVG  SG H+VLLFSSPP +HNAPRK L+G+QK+ L
Sbjct  660  TCRSINPVEQSCKNASIDVHLRVKNVGNYSGSHTVLLFSSPPQVHNAPRKHLIGYQKLHL  719

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +P  + +V FN+DVCKHLS+VDE GN+KVALG ++LHIG L HSL V I
Sbjct  720  TPQAEGLVRFNIDVCKHLSIVDENGNQKVALGEYILHIGSLMHSLHVVI  768



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   310 bits (793),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+ SILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ D V M +
Sbjct  546  FDISFAKNDDKIASILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +VQA  SVS+ +++GH C S+
Sbjct  606  MNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQAPKSVSIPIEEGHSCHSS  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV +
Sbjct  666  KCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFV  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LS+VDE G +KVALGLHVLH+G LKHSL V I
Sbjct  726  TAKAEALVRFKVDVCKDLSIVDELGTQKVALGLHVLHVGSLKHSLNVRI  774



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  D K+TSILW G+PGEAGG AIAD+IFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  547  MDVSFARTDDKITSILWVGYPGEAGGAAIADIIFGYYNPSGRLPMTWYPQSYVDKVPMTN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H ++QA   VS+ L++ H C S+
Sbjct  607  MNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSQFTHELIQAPRLVSVPLEESHVCHSS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV A+EQTC +S  D+ L VKNVGTVSG H+VLLFSSPPA+HNAP+K LVGF+KV L
Sbjct  667  ECQSVVASEQTCQNSTFDMLLRVKNVGTVSGSHTVLLFSSPPAVHNAPQKHLVGFKKVFL  726

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +      V F V++CK LS+VDE G++KVALG HVLH+G LKH L+V I
Sbjct  727  NAQTGRHVRFKVNICKDLSLVDELGSKKVALGEHVLHVGSLKHFLSVRI  775



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG A+ADVIFG HNPSGRLP TWYPQS+ D+V M +
Sbjct  549  MDVSFAKDNAKITSILWVGYPGEAGGAAMADVIFGDHNPSGRLPMTWYPQSYVDAVPMTN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFYTGPT++ FG GLSY+ F H  VQA   VS+ LD+GH C S+
Sbjct  609  MNMRPDPATGYPGRTYRFYTGPTVYSFGDGLSYSSFSHGQVQAPQLVSVPLDEGHICHSS  668

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP++H +P+K L+GF+KV L
Sbjct  669  ACESLEAKSETCSNLVFDVHLNVKNVGRFSGSHTVFLFSSPPSVHRSPQKHLLGFEKVFL  728

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  V F VDVCK LSVVDE G RKVALG HVLH+G LKH+L+V+I
Sbjct  729  ASQSEAQVQFKVDVCKDLSVVDELGGRKVALGTHVLHVGDLKHALSVQI  777



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 183/230 (80%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA ++PK+T ILWAGFPGEAGG AIADVIFG HNPSGRLP TWYPQS+A+ V+M D
Sbjct  548  MDVQFAKENPKITGILWAGFPGEAGGTAIADVIFGSHNPSGRLPLTWYPQSYAEKVNMTD  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSV-SLALDQGHPCRS  452
            M MRP+P TGYPGRTYRFY GPT++ FGYGLSY++F+H + +   ++ ++ L++GH C+S
Sbjct  608  MNMRPNPTTGYPGRTYRFYIGPTVYPFGYGLSYSEFKHLLAEPLPTIMTVDLEEGHACQS  667

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            + C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRKQLV F+KV 
Sbjct  668  SDCKSVDAVEPMCKNLGFGVHLTVKNVGKLTGSHTVLVFSRPPRVHNAPRKQLVAFRKVH  727

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LKHS  V I
Sbjct  728  LRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHSFNVTI  777



>emb|CAN78858.1| hypothetical protein VITISV_030325 [Vitis vinifera]
Length=699

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSI W G+PGEAGG AIADVIFG++NPSG+LP TWYPQS+ D V M +
Sbjct  471  FDISFAKNDDKITSIQWVGYPGEAGGAAIADVIFGFYNPSGKLPMTWYPQSYVDKVPMTN  530

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +VQA  SVS+ +++ H C S+
Sbjct  531  MNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQAPKSVSIPIEEAHSCHSS  590

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV +
Sbjct  591  KCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFV  650

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  651  TAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  699



>gb|KJB31996.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
 gb|KJB31998.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=507

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  279  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTN  338

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A   VS+ L++ H CRS+
Sbjct  339  MNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKAPRLVSIPLEEDHVCRSS  398

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L
Sbjct  399  ECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSL  458

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  459  TGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVGI  507



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  + K+TSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  559  FDISFAKNNDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTN  618

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGRTYRFYTG T++ FG GLSY+KF H +V+A   VS+ L++ H CRS+
Sbjct  619  MNMRPDPSSGYPGRTYRFYTGETIYTFGDGLSYSKFSHQLVKAPQLVSIPLEEVHVCRSS  678

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SVDA EQ+C + A DIHL V+N G  SG H+V LFS+PP++HN+PRK L+GF+KV L
Sbjct  679  ECKSVDAIEQSCKNLAFDIHLRVQNKGRNSGSHTVFLFSTPPSVHNSPRKHLLGFEKVLL  738

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE G+RKV+LG HVLH+G LKHSL V I
Sbjct  739  TGKSESLVRFKVDVCKDLSVVDERGSRKVSLGQHVLHVGSLKHSLNVRI  787



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -2

Query  805  DVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMIDM  626
            D++FA  D K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQ++ D V M +M
Sbjct  547  DITFAKNDDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQAYVDKVPMNNM  606

Query  625  RMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRSTK  446
             MRPDP +GYPGRTYRFYTG T+++FG+GLSY+ F H +VQA   VS+ L+Q H C S+ 
Sbjct  607  NMRPDPASGYPGRTYRFYTGDTVYEFGHGLSYSNFSHRLVQAPKQVSIPLEQDHVCHSSS  666

Query  445  CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  266
            C+S+D  E+ C + A DIH+ VKN+G +SG H+V+L+SSPP++HNAP+K L+GF+KV LS
Sbjct  667  CQSLDVVEERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPSVHNAPKKHLLGFEKVFLS  726

Query  265  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
              ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK +L+V I
Sbjct  727  SQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQTLSVRI  774



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   306 bits (783),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -2

Query  805  DVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMIDM  626
            D++FA  D K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQ++ D V M +M
Sbjct  572  DITFAKNDDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQAYVDKVPMNNM  631

Query  625  RMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRSTK  446
             MRPDP +GYPGRTYRFYTG T+++FG+GLSY+ F H +VQA   VS+ L+Q H C S+ 
Sbjct  632  NMRPDPASGYPGRTYRFYTGDTVYEFGHGLSYSNFSHRLVQAPKQVSIPLEQDHVCHSSS  691

Query  445  CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  266
            C+S+D  E+ C + A DIH+ VKN+G +SG H+V+L+SSPP++HNAP+K L+GF+KV LS
Sbjct  692  CQSLDVVEERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPSVHNAPKKHLLGFEKVFLS  751

Query  265  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
              ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK +L+V I
Sbjct  752  SQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQTLSVRI  799



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   305 bits (780),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ D V M +
Sbjct  551  FDISFAKNDSKITSILWVGYPGEAGGAAIADVIFGHYNPSGRLPMTWYPQSYVDKVPMTN  610

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GL Y+ F H +V+A   VS+ L++GH C S+
Sbjct  611  MNMRPDASNGYPGRTYRFYTGETVYSFGDGLGYSAFNHKLVRAPKLVSIPLEEGHVCHSS  670

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  ++ C + A DIHL VKN G++SGGH+VLLFSSPP++HN+P+K L+GF+KV L
Sbjct  671  SCKSLDVVQERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPSVHNSPQKHLLGFEKVFL  730

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  731  SAQREELVKFKVDVCKHLSVVDELGNRKVALGQHVLHVGSLKHSFSVGI  779



>gb|KJB31997.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=631

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  403  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTN  462

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A   VS+ L++ H CRS+
Sbjct  463  MNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKAPRLVSIPLEEDHVCRSS  522

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L
Sbjct  523  ECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSL  582

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  583  TGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVGI  631



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   302 bits (774),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 179/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFG++NP GRLP TWYPQS+ D V M +
Sbjct  551  FDISFAKNDSKITSILWVGYPGEAGGAAIADVIFGHYNPCGRLPMTWYPQSYVDKVPMTN  610

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GL Y+ F H +V+A   VS+ L++GH C S+
Sbjct  611  MNMRPDASNGYPGRTYRFYTGETVYSFGDGLGYSAFNHKLVRAPKLVSIPLEEGHVCHSS  670

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  ++ C + A DIHL VKN G++SGGH+VLLFSSPP++HN+P+K L+GF+KV L
Sbjct  671  SCKSLDVVQERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPSVHNSPQKHLLGFEKVFL  730

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  731  SAQREELVKFKVDVCKHLSVVDELGNRKVALGPHVLHVGSLKHSFSVGI  779



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   302 bits (774),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 177/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIAD+IFG +NPSGRLP TWYPQS+ D V M +
Sbjct  550  MDVSFAKTNDKITSILWVGYPGEAGGAAIADIIFGSYNPSGRLPMTWYPQSYVDKVPMTN  609

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H + QA   VS+ L++ H C S+
Sbjct  610  MNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEFSHELTQAPGLVSVPLEENHVCYSS  669

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV AAEQTC +   D+HL +KN GT SG H+V LFS+PP++HN+P+K LVGF+KV L
Sbjct  670  ECKSVAAAEQTCQNLTFDVHLRIKNTGTTSGSHTVFLFSTPPSVHNSPQKHLVGFEKVFL  729

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHS+TV I
Sbjct  730  HAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSMTVRI  778



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   301 bits (772),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIAD+IFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  545  MDVSFARTNDKITSILWVGYPGEAGGAAIADIIFGYYNPSGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H ++QA   V + L++ H C S+
Sbjct  605  MNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSQFTHELIQAPQLVYVPLEESHVCHSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV A+EQTC +S  D+ L VKN GT+SG H+V LFSSPPA+HN+P+K LVGF+KV L
Sbjct  665  ECQSVVASEQTCQNSTFDMLLRVKNEGTISGSHTVFLFSSPPAVHNSPQKHLVGFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +      V F VD+CK LSVVDE G++KVALG HVLH+G LKH L+V I
Sbjct  725  NAQTGRHVRFKVDICKDLSVVDELGSKKVALGEHVLHVGSLKHFLSVRI  773



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  551  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTN  610

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A   VS+ L++ H CRS+
Sbjct  611  MNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKAPRLVSIPLEEDHVCRSS  670

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L
Sbjct  671  ECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSL  730

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  731  TGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVRI  779



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSILW G+PGEAGG A+ADV+FG +NPSGRLP TWYPQS+ D V M +
Sbjct  545  FDITFAKNDTKITSILWVGYPGEAGGAAVADVVFGQYNPSGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GL Y+ F H +V+A   VS+ L++GH C S+
Sbjct  605  MNMRPDPSNGYPGRTYRFYTGETVYSFGDGLGYSAFNHKLVRAPKLVSIPLEEGHVCHSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  E+ C + A DIHL VKN+G +SG H+V+LFSSPPA+H +P+K L+GF+KV +
Sbjct  665  SCKSLDVVEERCENLAFDIHLGVKNMGRMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFV  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  725  SAKREALVKFNVDVCKHLSVVDELGNRKVALGKHVLHVGSLKHSFSVRI  773



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 181/230 (79%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA +D K+T+ILW GFPGEAGG AIADVIFG HNPSGRLP TWYPQS+A+ V+M D
Sbjct  541  MDVQFAKEDSKITAILWVGFPGEAGGAAIADVIFGSHNPSGRLPMTWYPQSYAEKVNMTD  600

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSV-SLALDQGHPCRS  452
            M MR + KTGYPGRTYRFYTGPT+++FG+GLSY+ F+H + +   ++ +++L+ GH C+S
Sbjct  601  MNMRHNSKTGYPGRTYRFYTGPTIYQFGFGLSYSGFKHRLAEPLPTIMTVSLETGHACQS  660

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            + C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRKQLV F+KV 
Sbjct  661  SDCKSVDAVEPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPPRVHNAPRKQLVAFRKVH  720

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LKH   V I
Sbjct  721  LRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHFFNVTI  770



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 181/230 (79%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDV FA +D K+T+ILW GFPGEAGG AIADVIFG HNPSGRLP TWYPQS+A+ V+M D
Sbjct  544  MDVQFAKEDSKITAILWVGFPGEAGGAAIADVIFGSHNPSGRLPMTWYPQSYAEKVNMTD  603

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSV-SLALDQGHPCRS  452
            M MR + KTGYPGRTYRFYTGPT+++FG+GLSY+ F+H + +   ++ +++L+ GH C+S
Sbjct  604  MNMRHNSKTGYPGRTYRFYTGPTIYQFGFGLSYSGFKHRLAEPLPTIMTVSLETGHACQS  663

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            + C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRKQLV F+KV 
Sbjct  664  SDCKSVDAVEPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPPRVHNAPRKQLVAFRKVH  723

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LKH   V I
Sbjct  724  LRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHFFNVTI  773



>gb|ACL53913.1| unknown [Zea mays]
 gb|ACN36701.1| unknown [Zea mays]
 gb|AFW59617.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=405

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FGYHNPSGRLP TWYP+SF   V M D
Sbjct  178  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGYHNPSGRLPVTWYPESFT-KVPMTD  236

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A   ++L L +GH C + 
Sbjct  237  MRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPKQLALQLAEGHACLTE  296

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  297  QCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSL  356

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  357  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  405



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  551  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTN  610

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A   VS+ L++ H CRS+
Sbjct  611  MNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKAPRLVSIPLEEDHVCRSS  670

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P+K L+GF+KV L
Sbjct  671  ECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSPQKHLLGFEKVSL  730

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV I
Sbjct  731  TGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVGI  779



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 178/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+TSILW G+PGEAGG A+ADV+FG++NP GRLP TWYPQS+ D V M +
Sbjct  545  FDITFAKINTKITSILWVGYPGEAGGAAVADVVFGHYNPCGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSY+ F H +VQA   VS+ L++GH C S+
Sbjct  605  MNMRPDASNGYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVQAPKLVSIPLEEGHVCHSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  E+ C + A DIHL VKN G++SG H+V+LFSSPPA+H +P+K L+GF+KV L
Sbjct  665  SCKSLDVVEERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  725  SAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKHSFSVRI  773



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   299 bits (766),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+++ILW G+PGEAGG A+AD++FGYHNP GRLP TWYP SFAD VSM D
Sbjct  537  FDISFAKSSDKISAILWVGYPGEAGGAALADILFGYHNPGGRLPVTWYPASFADKVSMTD  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPD  TGYPGRTYRFYTG T++ FG GLSYTKF HS+V A + V++ L +GH C + 
Sbjct  597  MRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSAPEQVAVQLAEGHACHTE  656

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K L+GF+KV L
Sbjct  657  HCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSL  716

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  717  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  765



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   299 bits (766),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/230 (63%), Positives = 178/230 (77%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQ++ D V M +
Sbjct  548  MDVSFAKTNDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQAYVDKVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCR-S  452
            M MRPDP +GYPGRTYRFYTG T++ FG GLSY++++H +VQA   VS+ L+  H CR S
Sbjct  608  MNMRPDPSSGYPGRTYRFYTGETVYSFGDGLSYSEYKHQLVQAPQLVSIPLEDDHVCRSS  667

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            +KC SVDA EQ C   A +I L V+N+G V G H+V LF +PP++HN+P+K LV F+KV 
Sbjct  668  SKCISVDAGEQNCQGLAFNIDLKVRNIGKVRGTHTVFLFFTPPSVHNSPQKHLVDFEKVS  727

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L      +V F VDVCKHLSVVDE G+RKVALG HVLH+G+L+HSLTV I
Sbjct  728  LDAKTYGMVSFKVDVCKHLSVVDEFGSRKVALGGHVLHVGNLEHSLTVRI  777



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 177/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSILW G+PGEAGG A+ADV+FG +NPSGRLP TWYPQS+ D V M +
Sbjct  545  FDITFAKNDTKITSILWVGYPGEAGGAAVADVVFGQYNPSGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRF TG T++ FG GL Y+ F H +V+A   VS+ L++GH C S+
Sbjct  605  MNMRPDPSNGYPGRTYRFXTGETVYSFGDGLGYSTFNHKLVRAPKLVSIPLEEGHVCHSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  E+ C + A DIHL VKN+G++SG H+V+LFSSPPA+H +P+K L+GF+KV +
Sbjct  665  SCKSLDVVEERCENLAFDIHLGVKNMGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFV  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S     +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V I
Sbjct  725  SAQRVALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKHSFSVRI  773



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD+SFA  + K+TSILW G+PGEAGG A+ADVIFGY+NPSGRLP TWYPQ+FAD V M +
Sbjct  545  MDISFAKANNKITSILWVGYPGEAGGAALADVIFGYYNPSGRLPMTWYPQAFADKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP+P TGYPGRTYRFY G T++ FG G+SY++F H +V+A   VS+ L++GH CRS 
Sbjct  605  MNMRPNPATGYPGRTYRFYRGETIYSFGDGMSYSQFSHHLVRAPKLVSVPLEEGHICRSQ  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+S+   E+ C + A +IHL V+N+G +SG H+V LFS+PP++HNAP K L+GF+KV L
Sbjct  665  KCKSIHLEEEGCRNLAFEIHLRVRNMGRMSGSHTVFLFSTPPSVHNAPNKHLLGFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V FNVDVCK LSVVDE G RKVALG HVLH+G LKHSL + I
Sbjct  725  TSQNEALVKFNVDVCKDLSVVDELGRRKVALGSHVLHVGSLKHSLNIRI  773



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 174/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA     ++SILW G+PGEAGG AIAD+IFG+ NPSGRLP TWYPQSFADSV M D
Sbjct  541  FDISFAKTSDDISSILWVGYPGEAGGAAIADIIFGHCNPSGRLPVTWYPQSFADSVPMTD  600

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP T YPGRTYRFYTG  +++FG GLSYT + H +V+A   VS+ L++GH C S 
Sbjct  601  MRMRPDPSTDYPGRTYRFYTGDAVYEFGDGLSYTDYTHHLVKAPKMVSIPLEEGHSCYSQ  660

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SVD A   C   A D+HL V+N G ++G H+V LFSSPPA+HNAPRK L+GF+KV L
Sbjct  661  RCNSVDLAGNACDGLAFDVHLRVQNSGGMAGSHTVFLFSSPPAVHNAPRKHLLGFEKVYL  720

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P     VVF VDVCK LSVVDE GNRK+ALG HVLH G LKHSL+++I
Sbjct  721  GPKAAGDVVFKVDVCKDLSVVDELGNRKLALGSHVLHAGSLKHSLSLKI  769



>gb|AFW59618.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=475

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FGYHNPSGRLP TWYP+SF   V M D
Sbjct  248  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGYHNPSGRLPVTWYPESFT-KVPMTD  306

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A   ++L L +GH C + 
Sbjct  307  MRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPKQLALQLAEGHACLTE  366

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  367  QCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSL  426

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  427  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  475



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+++ILW G+PGEAGG A+AD++FGYHNP GRLP TWYP SFAD VSM D
Sbjct  611  FDISFAKSSDKISAILWVGYPGEAGGAALADILFGYHNPGGRLPVTWYPASFADKVSMTD  670

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPD  TGYPGRTYRFYTG T++ FG GLSYTKF HS+V A + V++ L +GH C + 
Sbjct  671  MRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSAPEQVAVQLAEGHACHTE  730

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K L+GF+KV L
Sbjct  731  HCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSL  790

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  791  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  839



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D +++SILW G+PGEAGG A+AD+IFGY+NP GRLP TWYPQSFAD V M D
Sbjct  545  FDISFAKSDDRISSILWVGYPGEAGGAALADIIFGYYNPCGRLPVTWYPQSFADKVPMTD  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG  ++ FG GLSY  F H +VQA   VS+ L++GH C S 
Sbjct  605  MRMRPDPSTGYPGRTYRFYTGDVIYSFGDGLSYNDFTHHLVQAPKLVSIPLEEGHSCYSK  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SVD     C ++A DIHL V+N G ++G H+V LFS+PP++HN+P+K L+GF+K+ L
Sbjct  665  RCKSVDLVGSRCQNAAFDIHLRVQNPGRMAGSHTVFLFSTPPSVHNSPQKHLLGFEKIYL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P     VVFNVDVCK LS+VDE GNR VALG HVLH+G LKHSL V +
Sbjct  725  GPKXVGYVVFNVDVCKDLSLVDELGNRMVALGSHVLHVGSLKHSLRVRV  773



>ref|NP_001146416.1| uncharacterized protein LOC100279996 [Zea mays]
 gb|ACN32073.1| unknown [Zea mays]
Length=507

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FGYHNPSGRLP TWYP+SF   V M D
Sbjct  280  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGYHNPSGRLPVTWYPESFT-KVPMTD  338

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A   ++L L +GH C + 
Sbjct  339  MRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPKQLALQLAEGHACLTE  398

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  399  QCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSL  458

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  459  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  507



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D +++SILW G+PGEAGG A+AD+IFGY+NPSGRLP TWYP+SFAD V M D
Sbjct  544  FDISFAKSDDRISSILWVGYPGEAGGAALADIIFGYYNPSGRLPVTWYPESFADKVPMTD  603

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG  ++ FG GLSY  + H +V+A   VS+ L++GH C S 
Sbjct  604  MRMRPDPSTGYPGRTYRFYTGDVVYSFGDGLSYNDYAHHLVRAPKLVSIPLEEGHSCYSK  663

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D     C + A DIHL V+N G ++G H+V LFS+PP++HN+P+KQL+GF+KV L
Sbjct  664  RCKSIDVVGSGCENVAFDIHLRVQNTGRMAGSHTVFLFSTPPSVHNSPQKQLLGFEKVYL  723

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P     VVF VDVCK LS+VDE GNRKVALG H+LH+G L HSL V +
Sbjct  724  GPQGVGNVVFKVDVCKDLSLVDELGNRKVALGSHILHVGSLMHSLKVRV  772



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  +  ++SILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQSFADSV M D
Sbjct  542  FDISFAKTNGNISSILWVGYPGEAGGAAIADVIFGYYNPSGRLPVTWYPQSFADSVPMTD  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMR DP TGYPGRTYRFYTG  +++FG GLSYT + H +V+A   VS+ L++GH C S 
Sbjct  602  MRMRADPSTGYPGRTYRFYTGDIVYEFGDGLSYTDYTHHLVKAPRLVSIPLEEGHSCDSR  661

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SVD A   C     D+HL V+N G  +G H+V LFS+PPA+H APRK LVGF+KV L
Sbjct  662  QCKSVDLAGTGCNDLGFDVHLRVRNSGNRAGSHTVFLFSTPPAVHGAPRKHLVGFEKVFL  721

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P     VVF VDVCK LSVVDE GNRK+ALG HVLH+G LKHSL++++
Sbjct  722  GPKAVGQVVFKVDVCKDLSVVDELGNRKLALGSHVLHVGSLKHSLSLKV  770



>gb|KHN39204.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=648

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG+HNPSGRLP TWYPQS+ D V M +
Sbjct  420  MDVSFAKNNNKITSILWVGYPGEAGGAAIADVIFGFHNPSGRLPMTWYPQSYVDKVPMTN  479

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G T+F FG GLSY+   H +V+A   VS+ L + H CRS+
Sbjct  480  MNMRPDPATGYPGRTYRFYKGETVFAFGDGLSYSSMVHKLVKAPQLVSVQLAEDHVCRSS  539

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D   + C +   DIHL +KN G +S  H+V LFS+PPA+HNAP+K L+GF+KV L
Sbjct  540  ECKSIDVVGEHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPAVHNAPQKHLLGFEKVHL  599

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + +V F VDVCK LS+VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  600  IGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKHPLSVMI  648



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   297 bits (760),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD++FA  D K+TSILW GFPGEAGG AIADVIFG  NPSGRLP TWYPQS+ + V M D
Sbjct  563  MDITFAKNDDKITSILWVGFPGEAGGAAIADVIFGSFNPSGRLPMTWYPQSYVEKVPMTD  622

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRP P  GYPGRTYRFYTG T++ FG GLSY+ F+H +V+A   VS+ L++GH C S+
Sbjct  623  MRMRPSPSNGYPGRTYRFYTGETVYSFGDGLSYSDFKHHLVKAPKLVSIPLEEGHICHSS  682

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P+K L+GF+KV L
Sbjct  683  KCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSPQKHLLGFEKVSL  742

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V +
Sbjct  743  GRGREMVVRFKVDVCKDLSVTDEVGSRKVALGLHILHVGTLKHSLNVRV  791



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   295 bits (755),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 177/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD++FA KD K+TSILW GFPGEAGG AIADVIFG  NPSGRLP TWYPQS+ + V M D
Sbjct  554  MDITFAKKDDKITSILWVGFPGEAGGAAIADVIFGSFNPSGRLPMTWYPQSYVEKVPMTD  613

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRP    G+PGRTYRFYTG T++ FG GLSY+ F+H +V+A   VS+ L++GH C S+
Sbjct  614  MRMRPSASNGFPGRTYRFYTGETIYSFGDGLSYSDFKHHLVKAPKLVSIPLEEGHICHSS  673

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P+K L+GF+KV L
Sbjct  674  KCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSPQKHLLGFEKVSL  733

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V++
Sbjct  734  GRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKHSLNVKV  782



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+TSILW G+PGEAGG A+ADV+FG++NP GRLP TWYPQS+ D V M +
Sbjct  545  FDITFAKNNTKITSILWVGYPGEAGGAAVADVVFGHYNPCGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSY+ F H +V+A   VS+ L++GH C S+
Sbjct  605  MNMRPDASKGYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVRAPKLVSIPLEEGHVCHSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  E+ C +   DIHL VKN G++SG H+V+LFSSPPA+H +P+K L+GF+KV L
Sbjct  665  SCKSLDVMEERCKNLVFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G L HS +V I
Sbjct  725  SAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLXHSFSVRI  773



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+TSILW G+PGEAGG A+ADV+FG++NP GRLP TWYPQS+ D V M +
Sbjct  545  FDITFAKNNTKITSILWVGYPGEAGGAAVADVVFGHYNPCGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD    YPGRTYRFYTG T++ FG GLSY+ F H +V+A   VS+ L++GH C S+
Sbjct  605  MNMRPDASNSYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVRAPKLVSIPLEEGHVCHSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  E+ C + A DIHL VKN G++SG H+V+LFSSPPA+H +P+K L+GF+KV L
Sbjct  665  SCKSLDVVEERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSPQKHLLGFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK S +V I
Sbjct  725  SAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKRSFSVRI  773



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   294 bits (753),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 172/229 (75%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFGYHNPSGRLP TWYPQS+ D V M +
Sbjct  546  MDVSFAKTNKKITSILWVGYPGEAGGAAIADVIFGYHNPSGRLPMTWYPQSYVDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G T+F FG G+SY+ F H +V+A   VS+ L + H CRS+
Sbjct  606  MNMRPDPATGYPGRTYRFYKGETVFSFGDGISYSTFEHKLVKAPQLVSVPLAEDHVCRSS  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+S+D   + C +   DIHL +KN G +S   +V LFS+PPA+HNAP+K L+ F+KV  
Sbjct  666  KCKSLDVVGEHCQNLVFDIHLRIKNKGKMSSSQTVFLFSTPPAVHNAPQKHLLAFEKVHF  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE GNRKVALG H+LH+G LKH L+V I
Sbjct  726  TGKSEALVSFKVDVCKDLSVVDELGNRKVALGKHMLHVGDLKHPLSVMI  774



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFGYHNPSGRLP TWYPQS+ D V M +
Sbjct  546  MDVSFAKTNKKITSILWVGYPGEAGGAAIADVIFGYHNPSGRLPMTWYPQSYVDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G T+F FG G+SY+ F H +V+A   VS+ L + H CRS+
Sbjct  606  MNMRPDPATGYPGRTYRFYKGETVFSFGDGISYSTFEHKLVKAPQLVSVPLAEDHVCRSS  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+S+D   + C + A DIHL +KN G +S   +V LFS+PPA+HNAP+K L+ F+KV L
Sbjct  666  KCKSLDVVGEHCQNLAFDIHLRIKNKGKMSSSQTVFLFSTPPAVHNAPQKHLLAFEKVLL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK L +VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  726  TGKSEALVSFKVDVCKDLGLVDELGNRKVALGKHMLHVGDLKHPLSVMI  774



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG+HNPSGRLP TWYPQS+ D V M +
Sbjct  537  MDVSFAKNNNKITSILWVGYPGEAGGAAIADVIFGFHNPSGRLPMTWYPQSYVDKVPMTN  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G T+F FG GLSY+   H +V+A   VS+ L + H CRS+
Sbjct  597  MNMRPDPATGYPGRTYRFYKGETVFAFGDGLSYSSIVHKLVKAPQLVSVQLAEDHVCRSS  656

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D   + C +   DIHL +KN G +S  H+V LFS+PPA+HNAP+K L+GF+KV L
Sbjct  657  ECKSIDVVGEHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPAVHNAPQKHLLGFEKVHL  716

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + +V F VDVCK LS+VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  717  IGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKHPLSVMI  765



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIAD+IFG +NPSGRLP TWYPQS+ D V M +
Sbjct  548  MDVSFAKTNDKITSILWVGYPGEAGGAAIADIIFGSYNPSGRLPMTWYPQSYVDKVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY++  H + QA   VS+ L++ H C S+
Sbjct  608  MNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEVSHELTQAPGLVSVPLEENHVCYSS  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV AAEQTC +    + L +KN GT+SG H+V LFS+PP++HN+P+K L+GF+KV L
Sbjct  668  ECKSVAAAEQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPSVHNSPQKHLLGFEKVFL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHSLTV I
Sbjct  728  HAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSLTVRI  776



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   294 bits (752),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+++ILW G+PGEAGG A+AD++FGYHNPSGRLP TWYP SFAD VSM D
Sbjct  548  FDISFAKSSDKISAILWVGYPGEAGGAALADILFGYHNPSGRLPVTWYPASFADKVSMTD  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPD  TGYPGRTYRFYTG T++ FG GLSYT F H +V A   V++ L +GH C + 
Sbjct  608  MRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTNFAHHLVSAPKQVAVQLAEGHACYTE  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C SV+AA + C + + D+HL V+N G V+G H+V LF+SPP++HNAP K L+GF+KV L
Sbjct  668  HCLSVEAAGEHCENLSFDVHLRVRNAGDVAGRHTVFLFTSPPSVHNAPAKHLLGFEKVSL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  728  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  776



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 179/229 (78%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+TSILW G+PGEAGG AIADVIFG++NP GRLP TWYPQ++ D V M +
Sbjct  571  FDITFAKNNDKITSILWVGYPGEAGGAAIADVIFGFYNPCGRLPMTWYPQAYVDKVPMTN  630

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP +GYPGRTYRFYTG T++ FG G+SY+ F H +V+A + VS+ L++ H C S+
Sbjct  631  MNMRADPASGYPGRTYRFYTGDTVYAFGDGISYSTFNHRLVRAPNQVSIPLEEDHVCYSS  690

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+D  E+ C + A DIHL VKN+G + G H+VLL+SSPP++HNAP+K L+GF+KV L
Sbjct  691  SCQSLDVVEERCQNLAFDIHLGVKNMGKMCGSHTVLLYSSPPSVHNAPKKHLLGFEKVFL  750

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G L+ +L+V I
Sbjct  751  SSQGEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLRQTLSVRI  799



>ref|XP_008661823.1| PREDICTED: uncharacterized protein LOC100279996 isoform X2 [Zea 
mays]
Length=653

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FGYHNPSGRLP TWYP+SF   V M D
Sbjct  426  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGYHNPSGRLPVTWYPESFT-KVPMTD  484

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A   ++L L +GH C + 
Sbjct  485  MRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPKQLALQLAEGHACLTE  544

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  545  QCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSL  604

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  605  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  653



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  DPK+TSILW G+PG+AGG AIADV FG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDISFAKNDPKITSILWVGYPGQAGGAAIADVCFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSY+   H +V+A   V++ L++GH C S+
Sbjct  605  MNMRPDASNGYPGRTYRFYTGETVYAFGDGLSYSTMNHELVRAPKIVAIPLEEGHVCYSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+SVDA EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP++H +P+K L+ F+KV L
Sbjct  665  NCKSVDAVEQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPSVHKSPQKHLLAFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E+ +V F VD CK LSVVDE GNRK+ALG H+LH+G+LKHSLTV I
Sbjct  725  KGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKHSLTVRI  773



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 177/229 (77%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD++FA KD K+TSILW GFPGEAGG AIADVIFG  NPSGRLP TWYPQS+ + V M D
Sbjct  581  MDITFAKKDDKITSILWVGFPGEAGGAAIADVIFGSFNPSGRLPMTWYPQSYVEKVPMTD  640

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRP    G+PGRTYRFYTG T++ FG GLSY+ F+H +V+A   VS+ L++GH C S+
Sbjct  641  MRMRPSASNGFPGRTYRFYTGETIYSFGDGLSYSDFKHHLVKAPKLVSIPLEEGHICHSS  700

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P+K L+GF+KV L
Sbjct  701  KCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSPQKHLLGFEKVSL  760

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V++
Sbjct  761  GRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKHSLNVKV  809



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIAD+IFG +NPSGRLP TWYPQS+ D V M +
Sbjct  548  MDVSFAKTNDKITSILWVGYPGEAGGPAIADIIFGSYNPSGRLPMTWYPQSYVDKVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFYTG T++ FG GLSY++  H + QA   VS+ L++ H C S+
Sbjct  608  MNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEVSHELTQAPGLVSVPLEENHVCYSS  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+SV AAEQTC +    + L +KN GT+SG H+V LFS+PP++HN+P+K L+GF+KV L
Sbjct  668  ECKSVAAAEQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPSVHNSPQKHLLGFEKVFL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHSLTV I
Sbjct  728  HAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSLTVRI  776



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 177/235 (75%), Gaps = 8/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPS------GRLPNTWYPQSFAD  647
            MDVSFA  + K+TSILW G+PGEAGG AIAD+IFG +NPS      GRLP TWYPQS+ D
Sbjct  525  MDVSFAKTNDKITSILWVGYPGEAGGAAIADIIFGSYNPSTHQPPGGRLPMTWYPQSYVD  584

Query  646  SVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG  467
             V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H + QA   VS+ L++ 
Sbjct  585  KVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEFSHELTQAPGLVSVPLEEN  644

Query  466  HPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            H C S++C+SV AAEQTC +   D+HL +KN GT SG H+V LFS+PP++HN+P+K LVG
Sbjct  645  HVCYSSECKSVAAAEQTCQN--FDVHLRIKNTGTTSGSHTVFLFSTPPSVHNSPQKHLVG  702

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHS+TV I
Sbjct  703  FEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSMTVRI  757



>ref|XP_010068199.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2, partial [Eucalyptus grandis]
Length=531

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 178/229 (78%), Gaps = 2/229 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TS L  G+PGEAGG A+ADVIFG HNPSGRLP TWYPQS+ D+V M +
Sbjct  286  MDVSFAKDNDKITSTLLVGYPGEAGGAAMADVIFGDHNPSGRLPMTWYPQSYVDAVPMTN  345

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY GPT++ FG GLSY+   HS+VQA     + L++GH CRS 
Sbjct  346  MNMRPDPATGYPGRTYRFYIGPTVYLFGEGLSYSD-SHSLVQAPQLAYMPLEEGHVCRSL  404

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
              +S++A  +TC++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L
Sbjct  405  -AKSLEAIGKTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFL  463

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +  + F V+VCK LS+VDE G+RKVALG HVLHIG LKH+L+++I
Sbjct  464  ASQSEAQLQFKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKHALSMQI  512



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD+SFA  + K+TSILW G+PGEAGG A++DVIFGY+NPSGRLP TWYPQ FAD V M +
Sbjct  543  MDISFAKGNDKITSILWVGYPGEAGGAALSDVIFGYYNPSGRLPMTWYPQEFADKVPMTN  602

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR D  TGYPGRTYRFYTG T++ FG GLSY++F H IV+A   VS+ L++GH C S 
Sbjct  603  MNMRSDLATGYPGRTYRFYTGETIYSFGDGLSYSQFNHHIVRAPKLVSVPLEEGHICHSQ  662

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D  E +C + A  IHL V+N+G  SG H+VLLF++PP++HNAP+K L+GF+KV L
Sbjct  663  RCKSIDLFEGSCQNLAFKIHLRVRNMGRRSGSHTVLLFNTPPSVHNAPKKHLLGFKKVFL  722

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   +E+V FNVDVCK LSVVDE G+RKVALG HVL +G LKHSL ++I
Sbjct  723  TAQSEELVKFNVDVCKDLSVVDELGSRKVALGSHVLQVGSLKHSLNIKI  771



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   291 bits (745),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             DVSFA  DPK+ SILW G+PG+AGG AIADV FG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDVSFAKNDPKIKSILWVGYPGQAGGAAIADVCFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSY+   H +V+A   V++ L++GH C S+
Sbjct  605  MNMRPDASNGYPGRTYRFYTGETVYAFGDGLSYSTMNHELVRAPKIVAIPLEEGHVCYSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+SVDA EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP++H +P+K L+ F+KV L
Sbjct  665  NCKSVDAVEQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPSVHKSPQKHLLAFEKVFL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E+ +V F VD CK LSVVDE GNRK+ALG H+LH+G+LKHSLT+ I
Sbjct  725  KGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKHSLTIRI  773



>dbj|BAK03439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   289 bits (740),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 171/230 (74%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG A+AD++FG HNPSGRLP TWYP S+AD+V+M D
Sbjct  465  FDISFAKASDKIAAILWVGYPGEAGGAALADILFGSHNPSGRLPVTWYPASYADTVTMTD  524

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A  S VS+ L + HPCR+
Sbjct  525  MRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSAPPSYVSMRLAEDHPCRA  584

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV 
Sbjct  585  EECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVS  644

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  645  LAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  694



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 174/231 (75%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW GFPGEAGG A+AD+IFG++NPSGRLP TWYPQS+   V M +
Sbjct  548  FDISFAKNDNKITSILWVGFPGEAGGAAMADIIFGFYNPSGRLPITWYPQSYVGKVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYT+F H +V+A   VS  LD+ + CR++
Sbjct  608  MNMRPDASNGYPGRTYRFYTGETVYSFGDGLSYTQFHHHLVRAPKLVSFPLDEANACRTS  667

Query  448  KCESVDAA--EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            +C +++    E TC + A DIHL VKNVGT  G H+V LFSSPP++HN+PRK L+GF+KV
Sbjct  668  RCTTLNVGDHEHTCQNLAFDIHLRVKNVGTSGGTHTVFLFSSPPSVHNSPRKHLLGFEKV  727

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             L    + +V F V++CK LSVVDE G RKVALG H+LH+G LKHSL+V I
Sbjct  728  SLKAQSESLVKFTVNICKDLSVVDEVGTRKVALGHHLLHVGDLKHSLSVRI  778



>gb|KHN26728.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 172/229 (75%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ + V M +
Sbjct  420  MDVSFAKSNDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVNKVPMTN  479

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A   VS+ L + H CRS+
Sbjct  480  MNMRADPATGYPGRTYRFYKGETVFSFGDGISFSNIEHKIVKAPQLVSVPLAEDHECRSS  539

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K L+GF+KV L
Sbjct  540  ECMSLDVADEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVHNAPQKHLLGFEKVHL  599

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                +  V F VD+CK LSVVDE GNRKV LG H+LH+G+LKH L+V +
Sbjct  600  PGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKHQLSVSV  648



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG+HNPSGRLP TWYPQS+ D V M +
Sbjct  545  MDVSFAKTNNKITSILWVGYPGEAGGAAIADVIFGFHNPSGRLPMTWYPQSYVDKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G T+F FG GLSY+   H +++A   VS+ L + H CRS+
Sbjct  605  MNMRPDPATGYPGRTYRFYKGETVFSFGDGLSYSSIVHKLIKAPQMVSVPLAEDHVCRSS  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+    + C +  +DI+L VKN G +S GH+V LFS+PPA+HNAP+K L+GF+KV L
Sbjct  665  ECKSLVIDGELCQNLVIDINLKVKNKGNLSSGHTVFLFSTPPAVHNAPQKHLLGFEKVHL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + +V F VDVCK LS+VDE GNRKVALG H+LH+G+LKH L+V I
Sbjct  725  IGKSEALVRFKVDVCKDLSIVDELGNRKVALGQHLLHVGNLKHPLSVMI  773



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FGYHNPSGRLP TWYP+SF   V M D
Sbjct  546  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGYHNPSGRLPVTWYPESFT-KVPMTD  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A   ++L L +GH C + 
Sbjct  605  MRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPKQLALQLAEGHACLTE  664

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  665  QCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAPAKHLLGFEKVSL  724

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  725  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLGV  773



>dbj|BAK01582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=709

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 171/230 (74%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG A+AD++FG HNPSGRLP TWYP S+AD+V+M D
Sbjct  480  FDISFAKASDKIAAILWVGYPGEAGGAALADILFGSHNPSGRLPVTWYPASYADTVTMTD  539

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A  S VS+ L + HPCR+
Sbjct  540  MRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSAPPSYVSMRLAEDHPCRA  599

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV 
Sbjct  600  EECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVS  659

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  660  LAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  709



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 171/229 (75%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG+HNPSGRLP TWYPQS+ D V M +
Sbjct  546  MDVSFAKTNDKITSILWVGYPGEAGGAAIADVIFGFHNPSGRLPMTWYPQSYVDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G T+F FG G+SY+   H +V+A   VS+ L + H CRS 
Sbjct  606  MNMRPDPATGYPGRTYRFYKGETVFSFGDGISYSTCEHKLVKAPQLVSVPLSEDHVCRSL  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D A Q C + A DI L++KN G +S   +V LFS+PPA+HNAP+K L+ F+KV L
Sbjct  666  ECKSLDVAGQHCQNLAFDIQLSIKNNGKMSISQTVFLFSTPPAVHNAPQKHLLAFEKVHL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + VV F VDVCK LSVVDE GNRKVALG H+LH+G LKH L V I
Sbjct  726  MGKSEAVVSFKVDVCKDLSVVDEVGNRKVALGQHMLHVGDLKHPLGVRI  774



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 171/230 (74%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG A+AD++FG HNPSGRLP TWYP S+AD+V+M D
Sbjct  546  FDISFAKASDKIAAILWVGYPGEAGGAALADILFGSHNPSGRLPVTWYPASYADTVTMTD  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A  S VS+ L + HPCR+
Sbjct  606  MRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSAPPSYVSMRLAEDHPCRA  665

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV 
Sbjct  666  EECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVS  725

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  726  LAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  775



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 170/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FG+HNPSGRLP TWYP+SF   V MID
Sbjct  540  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGHHNPSGRLPVTWYPESFT-KVPMID  598

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPD  TGYPGRTYRFYTG T++ FG GLSYT F H +V A   V+L L +GH C + 
Sbjct  599  MRMRPDASTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPKQVALQLAEGHTCLTE  658

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C SV+A    C   A D+HL V+N G +SG H+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  659  QCPSVEAEGAHCEGLAFDVHLRVRNAGDMSGAHTVFLFSSPPAVHNAPAKHLLGFEKVSL  718

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L++ +
Sbjct  719  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGNHTLHVGDLKHTLSLGV  767



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 172/231 (74%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  + KVTSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ D V M +
Sbjct  546  FDISFAKHNDKVTSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYLDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCR-S  452
            M MRPDP  GYPGRTYRFYTG T++ FG+GLSY+KF H IV+A  +VS+ LD  H CR S
Sbjct  606  MNMRPDPPKGYPGRTYRFYTGETIYSFGHGLSYSKFSHKIVKAPQTVSIPLDDDHVCRHS  665

Query  451  TKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
              C SV+A EQ C  S   DIHL V+N     G HSVLLF +PP++HN+PRK L+GF+K+
Sbjct  666  LDCNSVEAVEQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTPPSVHNSPRKHLIGFEKI  725

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G+ KH+L++ I
Sbjct  726  SLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNFKHTLSLRI  776



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 172/229 (75%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ + V M +
Sbjct  548  MDVSFAKSNDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVNKVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A   VS+ L + H CRS+
Sbjct  608  MNMRADPATGYPGRTYRFYKGETVFSFGDGISFSNIEHKIVKAPQLVSVPLAEDHECRSS  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K L+GF+KV L
Sbjct  668  ECMSLDVADEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVHNAPQKHLLGFEKVHL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                +  V F VD+CK LSVVDE GNRKV LG H+LH+G+LKH L+V +
Sbjct  728  PGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKHQLSVSV  776



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 171/230 (74%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG A+AD++FG HNPSG+LP TWYP S+AD+V+M D
Sbjct  546  FDISFAKASDKIAAILWVGYPGEAGGAALADILFGSHNPSGKLPVTWYPASYADTVTMTD  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A  S VS+ L + HPCR+
Sbjct  606  MRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSAPPSYVSMRLAEDHPCRA  665

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP K L+GF+KV 
Sbjct  666  EECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLLGFEKVS  725

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  726  LAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  775



>dbj|BAD94522.1| beta-xylosidase - like protein [Arabidopsis thaliana]
Length=287

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AI DVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  54   FDITFAKNDKKITSIMWVGYPGEAGGLAIPDVIFGRHNPSGNLPMTWYPQSYVEKVPMSN  113

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGR+YRFYTG T++ F   L+YTKF H +++A   VSL+LD+ HPCRS+
Sbjct  114  MNMRPDKSKGYPGRSYRFYTGETVYAFADALTYTKFDHQLIKAPRLVSLSLDENHPCRSS  173

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S  ++HLNVKN G  +G H+V LF++ P +H +P KQL+GF
Sbjct  174  ECQSLDAIGPHCENAVEGGSDFEVHLNVKNTGDRAGSHTVFLFTTSPQVHGSPIKQLLGF  233

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  234  EKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHVGSLKHSLNISV  287



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  546  MDVSFAKTNDKITSILWVGYPGEAGGAAIADVIFGSYNPSGRLPMTWYPQSYVEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S+    H IV+A   VS+ L + H CRS 
Sbjct  606  MNMRADPATGYPGRTYRFYKGETVFSFGDGMSFGTVEHKIVKAPQLVSVPLAEDHECRSL  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D A++ C + A DIHL+VKN+G +S  HSVLLF +PP +HNAP+K L+GF+KV+L
Sbjct  666  ECKSLDVADKHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPNVHNAPQKHLLGFEKVQL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVC  LSVVDE GNRKV LG H+LH+G+LKHSL+V I
Sbjct  726  AGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKHSLSVRI  774



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + + M +
Sbjct  547  MDVSFAKTNDKITSILWVGYPGEAGGAAIADVIFGSYNPSGRLPMTWYPQSYVEKIPMTN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S+    H IV+A   VS+ L + H CRS 
Sbjct  607  MNMRSDPATGYPGRTYRFYKGETVFSFGDGMSFGTVEHKIVKAPQLVSVPLAEDHECRSL  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D A++ C + A DIHL+VKN+G +S  HSVLLF +PP +HNAP+K L+GF+KV+L
Sbjct  667  ECKSLDVADEHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPNVHNAPQKHLLGFEKVQL  726

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVC  LSVVDE GNRKV LG H+LH+G+LKHSL+V I
Sbjct  727  AGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKHSLSVRI  775



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 172/231 (74%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  + KVTSILW G+PGEAGG AIADVIFGY+NPSGRLP TWYPQS+ + V M +
Sbjct  546  FDISFAKHNDKVTSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYLEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCR-S  452
            M MRPDP  GYPGRTYRFYTG T++ FG+GLSY+KF H IV+A  +VS+ LD  H CR S
Sbjct  606  MNMRPDPSKGYPGRTYRFYTGETIYSFGHGLSYSKFSHKIVKAPQTVSIPLDNDHVCRHS  665

Query  451  TKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
              C SV+A EQ C  S   DIHL V+N     G HSVLLF +PP++HN+PRK L+GF+K+
Sbjct  666  LDCNSVEAVEQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTPPSVHNSPRKHLIGFEKI  725

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G+ KH+L++ I
Sbjct  726  SLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNFKHTLSLRI  776



>dbj|BAD94481.1| beta-xylosidase [Arabidopsis thaliana]
Length=523

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 174/235 (74%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIAD+IFG +NPSG+LP TWYPQS+ + V M  
Sbjct  289  FDITFAKNDPKIAGILWVGYPGEAGGIAIADIIFGRYNPSGKLPMTWYPQSYVEKVPMTI  348

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  +GYPGRTYRFYTG T++ FG GLSYTKF H++V+A   VSL L++ H CRS+
Sbjct  349  MNMRPDKASGYPGRTYRFYTGETVYAFGDGLSYTKFSHTLVKAPSLVSLGLEENHVCRSS  408

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++H+ V+N G   G H+V LF++PPA+H +PRK LVG
Sbjct  409  ECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFLFTTPPAIHGSPRKHLVG  468

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  469  FEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  523



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 170/227 (75%), Gaps = 0/227 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD+SFA  D K+TSI+W G+PGEAGG AIADVIFG HNP GRLP TWYPQ F   V M +
Sbjct  541  MDISFAKIDDKITSIIWVGYPGEAGGAAIADVIFGVHNPGGRLPVTWYPQDFVTKVPMTN  600

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGRTYRFYTG T++ FG GLSYT+F H +++A  +VS+ L++GHPC ST
Sbjct  601  MNMRPDTSTGYPGRTYRFYTGDTVYSFGDGLSYTEFSHHLIRAPTTVSIPLEEGHPCLST  660

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             CESV+     C +    +H+ VKNVG   GG++VLLFS+PP +HNAPRK+L+GF+KV +
Sbjct  661  ACESVELHSSKCPNLTFSLHVKVKNVGDRHGGNTVLLFSTPPRVHNAPRKRLLGFEKVHV  720

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
             P  +  V F V+VC+ L VVDE G++KVALG H  H+G+L HSL+V
Sbjct  721  EPRSERAVEFRVEVCEGLGVVDEFGSKKVALGSHTFHVGNLVHSLSV  767



>gb|KHN33504.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 170/229 (74%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ + V M +
Sbjct  420  MDVSFAKSNDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVNKVPMTN  479

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A   VS+ L + H CRS+
Sbjct  480  MNMRADPATGYPGRTYRFYKGETVFSFGDGISFSSIEHKIVKAPQLVSVPLAEDHECRSS  539

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C S+  A++ C + A DIHL VKN G +S  H VLLF +PP +HNAP+K L+GF+KV L
Sbjct  540  ECMSLGVADEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVHNAPQKHLLGFEKVHL  599

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                +  V F VDVCK LSVVDE GNRKV LG H+LH+G+LKH L++ +
Sbjct  600  PGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKHPLSLRV  648



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   284 bits (726),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 169/230 (73%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+++ILW G+PGEAGG AIAD+IFG +NPSGRLP TWYP SFAD V M D
Sbjct  545  FDISFAKASDKISAILWVGYPGEAGGAAIADIIFGKYNPSGRLPVTWYPASFADKVPMTD  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYT   H++V A  S VS+ L +GH C +
Sbjct  605  MRMRPDNSTGYPGRTYRFYTGETVFAFGDGLSYTTMSHNLVAAPPSEVSMQLAEGHACHT  664

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   A ++ L V N G ++G H+VLLFSSPPA+HNAP K L+GF+K+ 
Sbjct  665  KECASVEAAGDHCEGMAFEVRLRVHNTGEMAGAHTVLLFSSPPAVHNAPAKHLLGFEKLN  724

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L P +  V  F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  725  LEPGQAGVAAFKVDVCKDLSVVDELGNRKVALGGHTLHVGDLKHTLNLGV  774



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   283 bits (725),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ + V M  
Sbjct  547  MDVSFAKTNEKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVEKVPMTI  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S+    H IV+A   VS+ L + H CRS 
Sbjct  607  MNMRADPATGYPGRTYRFYKGDTVFSFGDGMSFGTVEHKIVKAPQLVSVPLAENHECRSL  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C+S+D A++ C + A DIHL+ KN+G +S  H+VLLF SPP +HNAP+K L+GF+KV+L
Sbjct  667  ECKSLDVADEHCQNLAFDIHLSAKNMGKMSSSHTVLLFFSPPNVHNAPQKHLLGFEKVQL  726

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +   + +V F VDVCK LSVVDE G RKV LG H+LH+G+LK+ L+V I
Sbjct  727  AGKSEALVKFKVDVCKDLSVVDEVGKRKVPLGEHMLHVGNLKYPLSVRI  775



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   283 bits (725),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 171/229 (75%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQ++ + V M +
Sbjct  548  MDVSFAKSNDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQAYVNKVPMTN  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A   VS+ L + H CRS+
Sbjct  608  MNMRADPATGYPGRTYRFYKGETVFSFGDGISFSSIEHKIVKAPQLVSVPLAEDHECRSS  667

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C S+D A++ C + A DIHL VKN G +S  H VLLF +PP +HNAP+K L+GF+KV L
Sbjct  668  ECMSLDIADEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVHNAPQKHLLGFEKVHL  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                +  V F VDVCK LSVVDE GNRKV LG H+LH+G+LKH L++ +
Sbjct  728  PGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKHPLSLRV  776



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   283 bits (725),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 175/234 (75%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSILW G+PGEAGG AIADVIFG HNPSG+LP TWYPQS+ + V M +
Sbjct  546  FDITFAKNDDKITSILWVGYPGEAGGLAIADVIFGRHNPSGQLPMTWYPQSYVEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGRTYRFY G T++ FG G+SYT+F H +++A   VSL LDQ HPCRS+
Sbjct  606  MNMRPDESTGYPGRTYRFYAGETVYAFGDGISYTQFTHRLIKAPGLVSLRLDQSHPCRSS  665

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+SVD+    C +     S  ++HLNV+N G   G H+V LF++PPA+H +P K L+GF
Sbjct  666  ECQSVDSIGPHCENAVKGRSDFEVHLNVRNAGDREGSHTVFLFTTPPAIHRSPIKHLLGF  725

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +KVRL  NE+ VV F VDVC+ LSVVDE G RK+ALG H+LH+G LKH+L + +
Sbjct  726  EKVRLGKNEEAVVRFKVDVCQDLSVVDEIGKRKIALGQHLLHVGSLKHTLNIRV  779



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   286 bits (731),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 169/230 (73%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+++ILW G+PGEAGG A+AD+I   HNPSGRLP TWYP S+AD+V M D
Sbjct  741  FDISFAKASDKISAILWVGYPGEAGGAALADIISASHNPSGRLPVTWYPASYADTVKMTD  800

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  H +V A  S VS+ L + HPCR+
Sbjct  801  MRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHQLVSAPPSYVSMQLAEDHPCRA  860

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP+ HNAP K L+GF+KV 
Sbjct  861  EECASVEAASDHCEDLAFDVKLRVRNAGEVAGAHSVLLFSSPPSAHNAPAKHLLGFEKVS  920

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + +
Sbjct  921  LAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELRV  970



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 170/229 (74%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MDVSFA  + K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ + V M +
Sbjct  547  MDVSFAKSNDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVNKVPMTN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY G T+F FG GLS++   H IV+A   VS+ L + H CRS+
Sbjct  607  MNMRADPATGYPGRTYRFYKGETVFSFGDGLSFSSIDHKIVKAPQLVSVPLAEDHECRSS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K L+ F+KV L
Sbjct  667  ECTSLDVADEHCQNLAFDIHLGVKNLGQMSSNHVVLLFFTPPHVHNAPQKHLLAFEKVHL  726

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                +  V F VDVCK LSVVDE GNRKV LG H+LH+G+ KH ++V +
Sbjct  727  PGKSETQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNFKHPISVRV  775



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ +ILW G+PGEAGG AIADV+FGYHNPSGRLP TWYP+SF   + M D
Sbjct  543  FDISFAKSSDKIAAILWVGYPGEAGGAAIADVLFGYHNPSGRLPVTWYPESFT-KIPMTD  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPD  TGYPGRTYRFYTG T++ FG GLSYT F H +V A   V++ L +GH C + 
Sbjct  602  MRMRPDKSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSAPTHVAVVLAEGHACLTE  661

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C SV+A    C   A D+HL V+N G V+G H+V LFSSPPA+HNAP K L+GF+KV L
Sbjct  662  HCLSVEAEGGHCDKLAFDVHLRVRNAGEVAGRHTVFLFSSPPAVHNAPAKHLLGFEKVSL  721

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVC+ LSVVDE GNRKVALG H LH+G LKH++ + +
Sbjct  722  EPGQAGVVAFKVDVCRDLSVVDELGNRKVALGSHTLHVGDLKHTINLRV  770



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD++FA  + K++SI+W G+PG+AGG A+AD+IFG +NPSGRLP TWYPQS+A+ V M +
Sbjct  549  MDITFAKDNDKISSIVWVGYPGQAGGAALADLIFGAYNPSGRLPMTWYPQSYAEKVPMTN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP+P TGYPGR+YRFYTG T++ FG GLSY+ F H +V+A   VS+ L + H C ++
Sbjct  609  MNMRPNPTTGYPGRSYRFYTGETVYNFGDGLSYSDFTHHLVKAPTEVSVPLQEEHVCHTS  668

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C+S+DA  + C +   D+HL V+N G + G H+V LFSSPP++HN+P+K L+ F+KV L
Sbjct  669  TCKSIDALGEHCKNLGFDVHLKVRNNGAMEGRHTVFLFSSPPSVHNSPKKNLIAFEKVFL  728

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                + + VF VD C+HLSVVDE GNRKVALG+H LHIG++KHS  V I
Sbjct  729  HGKTEGMTVFKVDACEHLSVVDEEGNRKVALGVHQLHIGNMKHSFNVRI  777



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 167/230 (73%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+ + LW G+PGEAGG A+ D +FG HNPSGRLP TWYP S+AD+V+M D
Sbjct  548  FDISFAKASDKIAATLWVGYPGEAGGAALDDTLFGSHNPSGRLPVTWYPASYADTVTMTD  607

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            MRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A  S VS+ L + H CR+
Sbjct  608  MRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSAPPSYVSMRLAEDHLCRA  667

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             +C SV+AA   C   ALD+ L V+N G V+G HSVLLFSSPP  HNAP K LVGF+KV 
Sbjct  668  EECASVEAAGDHCDDLALDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAPAKHLVGFEKVS  727

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L+P E   V F VDVC+ LSVVDE G RKVALG H LH G LKH++ + +
Sbjct  728  LAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHDGDLKHTVELRV  777



>ref|XP_009407358.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 171/230 (74%), Gaps = 5/230 (2%)
 Frame = -2

Query  796  FAVKDPKV----TSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            F +K  KV    +SILWAG+PGEAGG A+AD+IFG +NPSGR P TWY Q + + V M D
Sbjct  394  FQIKQDKVNVNISSILWAGYPGEAGGAALADIIFGRYNPSGRTPFTWYDQEYVEQVPMTD  453

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPDP + YPGRTYRFYTG   + FGYGLSYT++ H++VQA + +S+ L++GHPC S 
Sbjct  454  MRMRPDPASNYPGRTYRFYTGNPTYAFGYGLSYTRYDHNLVQAPEKLSITLEEGHPCYSE  513

Query  448  KCESVD-AAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
             C S+D A    C+    D+HL V+N G ++G H+VLLF++PPA+HNAPRKQLVGF+KV 
Sbjct  514  GCNSLDLAGSAHCSGLQFDVHLKVQNSGGMAGSHTVLLFNTPPAVHNAPRKQLVGFEKVF  573

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L PNE + V F VD C+ LSV DE+GN KV LG HVLH+G + H+LT+ I
Sbjct  574  LEPNESKNVAFQVDACRDLSVADESGNWKVPLGSHVLHVGDVTHTLTLSI  623



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 174/235 (74%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIAD+IFG +NPSG+LP TWYPQS+ + V M  
Sbjct  550  FDITFAKNDPKIAGILWVGYPGEAGGIAIADIIFGRYNPSGKLPMTWYPQSYVEKVPMTI  609

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  +GYPGRTYRFYTG T++ FG GLSYTKF H++V+A   VSL L++ H CRS+
Sbjct  610  MNMRPDKASGYPGRTYRFYTGETVYAFGDGLSYTKFSHTLVKAPSLVSLGLEENHVCRSS  669

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++H+ V+N G   G H+V LF++PPA+H +PRK LVG
Sbjct  670  ECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFLFTTPPAIHGSPRKHLVG  729

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  730  FEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  784



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+  ILW G+PGEAGG AIADVIFG  NPSGRLP TWYPQS+ + V M +
Sbjct  547  FDITFAKNDEKIAGILWVGYPGEAGGIAIADVIFGRCNPSGRLPMTWYPQSYVEKVPMTN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL L++ H CRS+
Sbjct  607  MNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPRLVSLRLEENHVCRSS  666

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     SA ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF
Sbjct  667  ECQSLDAIGPHCENAVSGGSAFEVHIKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGF  726

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+G LKHSL++ I
Sbjct  727  EKIRLGKMEEAVVKFKVEICKDLSVVDEIGKRKIALGQHLLHVGDLKHSLSIRI  780



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 174/235 (74%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+T ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  551  FDITFAKNDPKITGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  610

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD    YPGR+YRFY G T++ FG GLSYTKF HS+V+A   VSL L++ H CRS+
Sbjct  611  MNMRPDKANDYPGRSYRFYAGETVYAFGDGLSYTKFSHSLVKAPHLVSLRLEENHVCRSS  670

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++H+ V+N G   G H+V LF++PPA+H +PRK L+G
Sbjct  671  ECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLG  730

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+KVRL   E+ VV F V+VCK LSVVDE GNRK++LG H+LH+G LKH L++ I
Sbjct  731  FEKVRLGKMEEAVVRFKVEVCKDLSVVDEVGNRKISLGKHLLHVGDLKHYLSIRI  785



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+TSI+W GFPG+AGG AIADVIFG HNPSG+LP TWYPQS+ +++ M +
Sbjct  547  LDVTFAKNDPKITSIMWVGFPGQAGGLAIADVIFGRHNPSGKLPMTWYPQSYVENLPMSN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGR+YRFYTG T++ FG G+SYT F H +++    VSL L + HPCR++
Sbjct  607  MNMRPDNSTGYPGRSYRFYTGETVYAFGDGISYTHFNHRLIKPPRLVSLGLAKSHPCRTS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P K LV F+KVRL
Sbjct  667  KCQSVDATGPYCG-KAIEVELRVRNAGEREGTETVFLFTTPPAVHRSPVKHLVAFEKVRL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E   V FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V I
Sbjct  726  GKKEKAAVRFNVDVCKDLSVVDENGKRKIALGVHVLHVGSLKYSLIVRI  774



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 173/235 (74%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIAD+IFG +NPSGRLP TWYPQS+ + V M  
Sbjct  550  FDITFAKNDPKIAGILWVGYPGEAGGIAIADIIFGRYNPSGRLPMTWYPQSYVEKVPMTI  609

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL+L++ H CRS+
Sbjct  610  MNMRPDKSKGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPSLVSLSLEENHVCRSS  669

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++ + V+N G   G H+V LF++PPA+H +PRK L+G
Sbjct  670  ECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFLFTTPPAIHGSPRKHLLG  729

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+K+RL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  730  FEKIRLGKMEEAVVRFKVEVCKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  784



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 170/231 (74%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  546  FDITFAKNDPKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL L++ H CRS+
Sbjct  606  MNMRPDTSNGYPGRTYRFYTGETVYSFGDGLSYTKFSHSLVKAPRVVSLRLEENHVCRSS  665

Query  448  KCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            +C+S+DA    C +  S  ++ + V+N G   G H+V LF++PP +H APRK L+GF+K+
Sbjct  666  ECQSLDAVGPHCENTVSGFEVQVKVRNGGEREGVHTVFLFTTPPEVHGAPRKHLLGFEKI  725

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+G LKHSL++ I
Sbjct  726  RLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHVGDLKHSLSIRI  776



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 174/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  540  FDITFAKNDKKITSIMWVGYPGEAGGLAIADVIFGRHNPSGNLPMTWYPQSYVEKVPMSN  599

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGR+YRFYTG T++ F   L+YTKF H +++A   VSL+LD+ HPCRS+
Sbjct  600  MNMRPDKSKGYPGRSYRFYTGETVYAFADALTYTKFDHQLIKAPRLVSLSLDENHPCRSS  659

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S  ++HLNVKN G  +G H+V LF++ P +H +P KQL+GF
Sbjct  660  ECQSLDAIGPHCENAVEGGSDFEVHLNVKNTGDRAGSHTVFLFTTSPQVHGSPIKQLLGF  719

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  720  EKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHVGSLKHSLNISV  773



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 170/228 (75%), Gaps = 1/228 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+TSI+W GFPG+AGG AIADVIFG HNPSG+LP TWYPQS+ +++ M +
Sbjct  547  LDVTFAKNDPKITSIMWVGFPGQAGGLAIADVIFGRHNPSGKLPMTWYPQSYVENLPMSN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGR+YRFYTG T++ FG G+SYT F H +++    VSL L + HPCR++
Sbjct  607  MNMRPDNSTGYPGRSYRFYTGETVYAFGDGISYTHFNHRLIKPPRLVSLGLAKSHPCRTS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P K LV F+KVRL
Sbjct  667  KCQSVDATGPYCG-KAIEVQLRVRNAGEREGTETVFLFTTPPAVHRSPVKHLVAFEKVRL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
               E   V FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V 
Sbjct  726  GKKEKAAVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKYSLIVR  773



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 170/231 (74%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGE+GG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  546  FDITFAKNDPKIAGILWVGYPGESGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL L++ H CRS+
Sbjct  606  MNMRPDTSNGYPGRTYRFYTGETVYSFGDGLSYTKFSHSLVKAPRVVSLRLEENHVCRSS  665

Query  448  KCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            +C+S+DA    C +  S  ++ + V+N G   G H+V LF++PP +H APRK L+GF+K+
Sbjct  666  ECQSLDAVGPHCENTVSGFEVQVKVRNGGEREGVHTVFLFTTPPEVHGAPRKHLLGFEKI  725

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+G LKHSL++ I
Sbjct  726  RLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHVGDLKHSLSIRI  776



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 173/236 (73%), Gaps = 7/236 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  556  FDITFAKNDAKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  615

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKFRHS+V+A   VSL+L++ H CRS+
Sbjct  616  MNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFRHSLVKAPRLVSLSLEENHVCRSS  675

Query  448  KCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
            +C+S+DA    C         +A ++ + V+N G   G H+V LF++PPA+H +PRK L+
Sbjct  676  ECQSLDAIGPHCDNVVSGKGGTAFEVQIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLL  735

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  736  GFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLLHVGDVKHSLSIRI  791



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 173/236 (73%), Gaps = 7/236 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDITFAKNDAKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKFRHS+V+A   VSL+L++ H CRS+
Sbjct  605  MNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFRHSLVKAPRLVSLSLEENHVCRSS  664

Query  448  KCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
            +C+S+DA    C         +A ++ + V+N G   G H+V LF++PPA+H +PRK L+
Sbjct  665  ECQSLDAIGPHCDNVVSGKGGTAFEVQIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLL  724

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  725  GFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLLHVGDVKHSLSIRI  780



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 169/235 (72%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            MD+ FA  DPK++SILW GFPGEAGG AI+DVIFG HNPSG+LP TWYPQS+AD+VSM +
Sbjct  529  MDIQFAKNDPKISSILWVGFPGEAGGAAISDVIFGSHNPSGKLPMTWYPQSYADAVSMTN  588

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA---QDSVSLALDQGHPC  458
            M MRP     +PGRTYRFYTGPT++ FGYGLSYT+F H I+QA      +S+ LDQ HPC
Sbjct  589  MNMRPSRSNNFPGRTYRFYTGPTVYPFGYGLSYTQFSHKIIQAPPPPTLISIPLDQKHPC  648

Query  457  R---STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            R   S+ C S+D+AE    +   D+ L V+N G + G H+VLLF S P +H+AP K+L+G
Sbjct  649  RRRSSSNCTSIDSAEVCNLNLGFDLQLKVRNEGGMGGSHTVLLFVSTPRVHDAPEKRLLG  708

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F K+ L    + V  F +DVC+HLSVVDE G RK+ LG HVLH+G  KHS  V I
Sbjct  709  FDKLHLGGWGEGVARFRIDVCEHLSVVDEFGKRKLGLGEHVLHVGGSKHSFNVAI  763



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 174/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+T ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDITFAKDDPKITGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            M MRPD   GYPGRTYRFYTG T++ FG G+SYTKF HS+V+     V L+L++ H CRS
Sbjct  605  MNMRPDTSNGYPGRTYRFYTGETVYAFGDGISYTKFSHSLVKVPPRVVPLSLEENHVCRS  664

Query  451  TKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            ++C+S+DA     E+    +A ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF
Sbjct  665  SECQSLDAFGPHCEKKAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGF  724

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  725  EKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHSLSIRI  778



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   275 bits (704),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 171/234 (73%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  519  FDITFAKNDEKITSIMWVGYPGEAGGLAIADVIFGRHNPSGSLPMTWYPQSYVEKVPMSN  578

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A   VSL+LD+ HPCRS+
Sbjct  579  MNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKAPRLVSLSLDESHPCRSS  638

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S  ++ LNVKN G   G H+V LF++PPA+H +P K L+GF
Sbjct  639  ECQSLDAIGPHCENAVEGGSGFEVQLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGF  698

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+G LKHSL + +
Sbjct  699  EKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHVGSLKHSLNITV  752



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   275 bits (704),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  532  FDITFAKNDEKITSIMWVGYPGEAGGLAIADVIFGRHNPSGSLPMTWYPQSYVEKVPMSN  591

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A   VSL+LD+ HPCRS+
Sbjct  592  MNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKAPRLVSLSLDESHPCRSS  651

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S +++ LNVKN G   G H+V LF++PPA+H +P K L+GF
Sbjct  652  ECQSLDAIGPHCENAVEGESGIEVKLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGF  711

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+G LKHSL + +
Sbjct  712  EKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHVGSLKHSLNITV  765



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   276 bits (705),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 173/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  546  FDITFAKNDEKITSIMWVGYPGEAGGLAIADVIFGRHNPSGSLPMTWYPQSYVEKVPMSN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A   VSL+LD+ HPCRS+
Sbjct  606  MNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKAPRLVSLSLDESHPCRSS  665

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S +++ LNVKN G   G H+V LF++PPA+H +P K L+GF
Sbjct  666  ECQSLDAIGPHCENAVEGESGIEVKLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGF  725

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+G LKHSL + +
Sbjct  726  EKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHVGSLKHSLNITV  779



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   276 bits (705),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 171/234 (73%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  561  FDITFAKNDEKITSIMWVGYPGEAGGLAIADVIFGRHNPSGSLPMTWYPQSYVEKVPMSN  620

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A   VSL+LD+ HPCRS+
Sbjct  621  MNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKAPRLVSLSLDESHPCRSS  680

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S  ++ LNVKN G   G H+V LF++PPA+H +P K L+GF
Sbjct  681  ECQSLDAIGPHCENAVEGGSGFEVQLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGF  740

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+G LKHSL + +
Sbjct  741  EKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHVGSLKHSLNITV  794



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 172/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  546  FDITFAKNDEKITSIMWVGYPGEAGGLAIADVIFGRHNPSGSLPMTWYPQSYVEKVPMSN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG  LSYT F H +++A   VSL+LD+ HPCRS+
Sbjct  606  MNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTTFDHRLIKAPRLVSLSLDKSHPCRSS  665

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C +     S  ++ LNVKN G   G H+V LF++PPA+H +P K L+GF
Sbjct  666  ECQSLDAIGPHCENADEGGSGFEVQLNVKNAGDREGSHTVFLFTTPPAIHGSPIKHLLGF  725

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +KVRL  NE+ VV FNVDVCK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  726  EKVRLGKNEEAVVRFNVDVCKDLSVVDEIGTRKIALGHHLLHVGSLKHSLNITV  779



>emb|CAB89360.1| beta-glucosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09525.1| unnamed protein product [Arabidopsis thaliana]
Length=411

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 164/234 (70%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG+LP TWYPQS+ + V M +
Sbjct  178  FDITFAKNDEKITSIMWVGYPGEAGGIAIADVIFGRHNPSGKLPMTWYPQSYVEKVPMTN  237

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GY GRTYRFY G T++ FG GLSYT F H +++A   VSL LD+   CRS 
Sbjct  238  MNMRPDKSNGYLGRTYRFYIGETVYAFGDGLSYTNFSHQLIKAPKFVSLNLDESQSCRSP  297

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C       S  ++ L V+NVG   G  +V LF++PP +H +PRKQL+GF
Sbjct  298  ECQSLDAIGPHCEKAVGERSDFEVQLKVRNVGDREGTETVFLFTTPPEVHGSPRKQLLGF  357

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+G LKHS  + +
Sbjct  358  EKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHVGSLKHSFNISV  411



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+TSI+W GFPG+AGG AIADVIFG HNPSG+LP TWYPQ + +S+ M +
Sbjct  547  LDVTFAKNDPKITSIMWVGFPGQAGGLAIADVIFGRHNPSGKLPMTWYPQLYVESLPMSN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGRTYRFYTG T++ FG G+SYT F H +++    V L+L + HPCR++
Sbjct  607  MNMRPDNSTGYPGRTYRFYTGETIYAFGDGISYTHFNHRLIKPPRLVFLSLAKSHPCRTS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P K L+ F+KVRL
Sbjct  667  KCQSVDAIGPYCG-KAIEVQLRVRNAGEREGTDTVFLFTTPPAVHRSPVKHLLAFEKVRL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V I
Sbjct  726  GKKEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKYSLIVRI  774



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  D K+TSI+W GFPG+AGG AIADVIFG HNPSG+LP TWYPQS+ + + M +
Sbjct  549  LDVTFAKNDKKITSIMWVGFPGQAGGLAIADVIFGRHNPSGKLPTTWYPQSYVEKLPMSN  608

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGRTYRFYTG T++ FG G+SYT+F H  ++A   VSL LD  HPCRS+
Sbjct  609  MNMRPDNSTGYPGRTYRFYTGETVYAFGDGISYTQFNHRHIKAPRLVSLGLDASHPCRSS  668

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+S+DA    C   A ++ L V+N G   G H+V +F SPPA+H +P K L+ F+KVR 
Sbjct  669  KCQSLDAVGPYCG-KAFEVQLRVRNAGNREGSHTVFMFMSPPAVHRSPVKHLLAFEKVRP  727

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E  VV F VDVCK LSVVDE G RK+ALG HVLH+G LK+SL + I
Sbjct  728  GMKEKTVVRFEVDVCKDLSVVDETGKRKIALGKHVLHVGSLKYSLYITI  776



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 170/234 (73%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+T I+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  546  FDITFAKNEEKITGIMWVGYPGEAGGLAIADVIFGRHNPSGNLPMTWYPQSYVEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYT F H I++A   VSL LD+ H CRS+
Sbjct  606  MNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTNFNHQILKAPKLVSLDLDENHACRSS  665

Query  448  KCESVDAAEQTCASSA-----LDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+SVDA    C ++       ++ L V+NVG   G H+V LF++PP +H +PRK L+GF
Sbjct  666  ECQSVDAIGPHCDNAVGGGLNFEVQLKVRNVGDREGSHTVFLFTTPPEVHGSPRKHLLGF  725

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL   E+ V+ FNVDVCK LSVVDE G RK+ALG ++LH+G  KHSLT+ +
Sbjct  726  EKIRLGEKEETVIRFNVDVCKDLSVVDEIGKRKIALGHYLLHVGSFKHSLTISV  779



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 171/235 (73%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  550  FDITFAKNDPKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  609

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGR+YRFYTG T++ FG GLSYTKF HS+V+A   VSL L+  H CRS+
Sbjct  610  MNMRPDKSNGYPGRSYRFYTGETVYAFGDGLSYTKFSHSLVKAPRLVSLGLEDNHVCRSS  669

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S++A    C +      SA ++ + V+N G   G H+V LF++PPA+H +P+K L+G
Sbjct  670  ECQSLEATGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFLFTTPPAVHGSPKKHLLG  729

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+K+RL   E+ VV F V VCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  730  FEKIRLGKMEEAVVRFKVKVCKDLSVVDEIGKRKIGLGKHLLHVGDLKHSLSIRI  784



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+TSI+W GFPG+AGG AIADVIFG HNPSG+LP TWYPQS+ +++ M +
Sbjct  468  LDVTFAKNDPKITSIMWVGFPGQAGGLAIADVIFGRHNPSGKLPMTWYPQSYVENLPMSN  527

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR D  TGYPGRTYRFYTG T++ FG G+SY  F H +++    VSL+L + HPCR++
Sbjct  528  MNMRADNSTGYPGRTYRFYTGETVYAFGDGISYIHFNHRLIKPPRLVSLSLAKSHPCRTS  587

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P K L+ F+KVRL
Sbjct  588  KCQSVDAIGPYCG-KAIEVQLRVRNAGEREGTDTVFLFTTPPAVHRSPVKHLLAFEKVRL  646

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V I
Sbjct  647  GKEEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKYSLIVRI  695



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   273 bits (697),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 163/229 (71%), Gaps = 23/229 (10%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA  D K+TSILW G+PGEAGG AIADVIFG++NPSGRLP TWYPQS+ D V M +
Sbjct  546  FDISFAKNDDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVDKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +                    
Sbjct  606  MNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHL--------------------  645

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
               SVDA +++C +   DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV +
Sbjct  646  ---SVDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFV  702

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  703  TAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  751



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 172/234 (74%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIA+VIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDITFAKDDPKIAGILWVGYPGEAGGIAIAEVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A    V L L++ H CRS
Sbjct  605  MNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPPRVVPLRLEENHVCRS  664

Query  451  TKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            ++C+S+DA     E+    +A ++H+ V+N G   G H+V LF++PP +H +PRK L+GF
Sbjct  665  SECQSLDALGPHCEKNAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPTVHGSPRKHLLGF  724

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  725  EKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHSLSIRI  778



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 172/235 (73%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDITFAKNEAKIAGILWVGYPGEAGGLAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+++A   VSL L++ H CRS+
Sbjct  605  MNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLIKAPKLVSLRLEENHVCRSS  664

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++ + V+N G   G H+V LF++PP +H +PRK L+G
Sbjct  665  ECQSLDAIGPHCENADSGNGSAFEVEVKVQNGGEREGIHTVFLFTTPPDVHGSPRKHLLG  724

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+G LKHSL++ I
Sbjct  725  FEKIRLGKMEEAVVRFKVEICKDLSVVDEIGKRKIALGKHLLHVGDLKHSLSIRI  779



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 173/236 (73%), Gaps = 7/236 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+  ILW G+PGEAGG A ADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDITFAKNDAKIAGILWVGYPGEAGGIATADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL+L++ H CRS+
Sbjct  605  MNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPRLVSLSLEENHVCRSS  664

Query  448  KCESVDAAEQTCASS-------ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
            +C+S++A    C ++       A ++H+ V+N G   G H+V LF++PPA+H +PRK L+
Sbjct  665  ECQSLNAIGPHCDNAVSGTGGKAFEVHIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLL  724

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  725  GFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDVKHSLSIRI  780



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 169/231 (73%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  546  FDITFAKNDAKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL L + H CRS+
Sbjct  606  MNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPRVVSLRLGENHVCRSS  665

Query  448  KCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            +C+S+DA    C +  S  ++ + V+N G   G H+V LF++PP +H +PRK L+GF+K+
Sbjct  666  ECQSLDAVGPHCENTVSGFEVQVKVRNGGDREGIHTVFLFTTPPEVHGSPRKHLLGFEKI  725

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            RL   E+ VV F VDVCK L+VVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  726  RLGKMEEAVVKFKVDVCKDLNVVDEIGKRKIGLGQHLLHVGDLKHSLSIRI  776



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 168/230 (73%), Gaps = 1/230 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  + K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  543  FDITFAKNNDKITSIMWVGYPGEAGGLAIADVIFGRHNPSGNLPMTWYPQSYVEKVPMSN  602

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG G+SYT+F H ++++ + VSL LD  H CRS+
Sbjct  603  MNMRPDESNGYPGRTYRFYAGETVYTFGDGISYTQFHHKLIKSPNLVSLRLDDNHRCRSS  662

Query  448  KCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            +C+S+DA    C   S  +I L V N G   G H+V LF++PPA+H +P K L+GF+K+R
Sbjct  663  ECQSLDAIGSHCEGGSDFEIQLKVANAGDREGSHTVFLFTTPPAIHRSPIKHLLGFEKIR  722

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L  NE+ VV F V+VCK LSVVDE G RK+ LG HVLH+G+LKHSL + +
Sbjct  723  LVKNEETVVRFKVNVCKDLSVVDETGKRKIGLGEHVLHVGNLKHSLNIRV  772



>ref|NP_196532.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED91435.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=526

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 164/234 (70%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG+LP TWYPQS+ + V M +
Sbjct  293  FDITFAKNDEKITSIMWVGYPGEAGGIAIADVIFGRHNPSGKLPMTWYPQSYVEKVPMTN  352

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GY GRTYRFY G T++ FG GLSYT F H +++A   VSL LD+   CRS 
Sbjct  353  MNMRPDKSNGYLGRTYRFYIGETVYAFGDGLSYTNFSHQLIKAPKFVSLNLDESQSCRSP  412

Query  448  KCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            +C+S+DA    C       S  ++ L V+NVG   G  +V LF++PP +H +PRKQL+GF
Sbjct  413  ECQSLDAIGPHCEKAVGERSDFEVQLKVRNVGDREGTETVFLFTTPPEVHGSPRKQLLGF  472

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+G LKHS  + +
Sbjct  473  EKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHVGSLKHSFNISV  526



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 173/243 (71%), Gaps = 14/243 (6%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D KVTSILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  539  FDITFAKNDDKVTSILWVGYPGEAGGAAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  598

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLS++ F H +V+A   VSL LDQ H CRS+
Sbjct  599  MNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSFSHFAHQLVKAPRLVSLPLDQTHVCRSS  658

Query  448  KCESVDAAEQTCA------------SSALDIHLNVKNVGTVSGGHSVLLFSSPP--ALHN  311
             C+S+DA    C+            S+A ++H+ VKN G   G H+V LF++PP  ++  
Sbjct  659  DCQSLDAVGPHCSNAVADPNANASGSAAFEVHMKVKNSGEAEGTHTVFLFTTPPQSSVRG  718

Query  310  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  131
            +PRK L+GF+KVRL   E++VV F ++VCK LS+VDE G RKV LG HVLH+G LKHSL+
Sbjct  719  SPRKHLLGFEKVRLGKEEEKVVRFRIEVCKDLSLVDEFGTRKVVLGEHVLHVGSLKHSLS  778

Query  130  VEI  122
            V +
Sbjct  779  VRV  781



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 171/235 (73%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  542  FDITFAKNDPKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD    YPGR+YRFY G T++ FG GLSYTKF H++V+A   V+L L++ H CRS+
Sbjct  602  MNMRPDKSNDYPGRSYRFYAGETVYAFGDGLSYTKFSHTLVKAPRLVTLGLEENHVCRSS  661

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++ + V+N G   G H+V L+++PPA+H +PRK L+G
Sbjct  662  ECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFLYTTPPAVHGSPRKHLLG  721

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+KVRL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  722  FEKVRLGKMEEAVVRFRVEVCKDLSVVDEVGKRKIGLGKHLLHVGDLKHSLSIRI  776



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 171/234 (73%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             DV+FA  D K+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  545  FDVTFAKNDAKIVGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDS-VSLALDQGHPCRS  452
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A    V L L++ H CRS
Sbjct  605  MNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPPRVVPLRLEENHVCRS  664

Query  451  TKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
            ++C+S+DA     E+    +A ++H+ V+N G   G H+V LF++PPA+H +PRK L+GF
Sbjct  665  SECQSLDALGPHCEKNAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPAVHGSPRKHLLGF  724

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            +K+ L   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  725  EKISLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHSLSIRI  778



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   271 bits (692),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 171/236 (72%), Gaps = 7/236 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  556  FDITFAKNDAKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  615

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A   VSL+L++ H CRS+
Sbjct  616  MNMRPDNSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKAPRLVSLSLEENHVCRSS  675

Query  448  KCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
            +C+S+ A    C         +A ++ + V+N G   G H+V LF++PPA+H +PRK L+
Sbjct  676  ECQSLKAIGPHCDNVVSGTGRTAFEVQIKVQNGGDREGIHTVFLFTTPPAVHGSPRKHLL  735

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +KHSL++ I
Sbjct  736  GFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDVKHSLSIRI  791



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 169/235 (72%), Gaps = 6/235 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  DPK+  ILW G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ + V M +
Sbjct  542  FDITFAKNDPKIAGILWVGYPGEAGGIAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTN  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD    YPGR+YRFY G T++ FG GLSYTKF H++V+A   VSL L++ H CRS+
Sbjct  602  MNMRPDKANDYPGRSYRFYAGETIYAFGDGLSYTKFSHTLVKAPHLVSLRLEENHVCRSS  661

Query  448  KCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C +      SA ++ + V+N G   G H+V LF++PP +H +PRK L+G
Sbjct  662  ECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGEREGIHTVFLFTTPPDVHGSPRKHLLG  721

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            F+KVRL   E+ VV F V VCK LSVVDE G RK+ LG H+LH+G LKHSL++ I
Sbjct  722  FEKVRLGKMEEAVVRFKVAVCKDLSVVDEVGKRKIGLGKHLLHVGDLKHSLSIRI  776



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 169/229 (74%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  +PK+TSI+W GFPG+AGG AIADVIFG +NPSGRLP TWYPQS+ +++ M +
Sbjct  547  LDVTFAKNNPKITSIMWVGFPGQAGGLAIADVIFGRYNPSGRLPMTWYPQSYVENLPMSN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD  TGYPGR+YRFYTG T++ FG G+SYT+F H +++A   VSL LD  HPCRS+
Sbjct  607  MNMRPDNSTGYPGRSYRFYTGETVYSFGDGISYTQFHHWLIRAPGFVSLGLDPSHPCRSS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC SVDA    C  + +++ L V N GT  G H+V LF +PPA+H +P K LV F+K+ L
Sbjct  667  KCLSVDATGTYCGKT-VEVQLEVINAGTREGSHTVFLFMTPPAVHRSPVKHLVTFEKLLL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
               E  VV F +DVCK LSVVDE G R++ALG +VLH+G L +SL + I
Sbjct  726  GRTEMAVVRFELDVCKDLSVVDETGKRQIALGEYVLHVGSLTYSLYITI  774



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   268 bits (686),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 171/229 (75%), Gaps = 1/229 (0%)
 Frame = -2

Query  808   MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             +DV+FA  +PK+TSI+W GFPG+AGG AIADVIFG +NPSGRLP TWYPQS+ +++ M +
Sbjct  786   LDVTFAKNNPKITSIMWVGFPGQAGGLAIADVIFGRYNPSGRLPMTWYPQSYVENLPMSN  845

Query  628   MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
             M MRPD  TGYPGR+YRFYTG T++ FG G+SYT+F H +++A   VSL LD  HPCRS+
Sbjct  846   MNMRPDNSTGYPGRSYRFYTGETVYSFGDGISYTQFHHWLIRAPGFVSLGLDPSHPCRSS  905

Query  448   KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             KC SVDA    C  + +++ L V N GT  G H+V LF +PPA+H +P K LV F+K+ L
Sbjct  906   KCLSVDATGTYCGKT-VEVQLEVINAGTREGSHTVFLFMTPPAVHRSPVKHLVTFEKLLL  964

Query  268   SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
                E  VV F++DVCK LSVVDE G R++ALG +VLH+G LK+SL + I
Sbjct  965   GRTEIAVVRFDLDVCKDLSVVDETGKRQIALGEYVLHVGSLKYSLYITI  1013



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 169/233 (73%), Gaps = 6/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+TSI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQ + + V M +
Sbjct  545  FDITFAKNDEKITSIMWVGYPGEAGGLAIADVIFGRHNPSGNLPMTWYPQFYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPD   GYPGRTYRFY G T++ FG+GLSY+ FRH +++A   VSL L++ H C S+
Sbjct  605  MNMRPDKLRGYPGRTYRFYAGETVYAFGHGLSYSNFRHQLLKAPKLVSLNLEESHACLSS  664

Query  448  KCESVDAAEQTCASSAL------DIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
            +C+S+DA    C ++A+      ++ L V N G   G H+V LF++PP +H +P K L+G
Sbjct  665  ECQSLDAFGPHCDNNAVGGRLDFEVQLKVTNAGDREGTHTVFLFTTPPEVHGSPVKHLLG  724

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
            F+KVRL  +E+ +V FNVDVCK LSVVDE G RK+ALG H+LH+G LKHSL +
Sbjct  725  FEKVRLGKSEEAMVRFNVDVCKDLSVVDEIGTRKIALGHHLLHVGSLKHSLNI  777



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 170/236 (72%), Gaps = 7/236 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D++FA  D K+ SI+W G+PGEAGG AIADVIFG HNPSG LP TWYPQS+ + V M +
Sbjct  545  FDITFAKNDEKIKSIMWVGYPGEAGGLAIADVIFGRHNPSGNLPMTWYPQSYVEKVPMTN  604

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPC-RS  452
            M MRPD  +GYPGRTYRFYTG T++ FG+GLSY+ F H +++A   VSL L++ H C  S
Sbjct  605  MNMRPDKLSGYPGRTYRFYTGETVYAFGHGLSYSNFSHQLLKAPKLVSLNLEESHACLSS  664

Query  451  TKCESVDAAEQTCASSAL------DIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
            ++C+S+DA    C ++A+      ++ L V N G   G H+V LF++PP +H +P K L+
Sbjct  665  SECQSLDAFGPHCDNNAVGGRLDFEVQLKVTNAGDREGSHTVFLFTTPPEVHGSPVKHLL  724

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            GF+KVRL  +E+ +V F V+VCK LSVVDE G RK+ALG H+LH+G LKHSL + +
Sbjct  725  GFEKVRLRKSEEAMVRFKVNVCKDLSVVDEIGTRKIALGHHLLHVGSLKHSLNITV  780



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 161/215 (75%), Gaps = 1/215 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+TSI+W GFPG+AGG AIADVIFG HNPSG+LP TWYPQS+ +++ M +
Sbjct  547  LDVTFAKNDPKITSIMWVGFPGQAGGLAIADVIFGRHNPSGKLPMTWYPQSYVENLPMSN  606

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR D  TGYPGR+YRFYTG T++ FG G+SYT F H +++ Q  VSL L + HPCR++
Sbjct  607  MNMRADNSTGYPGRSYRFYTGETVYAFGDGISYTHFNHRLIKPQRLVSLGLAKSHPCRTS  666

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            KC+SVDA    C  + +++ L V+N G   G  +V LF++PPA+H +P K L+ F+KVRL
Sbjct  667  KCQSVDATGPYCGKT-IEVELRVRNAGEREGTDTVFLFTTPPAVHRSPVKHLLAFEKVRL  725

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHV  164
               E  VV FNVDVCK LSVVDE G RK+ALGL++
Sbjct  726  GKKEKAVVRFNVDVCKDLSVVDETGKRKIALGLNM  760



>gb|ABK96385.1| unknown [Populus trichocarpa x Populus deltoides]
Length=343

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 156/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYP  +   V M +
Sbjct  106  IDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGTANPGGKLPMTWYPHDYLAKVPMTN  165

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA   VS+ L   H  R+T
Sbjct  166  MGMRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQAPREVSVPLASLHVSRNT  225

Query  448  KCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
               S  +  +   C + AL +H++VKN G + G H++L+FSSPP    + +KQL+GF+KV
Sbjct  226  TGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQLIGFEKV  285

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             L     + V  ++ VCKHLSVVD  G R++  G H L+IG LKHS++++
Sbjct  286  HLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPNGEHYLYIGDLKHSISLQ  335



>gb|EEE61783.1| hypothetical protein OsJ_16354 [Oryza sativa Japonica Group]
Length=771

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 159/229 (69%), Gaps = 2/229 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             D+SFA    K+++ILW G+P  +              P   LP TWYP SFAD VSM D
Sbjct  545  FDISFAKSSDKISAILWVGYPRRSR--WRRPRRHPLRIPQSWLPVTWYPASFADKVSMTD  602

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            MRMRPD  TGYPGRTYRFYTG T++ FG GLSYTKF HS+V A + V++ L +GH C + 
Sbjct  603  MRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSAPEQVAVQLAEGHACHTE  662

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K L+GF+KV L
Sbjct  663  HCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAKHLLGFEKVSL  722

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  723  EPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  771



>gb|KCW63060.1| hypothetical protein EUGRSUZ_G00652 [Eucalyptus grandis]
Length=460

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 151/205 (74%), Gaps = 14/205 (7%)
 Frame = -2

Query  736  GGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTL  557
            GG A+ADVIFG HNPSGRLP TWYPQS+ D+V M +M MRPDP TGYPGRTYRFY GPT+
Sbjct  265  GGAAMADVIFGDHNPSGRLPMTWYPQSYVDAVPMTNMNMRPDPATGYPGRTYRFYIGPTV  324

Query  556  FKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVK  377
            + FG GLSY+   HS+VQA     + L++             A  +TC++ ALD+HLNVK
Sbjct  325  YLFGEGLSYSD-SHSLVQAPQLAYMPLEE-------------AIGKTCSNLALDVHLNVK  370

Query  376  NVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEA  197
            NVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +  + F V+VCK LS+VDE 
Sbjct  371  NVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSEAQLQFKVNVCKDLSLVDEL  430

Query  196  GNRKVALGLHVLHIGHLKHSLTVEI  122
            G+RKVALG HVLHIG LKH+L+++I
Sbjct  431  GHRKVALGTHVLHIGDLKHALSMQI  455



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 162/231 (70%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP+V +I+WAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  554  IDVSFAKNDPRVAAIVWAGYPGQAGGQAIADVLFGTVNPGGKLPVTWYPQEYVAKVPMTN  613

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSL---ALDQGHPC  458
            M MR +P  GYPGRTYRFY GP ++ FGYG+SYT +RHS+V+A   VS+   +L   +  
Sbjct  614  MNMRANPAKGYPGRTYRFYKGPVVYPFGYGMSYTSYRHSLVKAPTQVSVPVASLSAAYRN  673

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             S     + AA   C +++L IH+N++N G++ G H++L+FS+PP    +P +QL+GF+K
Sbjct  674  SSLLSAGIRAAHVNCNAASLGIHVNIENTGSMDGTHTLLVFSAPPEGKWSPARQLIGFEK  733

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +S      V  +V VC+HLSVVDE G R++ +G H LH+G ++HS+T++
Sbjct  734  VHVSAGSQRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHVGDVEHSMTLQ  784



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 156/231 (68%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++   + M D
Sbjct  538  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTD  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GP +F FG GLSYT+F H++ Q    VS+ L      ++T
Sbjct  598  MAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHTLAQGPTLVSVPLTSLIATKNT  657

Query  448  KC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
                   V  +   C S +LDIH++VKN GT+ G H++L+F++PPA   AP KQLVGF K
Sbjct  658  TMLNNNGVRVSHTNCDSLSLDIHVDVKNTGTMDGTHTLLVFATPPAEKWAPNKQLVGFHK  717

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  718  VHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>dbj|BAJ51947.1| putative beta-D-xylosidase [Glycyrrhiza uralensis]
Length=285

 Score =   226 bits (576),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 155/234 (66%), Gaps = 3/234 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+++ILW G+PG+AGG AIADVIFG  NP GRLP TWYPQ++   V M +
Sbjct  48   IDVSFAKNDPKISAILWVGYPGQAGGTAIADVIFGTTNPGGRLPMTWYPQNYLAKVPMTN  107

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA--QDSVSLALDQGHPCR  455
            M MRP+P TGYPGRTYRFY GP +F FG+GLSYT+F HS+  A  Q SV  A  Q     
Sbjct  108  MDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYTRFTHSLAIAPKQVSVPFATLQAFTNS  167

Query  454  S-TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            + +  ++V  +   C +  +  H++VKN G++ G +++L+FS PP    +  KQLV F K
Sbjct  168  TVSTSKAVRVSHANCDAMEVGFHVDVKNEGSMDGTNTLLVFSKPPPGKWSATKQLVSFHK  227

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI*E  116
              +     + V   V VCKHLSVVDE G R++ +G H L IG LKHS++V+  E
Sbjct  228  TYVPAGSKQRVKVGVHVCKHLSVVDEFGIRRIPMGEHELQIGDLKHSISVQTQE  281



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 158/230 (69%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYP ++   V M +
Sbjct  531  IDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGTANPGGKLPMTWYPHNYLAKVPMTN  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA   VS+ L   H  R+T
Sbjct  591  MGMRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQAPREVSVPLASLHVSRNT  650

Query  448  KCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
               S  +  +   C + AL +H++VKN G + G H++L+FSSPP    + +KQL+GF+KV
Sbjct  651  TGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQLIGFEKV  710

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             L     + V  ++ VCKHLSVVD  G R++ +G H L+IG LKHS++++
Sbjct  711  HLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYIGDLKHSISLQ  760



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 156/231 (68%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++   + M D
Sbjct  538  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTD  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GP +F FG GLSYT+F H++ Q    VS+ L      ++T
Sbjct  598  MAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHTLAQGPTLVSVPLTSLVAAKNT  657

Query  448  KC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
                   V  +   C S +LDIH+++KN GT+ G H++L+F++PPA   AP KQLVGF K
Sbjct  658  TMLNNNGVRVSYTNCDSLSLDIHVDIKNTGTMDGTHTLLVFATPPAEKWAPNKQLVGFHK  717

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  718  VHIVAGLERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_010652235.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Vitis vinifera]
Length=626

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 156/228 (68%), Gaps = 1/228 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA KDP++ +I+WAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +   V M  
Sbjct  391  VDVSFAKKDPRIAAIVWAGYPGQAGGAAIADILFGVANPGGKLPMTWYPQEYLSKVPMTT  450

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P   YPGRTYRFY GP +++FG+GLSYT F H+I QA  +V++ L  GH   + 
Sbjct  451  MAMRAIPSKAYPGRTYRFYKGPVVYRFGHGLSYTNFVHTIAQAPTAVAIPL-HGHHNTTV  509

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
              +++      C   ++ +HL+VKNVG   G H++L+FS PPA H AP KQLV F+KV +
Sbjct  510  SGKAIRVTHAKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGHWAPHKQLVAFEKVHV  569

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +    + V  N+ VCK+LSVVD +G R++ +G H LHIG  KH ++++
Sbjct  570  AARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKHLVSLQ  617



>ref|NP_001280797.1| putative beta-D-xylosidase precursor [Malus domestica]
 gb|ADI79208.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Malus domestica]
Length=774

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 155/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++  ++ M D
Sbjct  536  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVANLPMTD  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q    VS+        ++T
Sbjct  596  MAMRADPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHSLAQGPTLVSVPFTSLVASKNT  655

Query  448  KC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
                   +  +   C S +LD+H+++KN GT+ G H++L+F++PP    AP KQLVGF K
Sbjct  656  TMLGNHDIRVSHTNCDSLSLDVHIDIKNSGTMDGTHTLLVFATPPTGKWAPNKQLVGFHK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLSVVDE G R++ LG H L IG L+H ++VE
Sbjct  716  VHIVAGSERRVRVGVQVCKHLSVVDELGIRRIPLGQHKLEIGDLQHHVSVE  766



>dbj|BAF79669.1| beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 156/231 (68%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++  ++ M D
Sbjct  536  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVANLPMTD  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q    VS+ L      ++T
Sbjct  596  MAMRADPARGYPGRTYRFYKGPVVFPFGMGLSYTRFSHSLAQGPTLVSVPLTSLVAAKNT  655

Query  448  KCES---VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               S   V  +   C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF K
Sbjct  656  TMLSNHGVRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  716  VHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>gb|AGR44452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=774

 Score =   236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 156/231 (68%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++  ++ M D
Sbjct  536  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVANLPMTD  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q    VS+ L      ++T
Sbjct  596  MAMRADPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHSLAQGPTLVSVPLTSLVAAKNT  655

Query  448  KCES---VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               S   V  +   C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF K
Sbjct  656  TMLSNHGVRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  716  VHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 156/230 (68%), Gaps = 8/230 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
             DV+FA  D K+TSI+W G+PGEAGG AIADVIFG +NPSGRLP TWYPQS+ D V M +
Sbjct  528  FDVTFAKNDGKITSIMWVGYPGEAGGAAIADVIFGRYNPSGRLPMTWYPQSYVDKVPMNN  587

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPC-RS  452
            M MRPD   GYPGRTYRFY+G T++ FG GLS+T F H +V+A   VSL L   H C  S
Sbjct  588  MNMRPDGANGYPGRTYRFYSGETVYAFGDGLSFTNFIHQLVEAPRLVSLPLPPTHSCVSS  647

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
              C+++DA    CA++  D +       T SG   V     P A+  +PRK L+GF+KVR
Sbjct  648  ADCQTLDAVGPHCANTNADAN------ATCSGAFDVXT-PPPSAVKGSPRKHLLGFEKVR  700

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            L   E+ VV F V+VCK LSVVDEAG RK+ LG HVL +G+LKHSL + +
Sbjct  701  LGKGEEAVVRFRVEVCKDLSVVDEAGKRKIVLGDHVLRVGNLKHSLKIRV  750



>ref|XP_008353169.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=774

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++  ++ M D
Sbjct  536  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVANLPMTD  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q    VS+        ++T
Sbjct  596  MAMRADPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHSLAQGPTLVSVXFTSLVASKNT  655

Query  448  KC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
                   +  +   C S +LD+H+++KN GT+ G H++L+F++PP    AP KQLVGF K
Sbjct  656  TMXGNHDIRVSHTNCDSLSLDVHIDIKNSGTMDGTHTLLVFATPPTGKWAPNKQLVGFHK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLSVVD  G R++ LG H L IG L+H ++VE
Sbjct  716  VHIVAGSERRVRVGVQVCKHLSVVDXXGIRRIPLGQHKLEIGDLQHHVSVE  766



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 155/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  531  IDVSFAKNDPRIGAILWAGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQGYLAKVPMTN  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP LF FG+G+SYT F HS+VQA   V++     +  ++T
Sbjct  591  MGMRADPSRGYPGRTYRFYKGPVLFPFGHGMSYTTFAHSLVQAPQEVAVPFTSLYALQNT  650

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                 S+  +   C    L +H++VKN G + G H++L+FSSPP    +  K+L+GF+KV
Sbjct  651  TAARNSIRVSHANCEPLVLGVHIDVKNAGDMDGTHTLLVFSSPPEGKWSTNKKLIGFEKV  710

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             L     + V  ++ VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  711  HLVAGSKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHIGDLKHSISLQ  760



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 155/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++   + M D
Sbjct  538  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTD  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GP +F FG GLSYT+F +++ Q    VS+ L      ++T
Sbjct  598  MAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSYTLAQGPTLVSVPLTSLVAAKNT  657

Query  448  KC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
                   V  +   C S +LDIH++VKN GT+ G H++L+F +PPA   AP KQLVGF K
Sbjct  658  TMLNNNGVRVSHINCDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKWAPNKQLVGFHK  717

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  718  VHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 156/228 (68%), Gaps = 1/228 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA KDP++ +I+WAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +   V M  
Sbjct  533  VDVSFAKKDPRIAAIVWAGYPGQAGGAAIADILFGVANPGGKLPMTWYPQEYLSKVPMTT  592

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P   YPGRTYRFY GP +++FG+GLSYT F H+I QA  +V++ L  GH   + 
Sbjct  593  MAMRAIPSKAYPGRTYRFYKGPVVYRFGHGLSYTNFVHTIAQAPTAVAIPL-HGHHNTTV  651

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
              +++      C   ++ +HL+VKNVG   G H++L+FS PPA H AP KQLV F+KV +
Sbjct  652  SGKAIRVTHAKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGHWAPHKQLVAFEKVHV  711

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +    + V  N+ VCK+LSVVD +G R++ +G H LHIG  KH ++++
Sbjct  712  AARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKHLVSLQ  759



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 157/231 (68%), Gaps = 5/231 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP+VT+ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  540  IDVSFAKNDPRVTAILWAGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQDYVAKVPMTN  599

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P  GYPGRTYRFY GP +F FG+G+SYT F+HS+ QA   +S+ L+      + 
Sbjct  600  MGMR--PSRGYPGRTYRFYKGPVVFPFGHGMSYTTFKHSLAQAPTELSVPLNTNLYATTN  657

Query  448  KCESVDAAE---QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               S +A       C S +L  H++V+N GT+ G H++L+FS+PPA   +P KQL+GF +
Sbjct  658  STFSSNAVRVKHANCDSLSLPFHIDVQNTGTIDGTHTLLVFSTPPAGKWSPNKQLIGFHR  717

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +     + V  N+  CKHLS+VDE G R++ +G H LHIG L+HS++++
Sbjct  718  VHVLAGSQQRVEINIHACKHLSIVDELGIRRIPMGAHSLHIGDLEHSISLQ  768



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 156/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYP  +   V M +
Sbjct  530  IDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGTANPGGKLPMTWYPHDYLAKVPMTN  589

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M +R DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA   VS+ L   H  R+T
Sbjct  590  MGLRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQAPREVSVPLASLHVSRNT  649

Query  448  KCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
               S  +  +   C + AL +H++VKN G + G H++L+FSSPP    + +KQL+GF+KV
Sbjct  650  TGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQLIGFEKV  709

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             L     + V  ++ VCKHLSVVD  G R++ +G H L+IG LKHS+++ 
Sbjct  710  HLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYIGDLKHSISLR  759



>dbj|BAD98523.1| alpha-L-arabinofuranosidase / beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 155/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP + +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++  ++ M D
Sbjct  536  IDVTFAKNDPCIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVANLPMTD  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q    VS+ L      ++T
Sbjct  596  MAMRADPARGYPGRTYRFYKGPVVFPFGMGLSYTRFSHSLAQGPTLVSVPLTSLVAAKNT  655

Query  448  KCES---VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               S   V  +   C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF K
Sbjct  656  TMLSNHGVRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  716  VHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 156/232 (67%), Gaps = 4/232 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA +DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+  +V M  
Sbjct  544  IDVSFAQRDPRIGAILWVGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQSYLANVPMTS  603

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GP +F FGYGLSYT F H + QA   VS+ + + H   + 
Sbjct  604  MDMRANPTRGYPGRTYRFYKGPVVFPFGYGLSYTTFVHKLAQAPTQVSIPIARLHASSAN  663

Query  448  KC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
                 ++V      C S +L IH++V+N G   G H++L+FS+PP    A  KQLVGFQK
Sbjct  664  STSLSKAVRVTHTDCNSLSLRIHIDVENNGPTDGTHTLLIFSTPPTHKWAAHKQLVGFQK  723

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  125
            V L+    + V+  V VCKHLS+VD+ G R++ +G H LHIG  LKHS++ +
Sbjct  724  VHLAAGSRQRVILGVHVCKHLSIVDQFGIRRIPMGEHTLHIGDDLKHSISFQ  775



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 158/232 (68%), Gaps = 3/232 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  + +V  I+WAG+PG+AGG AIAD++FG +NP G+LP TWYPQ +   + M  
Sbjct  534  IDVSFAKDNNRVPGIIWAGYPGQAGGQAIADIVFGQYNPGGKLPMTWYPQEYVTKLPMTS  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPC---  458
            M MRPDP  GYPGRTYRFYTG T++ FG+G SYTKF  SI QA   VS+ LD  H C   
Sbjct  594  MNMRPDPSKGYPGRTYRFYTGNTVYPFGHGSSYTKFTESIAQAPSMVSVPLDGKHGCFRN  653

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             +  C++V  +   C+   + +H++V N+G + G H V ++S+PP  H AP KQLVGF++
Sbjct  654  DTVSCQAVRVSHTRCSGLFMSLHIDVNNIGPMDGSHVVFVYSTPPQGHGAPSKQLVGFRR  713

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            + L  N  +   F++DVC+ LS+VD+ G +K+ +G H+  +G L HS+++++
Sbjct  714  IHLPSNSQQQARFDIDVCRDLSIVDQFGLKKLPIGSHLFQVGELTHSVSLQL  765



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 155/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+   V M +
Sbjct  538  IDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQSYIAKVPMTN  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP TGYPGRTYRFY GP +F FG+G+SYT F HS+ QA   +SL +      ++T
Sbjct  598  MGMRADPSTGYPGRTYRFYKGPVVFPFGHGMSYTSFSHSLSQAPKQLSLPITSLSALKNT  657

Query  448  K--CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                 ++  +   C S  L + L+VKN G+V G  ++L+FSSPP    +  KQL+GF+K+
Sbjct  658  TGLNNAIRVSHTNCESLLLGLDLDVKNTGSVDGTQTLLVFSSPPEGKWSSNKQLIGFEKI  717

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             L     + V  N+ VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  718  HLVAGSQKQVRINIHVCKHLSVVDRFGIRRIPIGKHHLHIGDLKHSISLQ  767



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 156/231 (68%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+W G+PG+AGG AIADV+FG  NPSG+LP TWYPQ++   + M D
Sbjct  538  IDVTFAKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTD  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GP +F FG GLSYT+F +++ Q    VS+ L      ++T
Sbjct  598  MAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSYTLAQGPTLVSVPLTSLVAAKNT  657

Query  448  KCESVDAAEQT---CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               + +    +   C S +LDIH++VKN GT+ G H++L+F +PPA   AP KQLVGF K
Sbjct  658  TMLNNNGXRVSHINCDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKWAPNKQLVGFHK  717

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +    +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  718  VHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>emb|CDO98788.1| unnamed protein product [Coffea canephora]
Length=770

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 154/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +ILWAG+PG+AGG AIAD+IFG  NP  +LP TWYPQ +   V M D
Sbjct  533  VDVTFAKNDPRIAAILWAGYPGQAGGAAIADIIFGTTNPGAKLPMTWYPQDYVVKVPMTD  592

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP  GYPGRTYRFY GP +F FG+GLSYT F+ ++  A  +V + L   +  ++ 
Sbjct  593  MGMRPDPSRGYPGRTYRFYKGPVVFPFGFGLSYTAFKVALAHAPTTVPVTLASNYAFKNV  652

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                ++V  +   C +  L +H +V+NVG   G HS+L+FS+PPA   AP KQLV F+KV
Sbjct  653  TLLKDAVRVSHSNCDAMKLGMHFDVQNVGERDGSHSLLVFSTPPAGKWAPAKQLVAFEKV  712

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + +  + D CKHLSVVD  G R++ +G+H L IG L+H++T++
Sbjct  713  HVLAGAQQRISVHFDACKHLSVVDRFGIRRIPMGVHSLQIGDLEHAITLQ  762



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 155/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILWAG+PG+AGG AIADV+FG HNP G+LP TWYPQ + D++ M  
Sbjct  553  VDVSFAHNDPRIGAILWAGYPGQAGGAAIADVLFGTHNPGGKLPMTWYPQEYLDNLPMTT  612

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP   YPGRTYRFY GP ++ FG+G+SYT F H+I  A  + S+ +D  H   +T
Sbjct  613  MDMRADPSRNYPGRTYRFYKGPVVYPFGHGMSYTSFVHTIADAPKAFSVPVDGRHHSNTT  672

Query  448  KCE--SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                 S+      C   AL +H++VKN G+  G H++L+FSSPP    AP+KQLV F+KV
Sbjct  673  TVSSMSIRVNHAKCERLALRVHVDVKNTGSRDGSHTLLVFSSPPGGDWAPQKQLVAFEKV  732

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + +  ++ VCK+LSVVD  G R++ +G H LHIG  +H++++E
Sbjct  733  SVRAGGQQRIGVSIRVCKYLSVVDRFGVRRIPMGEHGLHIGDARHAVSLE  782



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 152/229 (66%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP+V +ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  546  IDVSFAKNDPRVGAILWAGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQGYLAKVPMTN  605

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRPDP TGYPGRTYRFY G  +F FG+G+SYT F HS+ QA   VSL +   +   +T
Sbjct  606  MGMRPDPATGYPGRTYRFYKGNVVFPFGHGMSYTSFSHSLTQAPKEVSLPITNLYALNTT  665

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA-LHNAPRKQLVGFQKVR  272
                          ++L I +NVKN GT+ G H++L+FSSPP+    +  KQL+GF+KV 
Sbjct  666  ISSKAIRVSHINCQTSLGIDINVKNTGTMDGTHTLLVFSSPPSGEKESSNKQLIGFEKVD  725

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            L       V  ++ VCKHLS VD  G R++ +G H ++IG LKHS++++
Sbjct  726  LVAGSQIQVKIDIHVCKHLSAVDRFGIRRIPIGDHHIYIGDLKHSISLQ  774



>gb|KDO71842.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=369

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M D
Sbjct  132  VDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTD  191

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG-HPCRS  452
            MRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A +  S+ +    +  ++
Sbjct  192  MRMR--AARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKN  249

Query  451  TKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
            T   S  +  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+
Sbjct  250  TTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFK  309

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  310  KVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  361



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 154/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  534  IDVSFAKNDPRIGAILWAGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQDYLAKVPMTN  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA   V++     +  ++T
Sbjct  594  MGMRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQAPQEVAVPFTSLYALQNT  653

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                 S+  +   C    L +H++VKN G + G  ++L+FSSPP    +  K+L+GF+KV
Sbjct  654  TAARNSIRVSHANCEPLVLGVHIDVKNTGDMDGIQTLLVFSSPPEGKWSANKKLIGFEKV  713

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + V  ++ VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  714  HIVAGSKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHIGDLKHSISLQ  763



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 156/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA  DP++ +ILW G+PG+AGG AIADV+FG HNP G+LP TWYPQ + +++ M  
Sbjct  533  IDISFAKNDPRIAAILWVGYPGQAGGAAIADVLFGTHNPGGKLPMTWYPQEYLNNLPMTT  592

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP   YPGRTYRFY GP ++ FG+G+SYT F H+I  A   VS+ +D  H   +T
Sbjct  593  MDMRADPSRNYPGRTYRFYKGPVVYPFGHGMSYTSFVHTIADAPKVVSVPVDGRHHSNTT  652

Query  448  --KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                +S+      C   +L + ++V+N G+  G H++L+FS+PP    AP KQL+ F+KV
Sbjct  653  VVSSKSIRVTHARCNRLSLVVSVDVRNTGSKDGSHTLLVFSTPPRGLGAPHKQLITFEKV  712

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +++    E V   + VCK+LSVVD AG R++ +G H LHIG ++H++++E
Sbjct  713  KVAAGGQERVPIKIHVCKYLSVVDGAGVRRIPMGEHALHIGDIRHAISLE  762



>gb|KDO71849.1| hypothetical protein CISIN_1g0062242mg [Citrus sinensis]
Length=415

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M D
Sbjct  178  VDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTD  237

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG-HPCRS  452
            MRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A +  S+ +    +  ++
Sbjct  238  MRMR--AARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKN  295

Query  451  TKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
            T   S  +  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+
Sbjct  296  TTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFK  355

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  356  KVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  407



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 152/230 (66%), Gaps = 3/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ F D V M +
Sbjct  536  VDVTFAKNDPRIAAILWVGYPGQAGGAAIADVLFGKFNPGGKLPVTWYPQQFVDKVPMTN  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGR+YRFYTGP +F +G+GLSYTKF HS+  A   +S+ LD        
Sbjct  596  MAMRADPARGYPGRSYRFYTGPVVFPYGHGLSYTKFTHSLAHAPAQISVQLDGRRASAHN  655

Query  448  KCE---SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
              E   +V  +   C   A+ +H++VKNVG   G H+VL++S+PP    AP+KQLV F+K
Sbjct  656  STEPGRAVRVSHARCDGLAIPVHVDVKNVGDQDGSHTVLVYSTPPGTRWAPQKQLVAFEK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
            V ++      V F VDVC+ LS  DE G R++ +G H L IG L H++++
Sbjct  716  VHVAVGGQVRVKFGVDVCRDLSFADEYGIRRIPIGEHSLQIGDLIHTISL  765



>dbj|BAF43576.1| arabinofuranosidase/xylosidase homolog [Prunus persica]
Length=349

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ++   + M D
Sbjct  111  IDVTFAKNDPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTD  170

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++      VS+ L   +     
Sbjct  171  MAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTLVSVPLTSLKATANS  230

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K
Sbjct  231  TMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHK  290

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   ++ V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  291  IHIAAGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  341



>gb|KHN14659.1| Beta-D-xylosidase 1 [Glycine soja]
Length=655

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA  DPK+++ILW G+PG+AGG AIADVIFG  NP GRLP TWYPQ +   V M +
Sbjct  422  VDISFAKNDPKISAILWVGYPGQAGGTAIADVIFGTTNPGGRLPMTWYPQGYLAKVPMTN  481

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F HS+  A   VS+ +   Q     
Sbjct  482  MDMRPNPTTGYPGRTYRFYKGPVVFPFGHGLSYSRFSHSLALAPKQVSVPIMSLQALTNS  541

Query  454  STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C  S  ++ H++VKN G++ G H++L+FS PP    +  KQLVGF K
Sbjct  542  TLSSKAVKVSHANCDDSLEMEFHVDVKNEGSMDGTHTLLIFSQPPHGKWSQIKQLVGFHK  601

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
              +     + V   V VCKHLSVVD+ G R++  G H LHIG +KHS++V+
Sbjct  602  THVLAGSKQRVKVGVHVCKHLSVVDQFGVRRIPTGEHELHIGDVKHSISVQ  652



>ref|XP_006349198.1| PREDICTED: probable beta-D-xylosidase 2-like [Solanum tuberosum]
Length=774

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 157/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++  I+WAG+PG+AGG AIADV+FG HNP G+LP TWYPQ +  ++ M  
Sbjct  536  VDVTFANNDPRIGGIVWAGYPGQAGGAAIADVLFGAHNPGGKLPMTWYPQEYLKNLPMTT  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF  +I +A  ++++ +D  H   S+
Sbjct  596  MDMRSNLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFITTIFEAPKTLAIPIDGRHTSNSS  655

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                +S+      C+  ++ IH++VKNVG   G H++L+FS PP     P KQLV FQKV
Sbjct  656  TITNKSIRVTHTKCSKLSIQIHIDVKNVGPKDGSHTLLVFSKPPVDVWVPHKQLVAFQKV  715

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + V  N+ VCK+LSVVD+AG R++++G H +HIG  KHSL+++
Sbjct  716  YVPARSKQRVAINIHVCKYLSVVDKAGVRRISIGEHSIHIGDAKHSLSLQ  765



>gb|KDO87030.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
 gb|KDO87031.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
Length=544

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 153/229 (67%), Gaps = 2/229 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+WAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  306  IDVAFAKNDPRIAAIIWAGYPGQAGGTAIADILFGTSNPGGKLPMTWYPQEYITNLPMTE  365

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP     YPGRTYRFY GP ++ FG+G+SYT F H++  A   V++ LD  H   + 
Sbjct  366  MAMRPSQSKRYPGRTYRFYKGPVVYPFGHGMSYTNFVHTVANAPTVVAVPLDGRHGSINA  425

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                +++      C    L + ++VKNVG+  G H++L+FS+PPA H AP KQLV F+KV
Sbjct  426  TISGKAIKVTHAKCNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHWAPHKQLVAFEKV  485

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
             +     + V  N+ VCK+LSVVD +G R++ LG H +HIG  KHS+++
Sbjct  486  HVPAGAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHIGGTKHSVSL  534



>dbj|BAO45878.1| beta-D-xylosidase [Acacia mangium]
Length=763

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 150/228 (66%), Gaps = 1/228 (0%)
 Frame = -2

Query  805  DVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMIDM  626
            DVSFA  DPK+++ILW G+PG+AGG A+ADV+FG  NP GRLP TWYP  +   V M  M
Sbjct  533  DVSFAKNDPKISAILWVGYPGQAGGTALADVLFGTTNPGGRLPMTWYPHEYVTKVPMTTM  592

Query  625  RMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRSTK  446
             MRP+P TGYPGRTYRFY GP +F FGYGLSYT+F H++ QA   VSL+  Q     +  
Sbjct  593  DMRPNPATGYPGRTYRFYKGPVVFPFGYGLSYTRFTHTLAQAPKEVSLSRLQALTNSTIS  652

Query  445  CESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
             +++  +   C  +  L  H++VKN G + G H++L++S PP+   +  K+LVGF +V +
Sbjct  653  NQAMRLSHVDCNKAPELGFHIDVKNEGPMDGAHTLLVYSKPPSGRWSETKRLVGFHRVHV  712

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
                 + V   +  C+HLSVVD  G R++  G H LHIG +KHSL+V+
Sbjct  713  PSGSKQRVKIGIHACEHLSVVDMFGIRRIPFGEHELHIGDIKHSLSVQ  760



>ref|XP_010313018.1| PREDICTED: slArf/Xyl1 protein isoform X1 [Solanum lycopersicum]
Length=633

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 154/236 (65%), Gaps = 10/236 (4%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP+V+SI+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   VSM +
Sbjct  392  IDVTFAKNDPRVSSIVWVGYPGQAGGAAIADVLFGATNPGGKLPMTWYPQDYVAKVSMAN  451

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GPT+F FG G+SYT F   +V A  +VS+     H   S 
Sbjct  452  MDMRANPSKGYPGRTYRFYKGPTVFPFGAGISYTTFSQHLVSAPITVSVPTLHSHDLVSN  511

Query  448  KCESVDAAEQT-------CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
               ++  A+ T       C S  +D+H++VKN G + G H+VL+FS+PP       KQLV
Sbjct  512  NTTTLMKAKATVRTIHTNCESLDIDMHIDVKNTGDMDGTHAVLIFSTPP--DPTETKQLV  569

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  125
             F+KV +     + V  N++ CKHLSV DE G R++ +G H +H+G HLKHS+T +
Sbjct  570  AFEKVHVVAGAKQRVKINMNACKHLSVADEYGVRRIYMGEHKIHVGDHLKHSITFQ  625



>gb|KHG28205.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=529

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 156/232 (67%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV++G  NP G+LP TWYPQ +  +++M D
Sbjct  291  IDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLYGTTNPGGKLPMTWYPQDYVSNLAMTD  350

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR      YPGRTYRFY GP ++ FG+GLSYT F H+IV A   V++ LD GH  RS 
Sbjct  351  MAMRSSTHRNYPGRTYRFYKGPVVYPFGHGLSYTNFVHTIVNAPLVVTVPLD-GHR-RSG  408

Query  448  KC----ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
                  +++      C   ++ + +NVKN G+  G H++L+FS PPA H AP KQLV F 
Sbjct  409  NATVLGKAIKVNHARCNKLSVGLQVNVKNTGSKDGTHTILVFSIPPAGHWAPSKQLVAFA  468

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV +    ++ V  ++ VCK LSVVD +G R++ +GLH +HIG +KHS+++E
Sbjct  469  KVYVLARSEQQVGISIHVCKFLSVVDRSGVRRIPIGLHHIHIGDVKHSVSLE  520



>ref|XP_004172482.1| PREDICTED: beta-D-xylosidase 1-like, partial [Cucumis sativus]
Length=534

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 150/229 (66%), Gaps = 4/229 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  D K++ ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+   V M +
Sbjct  301  IDVSFAKNDGKISGILWVGYPGQAGGAAIADVLFGATNPGGKLPMTWYPQSYLAKVPMTN  360

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M +RPDP TGYPGRTYRFY GP +F FG+GLSY+KF  S  +A   +SL L         
Sbjct  361  MGLRPDPSTGYPGRTYRFYKGPVVFPFGFGLSYSKFSQSFAEAPTKISLPLSSL---SPN  417

Query  448  KCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
               +V  +   CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV 
Sbjct  418  SSATVKVSHTDCASVSDLPIMIDVKNTGTVDGSHTILVFSTVPNQTWSPEKHLIGFEKVH  477

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            L     + V   + VC HLS VDE G R++ +G H LHIG L HS++++
Sbjct  478  LIAGSQKRVRIGIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLTHSISLQ  526



>gb|KDO71843.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=476

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M D
Sbjct  239  VDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTD  298

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG-HPCRS  452
            MRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A +  S+ +    +  ++
Sbjct  299  MRMR--AARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKN  356

Query  451  TKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
            T   S  +  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+
Sbjct  357  TTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFK  416

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  417  KVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  468



>gb|KDO71845.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71846.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71847.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71848.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=486

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M D
Sbjct  249  VDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVSRLPMTD  308

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG-HPCRS  452
            MRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A +  S+ +    +  ++
Sbjct  309  MRMR--AARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKN  366

Query  451  TKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
            T   S  +  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+
Sbjct  367  TTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFK  426

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  427  KVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  478



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 155/229 (68%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFAV DPK+++ILW G+PG+AGG AIADVIFG+ NP GRLP TWYP+ +   V M +
Sbjct  537  VDISFAVNDPKISAILWVGYPGQAGGTAIADVIFGHTNPGGRLPMTWYPEGYLSKVPMTN  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQ-GHPCRS  452
            M MRP+P TGYPGRTYRFY GP +F FG+GLSY+ F H++  A   +SL L    +   S
Sbjct  597  MDMRPNPGTGYPGRTYRFYKGPVVFPFGHGLSYSTFTHALAIAPKHLSLPLTTFTNSTLS  656

Query  451  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
            T+   +  A     +  ++ H++VKN G++ G H++L+FS PP    +  KQLV FQK+ 
Sbjct  657  TQAPRLSHANCDHDTLDMEFHVDVKNDGSMDGTHTLLVFSKPPPGKWSQIKQLVNFQKIH  716

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +     + V   V VCKHLSVVD+ G R++  G H LHIG LKHS++V+
Sbjct  717  VPAGSTQRVTVGVHVCKHLSVVDQFGIRRIPSGEHELHIGDLKHSISVQ  765



>ref|XP_003546334.1| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=775

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA  DPK+++ILW G+PG+AGG AIADVIFG  NP GRLP TWYPQ +   V M +
Sbjct  542  VDISFAKNDPKISAILWVGYPGQAGGTAIADVIFGTTNPGGRLPMTWYPQGYLAKVPMTN  601

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F HS+  A   VS+ +   Q     
Sbjct  602  MDMRPNPTTGYPGRTYRFYKGPVVFPFGHGLSYSRFSHSLALAPKQVSVPIMSLQALTNS  661

Query  454  STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C  S  ++ H++VKN G++ G H++L+FS PP    +  KQLVGF K
Sbjct  662  TLSSKAVKVSHANCDDSLEMEFHVDVKNEGSMDGTHTLLIFSQPPHGKWSQIKQLVGFHK  721

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
              +     + V   V VCKHLSVVD+ G R++  G H LHIG +KHS++V+
Sbjct  722  THVLAGSKQRVKVGVHVCKHLSVVDQFGVRRIPTGEHELHIGDVKHSISVQ  772



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 156/232 (67%), Gaps = 4/232 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D++FA  DP++  ILWAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  509  VDITFAKNDPRIQGILWAGYPGQAGGAAIADILFGTSNPGGKLPMTWYPQGYIKNLPMTN  568

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR     GYPGRTYRFY GP ++ FGYGLSYT F H++  A   VS+ +D      S+
Sbjct  569  MAMRASRSKGYPGRTYRFYNGPVVYPFGYGLSYTHFVHTLTSAPKLVSIPVDGHRHGNSS  628

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGFQ  281
                +++      C   ++++H++VKNVG+  G H++L+FS+PPA   H AP KQLV F+
Sbjct  629  NIANKAIKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFE  688

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV +     + V   + VCK LSVVD +G R++ +GLH LHIG +KHS++++
Sbjct  689  KVHIPAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSLHIGDVKHSVSLQ  740



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 159/230 (69%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA KDP+++ I+W G+PG+AGG AIADV+FG HNP G+LP TWYPQ + +++ M  
Sbjct  535  VDVTFAEKDPRISGIVWVGYPGQAGGAAIADVLFGAHNPGGKLPMTWYPQEYLNNLPMTT  594

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRS-  452
            M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF ++I +A + +++ +   H   + 
Sbjct  595  MDMRANLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFINTIAEAPNMLAIPIFGRHASNTT  654

Query  451  -TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
             T  +++      C+  ++ +H++VKNVG+  G  ++L+FS PP    AP KQLV FQKV
Sbjct  655  ITTSKAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPIGLWAPHKQLVAFQKV  714

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + V  N+ VCK+LSVVD+AG R++ +G H LHIG  KHSL+++
Sbjct  715  HVPAGSLQRVAINIHVCKYLSVVDKAGVRRIPIGEHSLHIGDAKHSLSLQ  764



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 157/233 (67%), Gaps = 5/233 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  D +++ ILWAG+PG+AGG A+ADV+FG  NP G+LP TWYPQ +  ++ M  
Sbjct  538  IDVSFAKNDRRISGILWAGYPGQAGGAAVADVLFGKSNPGGKLPMTWYPQDYISNLPMTA  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P   YPGRTYRFY GP ++ FGYGLSY+KF HSI +A    S+ +D     ++T
Sbjct  598  MDMRSSPSKNYPGRTYRFYKGPVVYPFGYGLSYSKFVHSIAEAPTVFSVPIDGHRKAQNT  657

Query  448  KCESVDAAEQT---CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGF  284
               S  A   T   C   +L +H++VKNVG+  G H++L+FS+PP    H AP KQLV F
Sbjct  658  STISNKAIRVTHTRCNRLSLGLHVDVKNVGSRDGSHTLLVFSTPPTENGHWAPLKQLVAF  717

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            QKVR++    + V  ++ VCK+LSVVD +G R++ +G H +HIG  +HS++++
Sbjct  718  QKVRVAAGSQQRVRISIHVCKYLSVVDRSGIRRLPMGEHNIHIGDARHSVSLQ  770



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 156/232 (67%), Gaps = 4/232 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D++FA  DP++  ILWAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  532  VDITFAKNDPRIQGILWAGYPGQAGGAAIADILFGTSNPGGKLPMTWYPQGYIKNLPMTN  591

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR     GYPGRTYRFY GP ++ FGYGLSYT F H++  A   VS+ +D      S+
Sbjct  592  MAMRASRSKGYPGRTYRFYNGPVVYPFGYGLSYTHFVHTLTSAPKLVSIPVDGHRHGNSS  651

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGFQ  281
                +++      C   ++++H++VKNVG+  G H++L+FS+PPA   H AP KQLV F+
Sbjct  652  NIANKAIKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFE  711

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV +     + V   + VCK LSVVD +G R++ +GLH LHIG +KHS++++
Sbjct  712  KVHIPAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSLHIGDVKHSVSLQ  763



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 156/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+WAG+PG+ GG AIADV+FG HNP G+LP TWYPQ + +++ M  
Sbjct  536  VDVTFANNDPRIGAIVWAGYPGQGGGAAIADVLFGAHNPGGKLPMTWYPQEYLNNLPMTT  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF  +I +A  ++++ +D  H   S+
Sbjct  596  MDMRSNLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFITTIFEAPKTLAIPIDGRHTYNSS  655

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                +S+      C+  ++ IH++VKNVG   G H++L+FS PP     P KQLV FQKV
Sbjct  656  TISNKSIRVTHAKCSKISVQIHVDVKNVGPKDGSHTLLVFSKPPVDIWVPHKQLVAFQKV  715

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + V  N+ VCK+LSVVD AG R++ +G H +HIG  KHSL+++
Sbjct  716  YVPARSKQRVAINIHVCKYLSVVDRAGVRRIPIGEHSIHIGDAKHSLSLQ  765



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 154/236 (65%), Gaps = 10/236 (4%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP+V+SI+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   VSM +
Sbjct  530  IDVTFAKNDPRVSSIVWVGYPGQAGGAAIADVLFGATNPGGKLPMTWYPQDYVAKVSMAN  589

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +P  GYPGRTYRFY GPT+F FG G+SYT F   +V A  +VS+     H   S 
Sbjct  590  MDMRANPSKGYPGRTYRFYKGPTVFPFGAGISYTTFSQHLVSAPITVSVPTLHSHDLVSN  649

Query  448  KCESVDAAEQT-------CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  290
               ++  A+ T       C S  +D+H++VKN G + G H+VL+FS+PP       KQLV
Sbjct  650  NTTTLMKAKATVRTIHTNCESLDIDMHIDVKNTGDMDGTHAVLIFSTPP--DPTETKQLV  707

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  125
             F+KV +     + V  N++ CKHLSV DE G R++ +G H +H+G HLKHS+T +
Sbjct  708  AFEKVHVVAGAKQRVKINMNACKHLSVADEYGVRRIYMGEHKIHVGDHLKHSITFQ  763



>ref|XP_009383731.1| PREDICTED: probable beta-D-xylosidase 2 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 152/232 (66%), Gaps = 4/232 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP + +ILWAG+PG+AGG AIA+VIFG HNP G+LP TWYPQ + + V+M +
Sbjct  544  VDVSFAKDDPNIAAILWAGYPGQAGGTAIAEVIFGAHNPGGKLPVTWYPQEYVEKVTMTN  603

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPC-  458
            M MR DP TGYPGRTYRFY GP ++ FG+GLSYTKF H++      VS+  D  +  P  
Sbjct  604  MAMRADPSTGYPGRTYRFYDGPVVYSFGHGLSYTKFTHALADTPAQVSVPFDGLRAEPLF  663

Query  457  -RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
              S    +V      C   ++ +H++V N G   G H+VL++  PPA   AP KQLV F+
Sbjct  664  NASEPGRTVPVTHARCDGLSVPVHVDVTNAGDRDGSHTVLVYWRPPAADGAPSKQLVAFE  723

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV L+  E   V+  VDVC+ L+V D  G R++ LG H LH+G L H+++++
Sbjct  724  KVHLAAGEQVRVLLGVDVCRDLTVADGDGIRRIPLGEHSLHVGDLTHTISLQ  775



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 156/230 (68%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILWAG+PG+AGG AIADV++G  NP G+LP TWYPQ +  ++ M D
Sbjct  580  IDVSFAKNDPRIGAILWAGYPGQAGGAAIADVLYGTTNPEGKLPMTWYPQEYVSNLPMTD  639

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P   YPGRTYRFY GP ++ FG+GLSYT F H+I  A   V++ LD  H   +T
Sbjct  640  MAMRSRPLKNYPGRTYRFYKGPLVYPFGHGLSYTNFVHTIASAPKVVTVPLDGRHHSGNT  699

Query  448  KC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
                +++      C    + + ++VKN G+  G H++L+FS+ PA H AP+KQLV F KV
Sbjct  700  TVSGKAIKVNHAKCNKLTIGLQVDVKNTGSKDGTHTMLVFSTTPAGHWAPQKQLVAFAKV  759

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            R+     + +  N+ VCK LSVVD +G R++ +G+H LHIG++KHS++++
Sbjct  760  RVPAGAQQRIGINIHVCKFLSVVDGSGVRRIPIGVHNLHIGNVKHSVSLQ  809



>gb|KJB49844.1| hypothetical protein B456_008G140600 [Gossypium raimondii]
Length=774

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 158/232 (68%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILWAG+PG+AGG AIADV++G  NP G+LP TWYPQ +  +++M D
Sbjct  536  IDVSFAKNDPRIGAILWAGYPGQAGGAAIADVLYGTTNPGGKLPMTWYPQDYVSNLAMTD  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR      YPGRTYRFY GP ++ FG+GLSYT F H+IV A   V++ LD GH  RS 
Sbjct  596  MAMRSSRHRNYPGRTYRFYKGPVVYPFGHGLSYTNFVHTIVNAPHVVTVPLD-GHR-RSG  653

Query  448  KC----ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
                  +++      C   ++ + +NVKN G+  G H++L+FS+PPA H AP KQLV F 
Sbjct  654  NATVLGKAIKVNHARCNKLSVGLQVNVKNTGSKDGTHTMLVFSTPPAGHWAPSKQLVAFA  713

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV +    ++ V  ++ VCK LSVVD +G R++ +GLH +HIG +KHS+++E
Sbjct  714  KVYVPARSEQQVGISIHVCKFLSVVDRSGVRRIPIGLHRIHIGDVKHSVSLE  765



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 155/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+ SI+WAG+PG+AGG AI+DV+FG  NP G+LP TWYPQ +  ++ M D
Sbjct  531  IDVSFAENDPKIGSIVWAGYPGQAGGAAISDVLFGITNPGGKLPMTWYPQDYITNLPMTD  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ LD    G   
Sbjct  591  MAMRSSKSKGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLDGHRHGSGN  650

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             +   +++      C   +L + ++VKN+G++ G H++L++S PPA H AP KQLV F+K
Sbjct  651  ATISRKAIRVTHARCNKLSLGVQVDVKNIGSMDGTHTLLVYSRPPARHWAPHKQLVAFEK  710

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V ++    + V  N+ VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  711  VHVAAGTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHIGDVKHSVSLQ  761



>ref|XP_008458374.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Cucumis 
melo]
Length=768

 Score =   224 bits (571),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 150/228 (66%), Gaps = 3/228 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  D K++ ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+   V M +
Sbjct  534  IDVSFAKNDGKISGILWVGYPGQAGGAAIADVLFGATNPGGKLPMTWYPQSYLAKVPMTN  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M +RPDP TGYPGRTYRFY GP +F FG+GLSY+KF HSI +A   +SL L         
Sbjct  594  MGLRPDPSTGYPGRTYRFYKGPVVFPFGFGLSYSKFSHSIAEAPTKISLPLSSLS--XPN  651

Query  448  KCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
               +V  +   CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV 
Sbjct  652  SSAAVKVSHTDCASVSDLPIQVDVKNTGTVDGSHTILVFSTAPNPIWSPEKHLIGFEKVH  711

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
            L     + V   + VC HLS VDE G R++  G H LHIG L HS+++
Sbjct  712  LMAGSQKRVRIGIHVCDHLSRVDEFGTRRIPTGEHKLHIGDLTHSISL  759



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   224 bits (570),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 155/228 (68%), Gaps = 0/228 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA KDPK+ +ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +  ++ M +
Sbjct  532  IDVSFAKKDPKIAAILWAGYPGQAGGAAIADVLFGTINPGGKLPMTWYPQEYITNLPMTE  591

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ LD      S 
Sbjct  592  MAMRSSQSKGYPGRTYRFYQGKVVYPFGHGMSYTHFVHNIASAPTMVSVPLDGHRGNTSI  651

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
              +++      C   +L I ++VKNVG+  G H++L++S+PPA   +P KQLV F++V +
Sbjct  652  SGKAIRVTHTKCNKLSLGIQVDVKNVGSKDGTHTLLVYSAPPAGRWSPHKQLVAFERVHV  711

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            S    E V  ++ VCK LSVVD +G R++ +G H +HIG++KHS++++
Sbjct  712  SAGTQERVGISIHVCKLLSVVDRSGIRRIPIGEHSIHIGNVKHSVSLQ  759



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 155/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+ SI+WAG+PG+AGG AI+DV+FG  NP G+LP TWYPQ +  ++ M D
Sbjct  531  IDVSFAENDPKIGSIVWAGYPGQAGGAAISDVLFGITNPGGKLPMTWYPQDYITNLPMTD  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ LD    G   
Sbjct  591  MAMRSSKSKGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLDGRRHGSGN  650

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             +   +++      C   +L + ++VKN+G++ G H++L++S PPA H AP KQLV F+K
Sbjct  651  ATISRKAIRVTHARCNKLSLGMQVDVKNIGSMDGTHTLLVYSRPPARHWAPHKQLVAFEK  710

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V ++    + V  N+ VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  711  VHVAAGTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHIGDVKHSVSLQ  761



>ref|XP_008451490.1| PREDICTED: probable beta-D-xylosidase 2 [Cucumis melo]
Length=773

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 163/233 (70%), Gaps = 7/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++++ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+  ++ M +
Sbjct  534  IDVSFAKNDPRISAILWVGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQSYLSNLPMTN  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MR +  + YPGRTYRFY+GP +++FG+GLSYT F H+IV+A   VS++L    Q H  
Sbjct  594  MAMRSN--SSYPGRTYRFYSGPVVYEFGHGLSYTNFIHTIVKAPTIVSVSLSGHRQTHSA  651

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGF  284
             +   +++      C   +L IH++V+N G   G H++L+FS+PPA      PRKQLV F
Sbjct  652  STLSGKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFSTPPANGATWVPRKQLVAF  711

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +K+ LS  E   +  +V +CK+LSVVD+ G R++ LG HV+HIG +KH+++++
Sbjct  712  EKLHLSSKEKRRLQVHVHICKYLSVVDKLGVRRIPLGDHVIHIGDVKHTISLQ  764



>ref|XP_010671663.1| PREDICTED: beta-D-xylosidase 1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 156/234 (67%), Gaps = 5/234 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+++I+W G+PG+AGG AIADV+FG  NP GRLPNTWYPQ +   ++M D
Sbjct  531  VDVSFAKVDPKISAIVWVGYPGQAGGTAIADVLFGTTNPGGRLPNTWYPQDYVAKIAMTD  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            + MR +P  GYPGRTYRFY GP +F FG+GLSYT+F  S+ QA   V + L + +   +T
Sbjct  591  LAMRANPVRGYPGRTYRFYRGPVVFPFGFGLSYTRFSQSLAQAPTKVMVPLSKHYTSTNT  650

Query  448  KCESVDAAE----QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
               S +A      +   +++L +H++VKN G   G H+VL+FSSPP    A  K L+GF+
Sbjct  651  TTLSNNAVRVLHTKCDTTTSLSLHIDVKNTGEADGSHTVLVFSSPPRGAQASEKHLIGFK  710

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVEI  122
            KV +     E V  N+ VCKHLS  DE G R++ +G H LHIG  +KH L++++
Sbjct  711  KVHVLAGSLERVRMNIHVCKHLSTADEFGIRRIQMGEHTLHIGDDIKHQLSLQV  764



>sp|P83344.1|XYNB_PRUPE RecName: Full=Putative beta-D-xylosidase; AltName: Full=PpAz152, 
partial [Prunus persica]
 gb|AAM00218.1|AF362990_1 beta-D-xylosidase, partial [Prunus persica]
Length=461

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIA+V+FG  NP G+LP TWYPQ++   + M D
Sbjct  223  IDVTFAKNDPRISAIIWVGYPGQAGGTAIANVLFGTANPGGKLPMTWYPQNYVTHLPMTD  282

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++      VS+ L   +     
Sbjct  283  MAMRADPARGYPGRTYRFYIGPVVFPFGLGLSYTTFAHNLAHGPTLVSVPLTSLKATANS  342

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K
Sbjct  343  TMLSKTVRVSHPDCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHK  402

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   ++ V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  403  IHIATGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  453



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 153/229 (67%), Gaps = 2/229 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +I+WAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  532  IDVAFAKNDPRIAAIIWAGYPGQAGGTAIADILFGTSNPGGKLPMTWYPQEYITNLPMTE  591

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPC--R  455
            M MRP     YPGRTYRFY GP ++ FG+G+SYT F H++  A   V++ LD  H     
Sbjct  592  MAMRPSQSKRYPGRTYRFYKGPVVYPFGHGMSYTNFVHTVANAPTVVAVPLDGRHGSINA  651

Query  454  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            +   +++      C    L + ++VKNVG+  G H++L+FS+PPA H AP KQLV F+KV
Sbjct  652  TISGKAIKVTHAKCNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHWAPHKQLVAFEKV  711

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
             +     + V  N+ VCK+LSVVD +G R++ LG H +HIG  KHS+++
Sbjct  712  HVPAGAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHIGGTKHSVSL  760



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 153/232 (66%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++++ILWAG+PG+AGG AIADV++G  NP G+LP TWYPQ +  ++ M D
Sbjct  538  IDVSFAKNDPRISAILWAGYPGQAGGAAIADVLYGTTNPEGKLPMTWYPQEYVSNLPMTD  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD----QGHP  461
            M MR  P   YPGRTY+FY GP ++ FG+GLSYT F H+I  A   V++ LD     G+ 
Sbjct  598  MAMRSSPNRNYPGRTYKFYKGPVVYPFGHGLSYTNFVHTIASAPKVVTVPLDGHRHSGNA  657

Query  460  CRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
              S K   V+     C   ++ + ++VKN G+  G H++L+FS PPA H AP+KQLV F 
Sbjct  658  TISGKAIKVNHVR--CNKLSVGLQVDVKNTGSKEGTHTMLVFSKPPAGHWAPQKQLVAFA  715

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV +       V  N+ VCK LSVVD +G R++  G+H LHIG  KHSL+++
Sbjct  716  KVHVPARSQRRVGINIHVCKFLSVVDRSGVRRIPTGVHNLHIGGAKHSLSLQ  767



>ref|XP_009609889.1| PREDICTED: putative beta-D-xylosidase, partial [Nicotiana tomentosiformis]
Length=496

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 147/227 (65%), Gaps = 10/227 (4%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP+V++ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V+M +
Sbjct  269  IDVTFAKNDPRVSAILWVGYPGQAGGAAIADVLFGAANPGGKLPMTWYPQDYVAKVAMTN  328

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP +F FG G SYT+F  SIV A   VS+      P    
Sbjct  329  MDMRADPARGYPGRTYRFYKGPVVFPFGAGFSYTRFSQSIVSAPAIVSV------PTLDM  382

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            +  +V      C S  L +H++VKN G + G H++L+FS PP    A  KQLV FQKV +
Sbjct  383  RKTAVRTTHTNCDSLNLHLHIHVKNTGDMDGTHTLLIFSKPPP---AATKQLVAFQKVHV  439

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH-LKHSLT  131
            +    + V  N++ CKHL+V D+ G R++ +G H +H+G  + HS+T
Sbjct  440  AAGAQQRVNININACKHLTVADQFGIRRIFMGEHKIHVGEDINHSIT  486



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 150/231 (65%), Gaps = 2/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP GRLP TWYPQ +     M +
Sbjct  530  IDVSFAKNDPRIGAILWVGYPGQAGGTAIADVLFGRTNPGGRLPMTWYPQDYLAKAPMTN  589

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQ--GHPCR  455
            M MR +P +GYPGRTYRFY GP +F FG+G+SYT F H +  A  +VS+ L    G    
Sbjct  590  MAMRANPSSGYPGRTYRFYKGPVVFPFGHGMSYTTFAHELAHAPTTVSVPLTSLYGLQNS  649

Query  454  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            +T    +      C +  L IH++VKN G + G H+VL+FS+PP       KQL+GF+KV
Sbjct  650  TTFNNGIRVTHTNCDTLILGIHIDVKNTGDMDGTHTVLVFSTPPVGKWGANKQLIGFKKV  709

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
             +     + V  +V VC  LSVVD+ G R++ +G H LHIG +KHS+++++
Sbjct  710  HVVARGRQRVKIHVHVCNQLSVVDQFGIRRIPIGEHSLHIGDIKHSISLQV  760



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 151/229 (66%), Gaps = 1/229 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA   P++ +ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M  
Sbjct  537  IDVSFARDAPRIPAILWAGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQDYVARLPMTT  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR DP  GYPGRTYRFY GP ++ FG+G+SYT F ++I  A   V++ L       ST
Sbjct  597  MDMRSDPWRGYPGRTYRFYKGPVVYPFGHGMSYTNFVYTIADAPAMVTVPLRGHQGNSST  656

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS-PPALHNAPRKQLVGFQKVR  272
              +++      C   ++ +H++VKN G+  G HS+L+FSS PPA H  P+KQLV F+KV 
Sbjct  657  SGKAIKVTHAKCDGLSVVLHVDVKNAGSKDGSHSLLVFSSPPPAEHWVPQKQLVAFEKVH  716

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            L     + V   + +CK LSVVD+ G R++ LG HVLHIG++ HS+ + 
Sbjct  717  LPAGSQQRVQITIHLCKFLSVVDKLGIRRIPLGQHVLHIGNIHHSIVLR  765



>ref|XP_002276351.1| PREDICTED: putative beta-D-xylosidase [Vitis vinifera]
Length=770

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQS+     M +
Sbjct  531  IDVSFAKNDPRIAAIIWVGYPGQAGGTAIADVLFGRTNPGGKLPVTWYPQSYLRKAPMTN  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P  GYPGRTYRFY GP +F FG+GLSY+ F HS+ QA  +VS++L      +++
Sbjct  591  MAMRAIPSRGYPGRTYRFYNGPVVFPFGHGLSYSTFAHSLAQAPTTVSVSLASLQTIKNS  650

Query  448  KCESVDA---AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               S  A   +   C +  L  H++VKN GT+ G H++LLFS+PP    +P K+L+ F+K
Sbjct  651  TIVSSGAIRISHANCNTQPLGFHIDVKNTGTMDGSHTLLLFSTPPPGTWSPNKRLLAFEK  710

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V +     E V F+V VCKHLSVVD  G  ++ +G H  HIG LKHS++++
Sbjct  711  VHVGAGSQERVRFDVHVCKHLSVVDHFGIHRIPMGEHHFHIGDLKHSISLQ  761



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 152/233 (65%), Gaps = 7/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++++ILWAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +   V M  
Sbjct  537  IDVSFARDDPRISAILWAGYPGQAGGAAIADILFGRSNPGGKLPMTWYPQDYVAKVPMTS  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P  GYPGRTYRFY GP ++ FG+G+SYT F H++ QA   VS+ LD      ++
Sbjct  597  MGMR--PSGGYPGRTYRFYRGPVVYPFGHGMSYTNFAHTVAQAPTLVSVPLDGRRAVGNS  654

Query  448  KC-----ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
                   ++V      C   ++ +H++VKN G + G HS+L+FS PP    AP KQLV F
Sbjct  655  TTVSFSGKAVRVTHAKCDGLSVVVHVDVKNTGPMDGAHSLLVFSEPPTGQWAPSKQLVAF  714

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +KV +    ++ V   +  CKHLSVVD  G R++ +G H LHIG +KHS++++
Sbjct  715  EKVHVPAGTEQRVEVKIHACKHLSVVDRFGIRRIPMGEHSLHIGDVKHSVSLQ  767



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ++   + M D
Sbjct  537  IDVTFAKNDPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTD  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++     SVS+ L   +     
Sbjct  597  MAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTSVSVPLTSLKATANS  656

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K
Sbjct  657  TMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHK  716

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   +  V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  717  IHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ++   + M D
Sbjct  537  IDVTFAKNDPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTD  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++     SVS+ L   +     
Sbjct  597  MAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTAFAHNLAHGPTSVSVPLTSLKATANS  656

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K
Sbjct  657  TMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHK  716

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   ++ V   V  CKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  717  IHIAAGSEKRVRIAVHACKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 150/229 (66%), Gaps = 4/229 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  D K++ ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+   V M +
Sbjct  537  IDVSFAKNDGKISGILWVGYPGQAGGAAIADVLFGATNPGGKLPMTWYPQSYLAKVPMTN  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M +RPDP TGYPGRTYRFY GP +F FG+GLSY+KF  S  +A   +SL L         
Sbjct  597  MGLRPDPSTGYPGRTYRFYKGPVVFPFGFGLSYSKFSQSFAEAPTKISLPLSSLS---PN  653

Query  448  KCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
               +V  +   CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV 
Sbjct  654  SSATVKVSHTDCASVSDLPIMIDVKNTGTVDGSHTILVFSTVPNQTWSPEKHLIGFEKVH  713

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            L     + V   + VC HLS VDE G R++ +G H LHIG L HS++++
Sbjct  714  LIAGSQKRVRIGIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLTHSISLQ  762



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 152/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+  I+WAG+PG+AGG AI+DV+FG  NP G+LP TWYPQ +  ++ M +
Sbjct  531  IDVSFAENDPKIGGIVWAGYPGQAGGAAISDVLFGTTNPGGKLPMTWYPQDYVTNLPMTN  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MRP    GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ LD   Q    
Sbjct  591  MAMRPSTSNGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLDGHRQASRN  650

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             +   +++      C   +  + ++VKN G++ G H++L++S PPA H AP KQLV F+K
Sbjct  651  ATISGKAIRVTHARCNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHWAPLKQLVAFEK  710

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V ++      V  NV VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  711  VHVTAGTQRRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHIGDVKHSVSLQ  761



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ++   + M D
Sbjct  537  IDVTFAKNDPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTD  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++     SVS+ L   +     
Sbjct  597  MAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTSVSVPLTSLKATANS  656

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K
Sbjct  657  TMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHK  716

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   +  V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  717  IHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>gb|KDO71844.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=485

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 160/232 (69%), Gaps = 7/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M D
Sbjct  249  VDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANP-GKLPMTWYPQDYVSRLPMTD  307

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG-HPCRS  452
            MRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A +  S+ +    +  ++
Sbjct  308  MRMRA--ARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKN  365

Query  451  TKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
            T   S  +  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+
Sbjct  366  TTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFK  425

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  426  KVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  477



>gb|ADV41671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Actinidia deliciosa 
var. deliciosa]
Length=634

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 152/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ++   + M D
Sbjct  396  IDVTFAKNDPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTD  455

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++      VS+ L   +     
Sbjct  456  MAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTLVSVPLTSLKATANS  515

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K
Sbjct  516  TMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHK  575

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   +  V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  576  IHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  626



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 160/231 (69%), Gaps = 7/231 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+++ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ + + + M +
Sbjct  530  VDVTFAKNDPKISAILWAGYPGQAGGQAIADVLFGTTNPGGKLPMTWYPQEYLNKLPMTN  589

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR  P  GYPGRTYRFY GP ++ FG+GLSYT F H+I  A   V++ LD GH  RS 
Sbjct  590  MGMRSGP--GYPGRTYRFYQGPVVYPFGHGLSYTHFTHTIADAPMEVTVPLD-GHR-RSN  645

Query  448  KCESVDAAEQT---CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               S  A   T   C   +L +H++VKN G+  G H++L+FS PPA   AP+KQLV F++
Sbjct  646  ASASGKAIRVTHARCGQLSLMVHVDVKNEGSKDGAHTLLVFSRPPAGKWAPQKQLVAFER  705

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V L     + V  ++ VCK+LSVVD++G R++ LG H +HIG+ +HS++++
Sbjct  706  VHLPAGSQQRVRVHIHVCKYLSVVDKSGIRRIPLGDHHIHIGNARHSISLK  756



>gb|EYU46800.1| hypothetical protein MIMGU_mgv1a018473mg [Erythranthe guttata]
Length=757

 Score =   221 bits (563),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 155/233 (67%), Gaps = 5/233 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+ +ILWAG+PG+AGG AIADV+FG HNP G+LP TWYPQ + +++ M  
Sbjct  516  IDVSFAENDPKIGAILWAGYPGQAGGAAIADVLFGSHNPGGKLPMTWYPQEYLNNLPMTT  575

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSI-VQAQDSVSLALDQGH----  464
            M MR +P   YPGRTYRFY GP ++ FG+G+SYT F H++   A   VS+ +D  H    
Sbjct  576  MDMRSNPSRNYPGRTYRFYKGPVVYPFGHGMSYTSFAHAVSADAPTVVSVPVDGRHHHLY  635

Query  463  PCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGF  284
               +    +V      C   +L + ++VKN G+  G H++L+F+SPP    AP KQLV F
Sbjct  636  NDTAFSGGAVRVTHARCKGLSLSVGMDVKNTGSRDGSHTLLVFASPPGGGWAPHKQLVAF  695

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +KVR++    E V   + VCK LSVVD AG R++ +G+H LHIG +KHS++++
Sbjct  696  EKVRVAAGGQERVAVRIHVCKFLSVVDGAGIRRIPMGVHALHIGGVKHSVSLQ  748



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 153/233 (66%), Gaps = 7/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP+V++I+WAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  534  IDVSFAKNDPRVSAIIWAGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQDYVAKVPMTN  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG----HP  461
            M MR  P  GYPGRTYRFY GP +F FG+GLSYT F+HS+  A   +S+ LD        
Sbjct  594  MGMR--PSRGYPGRTYRFYKGPVVFPFGHGLSYTSFKHSLALAPTDLSVLLDTNLFATKN  651

Query  460  CRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHN-APRKQLVGF  284
              +    ++      C S +   H++V+N G + G H++L+FS+PPA    +P KQL+GF
Sbjct  652  YSTLSSNAIRVKHAKCDSLSSLFHIDVENTGNMDGTHTLLVFSTPPAGQKWSPNKQLIGF  711

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +V +     + V  N+  CKHLSVVDE G R++ +G H LHIG LKHS++++
Sbjct  712  HRVHVVAGSKQRVKINIHACKHLSVVDEFGIRRIPMGSHSLHIGDLKHSISLQ  764



>ref|XP_006418321.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
 gb|ESQ36674.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
Length=766

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 157/228 (69%), Gaps = 2/228 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA KDPK+ +I+WAG+PG+ GG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  532  IDVSFAEKDPKIQAIVWAGYPGQEGGTAIADILFGGANPGGKLPMTWYPQDYLTNLPMTE  591

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP    G+PGRTYRFY GP ++ FG+GLSYT+F HSI  A   + +A+   +   S 
Sbjct  592  MSMRPIRSKGFPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADAPKMIPIAVRGRNGTVSG  651

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            K  SV      C   +L +H+++KNVG+  G H++L+FS+PP    AP+KQLV F++V +
Sbjct  652  K--SVRVTHARCNRLSLGVHVDIKNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHV  709

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +  E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  710  AAGEMKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDETHTVSLQ  757



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 156/233 (67%), Gaps = 6/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D++FA  +P++ +ILWAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  531  VDITFAKNNPRIQAILWAGYPGQAGGAAIADILFGTSNPGGKLPMTWYPQGYIKNLPMTN  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGH---PC  458
            M MR     GYPGRTYRFY GP ++ FGYGLSYT F H++  A   VS+ +D GH     
Sbjct  591  MAMRASRSKGYPGRTYRFYNGPVVYPFGYGLSYTHFVHTLASAPKLVSIPVD-GHRHGNS  649

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGF  284
             S   +++      C   ++ + ++VKNVG+  G H++L+FS+PPA   H AP KQLV F
Sbjct  650  SSIANKAIKVTHARCGKLSISLQVDVKNVGSKDGTHTLLVFSAPPAGNGHWAPHKQLVAF  709

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            QK+ +     + V  N+ VCK LSVVD +G R+V +GLH LHIG +KH ++++
Sbjct  710  QKLHIPSKAQQRVNVNIHVCKLLSVVDRSGTRRVPMGLHSLHIGDVKHYVSLQ  762



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 155/228 (68%), Gaps = 1/228 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA KDP++  I+W G+PG+AGG AIADV+FG HNP G+LP TWYPQ + +++ M  
Sbjct  535  VDVTFAEKDPRIGGIVWVGYPGQAGGAAIADVLFGAHNPGGKLPMTWYPQEYLNNLPMTT  594

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF ++I +  + +++ +   H   +T
Sbjct  595  MDMRANLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFINTIAEVPNMLAIPIFGRHASNTT  654

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
              +++      C+  ++ +H++VKNVG+  G  ++L+FS PP     P KQLV FQKV +
Sbjct  655  S-KAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPVGLWVPHKQLVAFQKVYV  713

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
                 + V  N+ VCK+LSVVD AG R++ +G H LHIG  KH+L+++
Sbjct  714  PAGSLQRVTINIHVCKYLSVVDRAGVRRIPIGEHSLHIGDAKHTLSLQ  761



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 154/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D++FA  DP++  ILWAG+PG+AGG AIAD++FG  NP  +LP TWYPQ +  +++M +
Sbjct  527  IDITFAKNDPRIMGILWAGYPGQAGGAAIADILFGTTNPGAKLPMTWYPQGYLKNLAMTN  586

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP   TGYPGRTYRFY GP ++ FGYGLSYT F H++  A   VS+ +D      S+
Sbjct  587  MAMRPSSSTGYPGRTYRFYNGPVVYPFGYGLSYTNFVHTLASAPKVVSVPVDGHRRGNSS  646

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGFQKV  275
               ++      C   ++ + ++VKNVG+  G +++L+FS PP    H AP+KQLV F+KV
Sbjct  647  NKAAIRVTHARCGKLSIRLDIDVKNVGSKDGTNTLLVFSVPPTGNGHWAPQKQLVAFEKV  706

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + V  N+ VCK LSVVD++G R++ +G H +HIG +KH ++++
Sbjct  707  YVPAKAQQRVRINIHVCKLLSVVDKSGTRRIPMGAHSIHIGDVKHFVSLQ  756



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+ SI+WAG+PG+AGG AI+DV+FG  NP G+LP TWYPQ +  ++ M +
Sbjct  526  IDVSFAENDPKIGSIVWAGYPGQAGGAAISDVLFGITNPGGKLPMTWYPQDYITNLPMTN  585

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ LD    G   
Sbjct  586  MAMRSSKSKGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLDGHRHGSGN  645

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             +   +++      C   +L + ++VKN G++ G H++L++S PPA H AP KQLV F+K
Sbjct  646  ATISGKAIRVTHARCNRLSLGMQVDVKNTGSMDGTHTLLVYSRPPARHWAPHKQLVAFEK  705

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V ++    + V  N+ VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  706  VHVAAGTQQRVGINIHVCKSLSVVDGSGIRRIPMGEHSLHIGDVKHSVSLQ  756



>ref|XP_004162442.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 2-like 
[Cucumis sativus]
Length=772

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 161/233 (69%), Gaps = 7/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++++ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+  ++ M +
Sbjct  533  IDVSFADNDPRISAILWVGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQSYLSNLPMTN  592

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MR    + YPGRTYRFY GP +++FG+GLSYT F H+IV+A   VS++L    Q H  
Sbjct  593  MAMR--STSSYPGRTYRFYAGPVVYEFGHGLSYTNFIHTIVKAPTIVSISLSGHRQTHSA  650

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGF  284
             +   +++      C   +L IH++V+N G   G H++L+FS+PPA      PRKQLV F
Sbjct  651  STLSSKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFSTPPANGATWVPRKQLVAF  710

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +K+ L+  E   +  +V VCK+LSVVD+ G R++ LG H +HIG++KH+++++
Sbjct  711  EKLHLASREKRRLQVHVHVCKYLSVVDKLGVRRIPLGDHYIHIGNVKHTVSLQ  763



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   + M D
Sbjct  532  VDVSFAKNDPRIGAILWVGYPGQAGGAAIADVLFGRANPGGKLPMTWYPQDYVARLPMTD  591

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQG-HPCRS  452
            MRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A +  S+ +    +  ++
Sbjct  592  MRMRAG--RGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKAPNQFSVPIATSLYAFKN  649

Query  451  TKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
            T   S  +  A   C  + +L +H++VKN G ++G H++L+F+ PPA + +P KQL+GF+
Sbjct  650  TTISSNAIRVAHTNCNDAMSLGLHVDVKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFK  709

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  710  KVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  761



>ref|XP_004979939.1| PREDICTED: probable beta-D-xylosidase 2-like [Setaria italica]
Length=782

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 151/239 (63%), Gaps = 10/239 (4%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D++FA  DP++ +ILW G+PG+AGG AIADVIFG+HNP G+LP TWYP+ +     M +
Sbjct  538  IDIAFAQNDPRIAAILWVGYPGQAGGQAIADVIFGHHNPGGKLPVTWYPEDYLRKAPMTN  597

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGH-----  464
            M MR +P +GYPGRTYRFYTGP +  FG+GLSYT+F HS+  A + +++ L  GH     
Sbjct  598  MAMRANPASGYPGRTYRFYTGPAILPFGHGLSYTQFTHSLAHAPEKLTVQLTGGHASAAA  657

Query  463  -----PCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  299
                 P  +    +V  A   C    + +H++V+N G   G H+VL++ SPP+   AP +
Sbjct  658  ASSSFPNATRSASAVRVAHARCEGLTVPVHVDVRNAGDRDGAHTVLVYHSPPSAPGAPAR  717

Query  298  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  122
            QLV F+KV +       V   VDVC+ +SV D  G R++ +G H L IG L H++T+ +
Sbjct  718  QLVAFEKVHVPAGGVARVEMGVDVCEGMSVADRDGVRRIPVGEHSLMIGELTHTVTLGV  776



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ +ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQ F + VSM +
Sbjct  536  VDVTFAKNDPRIAAILWAGYPGQAGGAAIADVLFGTFNPGGKLPVTWYPQEFVEKVSMAN  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR D   GYPGR+YRFY GP ++ +G+GLSYTKF HS+  A   +++ LD  +     
Sbjct  596  MAMRADGDRGYPGRSYRFYNGPVVYPYGHGLSYTKFTHSLAHAPAQIAVQLDGRRAPAYN  655

Query  454  STK-CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            ST+   +V  +   C   ++ +H++V+NVG   G H+VL++S+PP    AP+KQLV F+K
Sbjct  656  STEPARAVRVSHARCDGLSIPVHVDVENVGDRDGSHTVLVYSTPPGTRWAPQKQLVAFEK  715

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V ++      V   VDVC  +S  DE G R++ +G H L IG L HS++++
Sbjct  716  VHVAAGGQVRVELGVDVCGQMSFADEYGIRRIPIGEHNLQIGDLIHSISLD  766



>ref|XP_010522822.1| PREDICTED: probable beta-D-xylosidase 2 [Tarenaya hassleriana]
Length=767

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 156/228 (68%), Gaps = 0/228 (0%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+ +I+WAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  531  IDVSFAQNDPKIPAIIWAGYPGQAGGAAIADILFGSANPGGKLPMTWYPQEYLANLPMTE  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP     +PGRTYRFY GP ++ FG+GLSYT+F H+I  A   + +AL       + 
Sbjct  591  MSMRPSQSKRFPGRTYRFYKGPVVYPFGHGLSYTRFTHTIADAPRVLPIALHGRGRNGTV  650

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
              ++V      C+  +L +H++VKNVG+  G H++L+FS+PPA   AP +QLV F++V +
Sbjct  651  SGKAVRVTHAKCSRLSLGVHVDVKNVGSRDGTHTMLVFSAPPAGRWAPHRQLVAFERVHV  710

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +  E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  711  AAGEKKRVPINIHVCKYLSVVDRAGVRRIPIGDHNIHIGDATHTVSLQ  758



>ref|XP_004136155.1| PREDICTED: probable beta-D-xylosidase 2-like [Cucumis sativus]
 gb|KGN45007.1| hypothetical protein Csa_7G407600 [Cucumis sativus]
Length=772

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 161/233 (69%), Gaps = 7/233 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++++ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQS+  ++ M +
Sbjct  533  IDVSFADNDPRISAILWVGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQSYLSNLPMTN  592

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD---QGHPC  458
            M MR    + YPGRTYRFY GP +++FG+GLSYT F H+IV+A   VS++L    Q H  
Sbjct  593  MAMR--STSSYPGRTYRFYAGPVVYEFGHGLSYTNFIHTIVKAPTIVSISLSGHRQTHSA  650

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRKQLVGF  284
             +   +++      C   +L IH++V+N G   G H++L+FS+PPA      PRKQLV F
Sbjct  651  STLSSKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFSTPPANGATWVPRKQLVAF  710

Query  283  QKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +K+ L+  E   +  +V VCK+LSVVD+ G R++ LG H +HIG++KH+++++
Sbjct  711  EKLHLASREKRRLQVHVHVCKYLSVVDKLGVRRIPLGDHYIHIGNVKHTVSLQ  763



>gb|KHN12900.1| Beta-D-xylosidase 1 [Glycine soja]
Length=774

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 150/231 (65%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  +PK+++ILW G+PG+AGG AIADVIFG  NP GRLP TWYPQ +   V M +
Sbjct  541  VDVSFAKNNPKISAILWVGYPGQAGGTAIADVIFGATNPGGRLPMTWYPQGYLAKVPMTN  600

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA--QDSVSLALDQGHPCR  455
            M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F  S+  A  Q SV +   Q     
Sbjct  601  MDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYSRFSQSLALAPKQVSVQILSLQALTNS  660

Query  454  STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C  S   + H++VKN G++ G H++L+FS PP    +  KQLV F K
Sbjct  661  TLSSKAVKVSHANCDDSLETEFHVDVKNEGSMDGTHTLLIFSKPPPGKWSQIKQLVTFHK  720

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
              +     + +  NV  CKHLSVVD+ G R++  G H LHIG LKHS+ V+
Sbjct  721  THVPAGSKQRLKVNVHSCKHLSVVDQFGVRRIPTGEHELHIGDLKHSINVQ  771



>gb|AAP83934.1| auxin-induced beta-glucosidase [Oxybasis rubra]
Length=767

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 150/233 (64%), Gaps = 4/233 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+++ILW G+PG+AGG AIADV+FG  NP G+LPNTWYPQS+   V M D
Sbjct  531  VDVTFAKNDPKISAILWVGYPGQAGGTAIADVLFGTTNPGGKLPNTWYPQSYVAKVPMTD  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            + MR +P  GYPGRTYRFY GP +F FG+GLSYT+F  S+  A   V + L       + 
Sbjct  591  LAMRANPSNGYPGRTYRFYKGPVVFPFGFGLSYTRFTQSLAHAPTKVMVPLANQFTNSNI  650

Query  448  KCESVDAAE---QTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
               + DA +     C +  L +H++VKN G V G H++L+FS+PP    +  KQL+GF++
Sbjct  651  TSFNKDALKVLHTNCDNIPLSLHIDVKNKGKVDGSHTILVFSTPPKGTKSSEKQLIGFKR  710

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVEI  122
            V +     + V  N+ VC HLS  DE G R++ +G H LHIG   KH L++ I
Sbjct  711  VHVFAGSKQRVRMNIHVCNHLSRADEFGVRRIPIGEHTLHIGDDHKHKLSLHI  763



>ref|XP_003533205.2| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=823

 Score =   219 bits (559),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 150/231 (65%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  +PK+++ILW G+PG+AGG AIADVIFG  NP GRLP TWYPQ +   V M +
Sbjct  590  VDVSFAKNNPKISAILWVGYPGQAGGTAIADVIFGATNPGGRLPMTWYPQGYLAKVPMTN  649

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA--QDSVSLALDQGHPCR  455
            M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F  S+  A  Q SV +   Q     
Sbjct  650  MDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYSRFSQSLALAPKQVSVQILSLQALTNS  709

Query  454  STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C  S   + H++VKN G++ G H++L+FS PP    +  KQLV F K
Sbjct  710  TLSSKAVKVSHANCDDSLETEFHVDVKNEGSMDGTHTLLIFSKPPPGKWSQIKQLVTFHK  769

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
              +     + +  NV  CKHLSVVD+ G R++  G H LHIG LKHS+ V+
Sbjct  770  THVPAGSKQRLKVNVHSCKHLSVVDQFGVRRIPTGEHELHIGDLKHSINVQ  820



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   219 bits (557),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 152/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+  I+WAG+PG+AGG AI+DV+FG  NP G+LP TWYPQ +  ++ M +
Sbjct  531  IDVSFAENDPKIGGIVWAGYPGQAGGAAISDVLFGTTNPGGKLPMTWYPQDYVTNLPMTN  590

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLAL---DQGHPC  458
            M MRP    GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ L    Q    
Sbjct  591  MAMRPSKSNGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLVGHRQASRN  650

Query  457  RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
             +   +++      C   +  + ++VKN G++ G H++L++S PPA H AP KQLV F+K
Sbjct  651  ATISGKAIRVTHARCNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHWAPLKQLVAFEK  710

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            V ++    + V  NV VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  711  VHVAAGTQQRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHIGDVKHSVSLQ  761



>ref|XP_006306830.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39728.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=625

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 156/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA KD ++++ILWAG+PG+ GG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  391  IDISFAEKDRRISAILWAGYPGQEGGTAIADILFGSANPGGKLPMTWYPQDYLTNLPMTE  450

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A   +++A+   +   S 
Sbjct  451  MSMRPVHSKQIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADAPKVIAIAVRGRNSTVSG  510

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            K  SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V +
Sbjct  511  K--SVRVTHARCNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHV  568

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  569  AVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  616



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ++   + M D
Sbjct  537  IDVTFAKNDPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTD  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD--QGHPCR  455
            M MR DP  GYPGRTYRFY GP +F FG GLSYT F H++      VS+ L   +     
Sbjct  597  MAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTLVSVPLTSLKATANS  656

Query  454  STKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  278
            +   ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K
Sbjct  657  TMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHK  716

Query  277  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            + ++   ++ V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  717  IHIAAGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 156/235 (66%), Gaps = 11/235 (5%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP+V++I+WAG+PG+AGG AIADV+FG  NP G+LP TWYPQ +   V M +
Sbjct  534  IDVSFAKNDPRVSAIIWAGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQDYVAKVPMTN  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD------QG  467
            M +R  P  GYPGRTYRFY GP +F FG+GLSYT F+HS+  A   +S+ LD      + 
Sbjct  594  MGIR--PSRGYPGRTYRFYKGPVVFPFGHGLSYTSFKHSLALAPTDLSVLLDTNLFATKN  651

Query  466  HPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHN-APRKQLV  290
            +   S+    V  A+    SS    H++V+N G + G H++L+FS+PPA    +P KQL+
Sbjct  652  YSTLSSNAIRVKHAKCDLLSSLF--HIDVENTGNMDGTHTLLVFSTPPAGQKWSPNKQLI  709

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            GF +V +     + V  N+  CKHLSVVDE G R++ +G H LHIG LKHS++++
Sbjct  710  GFHRVHVIAGSKQRVKINIHACKHLSVVDEFGIRRIPMGSHSLHIGDLKHSISLQ  764



>ref|XP_004487789.1| PREDICTED: beta-D-xylosidase 1-like [Cicer arietinum]
Length=776

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 148/234 (63%), Gaps = 6/234 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DPK+++ILW G+PG+AGG AIADVIFG  NP GRLP TWYPQ +   V M +
Sbjct  536  IDVTFAKNDPKISAILWVGYPGQAGGTAIADVIFGRTNPGGRLPMTWYPQDYVTKVPMTN  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSL------ALDQG  467
            M MRP+P TGYPGRTYRFY GP +F FG+GLSYT+F  ++V A   VS+      A  + 
Sbjct  596  MDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYTRFTQTLVLAPKQVSIPFASLQAQAKA  655

Query  466  HPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVG  287
                ++  ++V  +   C    +  H++VKN G++ G +++L+FS  P    +  KQLV 
Sbjct  656  QAFTNSSYKAVKVSHANCDEMEVGFHVDVKNEGSMDGTYTLLIFSKAPHGKWSALKQLVS  715

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            F K  +       V   + VC HLS+VDE G R++ +G H L IG LKHS+ V+
Sbjct  716  FHKTYVPAGSKTRVNAGIHVCNHLSIVDEFGVRRIPIGEHELQIGDLKHSIFVQ  769



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 157/229 (69%), Gaps = 2/229 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DPK+++ILW G+PG+AGG AIADV+FG  NP G+LP TWYPQ +  ++ M +
Sbjct  536  IDVSFAKNDPKISAILWTGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQDYITNLPMTE  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A   VS+ L  GH   +T
Sbjct  596  MGMRSSQSKGYPGRTYRFYKGEVVYPFGHGMSYTNFVHNIASAPTMVSVPL-AGHRGNTT  654

Query  448  -KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  272
               +++      C   +L + ++VKNVG+  G +++L++S+PPA   AP KQLV F+KV 
Sbjct  655  ISGKAIRVTHTKCNRLSLGLQVDVKNVGSKDGTYTLLVYSTPPAGLWAPHKQLVAFEKVH  714

Query  271  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            ++    + V  N+ VCK+LSVVD+ G R++ +GLH LHIG ++HS++++
Sbjct  715  VAAGSQQRVGINIHVCKYLSVVDKYGIRRIPIGLHSLHIGDIEHSVSLQ  763



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 151/232 (65%), Gaps = 6/232 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  DP++ +ILWAG+PG+AGG AIADV++G  NP G+LP TWYPQ +  ++ M D
Sbjct  559  IDVSFAKNDPRIGAILWAGYPGQAGGAAIADVLYGTTNPEGKLPMTWYPQEYVSNLPMTD  618

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD----QGHP  461
            M MR      YPGRTY+FY GP ++ FG+GLSYT F H+I  A   V++ LD     G+ 
Sbjct  619  MAMRSSANRNYPGRTYKFYKGPVVYPFGHGLSYTNFVHTIASAPKVVTVPLDGHRHSGNA  678

Query  460  CRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQ  281
              S K   V+     C   ++ + ++VKN G+  G H++L+FS PPA H AP+KQLV F 
Sbjct  679  TISGKAIKVNHVR--CNKLSVGLQVDVKNTGSKDGTHTMLVFSKPPAGHWAPQKQLVAFA  736

Query  280  KVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            KV +       V  N+ VCK LSVVD +G R++  G+H LHIG +KH L+++
Sbjct  737  KVLVPARSQRRVGINIHVCKFLSVVDRSGVRRIPTGVHNLHIGGIKHPLSLQ  788



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 158/235 (67%), Gaps = 11/235 (5%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DVSFA  D +V++ILWAG+PG+AGG AIADV+FG  NP G+LP TWYPQS+   V M +
Sbjct  536  IDVSFAKYDRRVSAILWAGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQSYVAKVPMTN  595

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD------QG  467
            M MR  P  GYPGRTYRFY GP +F FG+GLSYT F+ S+  A   +S+ ++      + 
Sbjct  596  MGMR--PSRGYPGRTYRFYKGPVVFPFGHGLSYTNFKQSLALAPTDLSVLINTNLFATKN  653

Query  466  HPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP-ALHNAPRKQLV  290
            +   S+K  ++      C S +L +H++V+N+G + G H++LLFS PP A+  +P KQL+
Sbjct  654  YSTLSSK--AIRVKHTNCDSLSLPLHIDVENIGNMDGTHTLLLFSEPPAAVKWSPNKQLI  711

Query  289  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             F +V +     + V  NV  CKHLSVVDE G R++ +G H L+IG LKHS++++
Sbjct  712  SFHRVHVIAGSKQRVKINVHACKHLSVVDEFGIRRIPMGQHSLYIGDLKHSISLQ  766



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 156/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA KD ++++ILWAG+PG+ GG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  534  IDISFAEKDRRISAILWAGYPGQEGGTAIADILFGSANPGGKLPMTWYPQDYLTNLPMTE  593

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A   +++A+   +   S 
Sbjct  594  MSMRPVHSKQIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADAPKVIAIAVRGRNSTVSG  653

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            K  SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V +
Sbjct  654  K--SVRVTHARCNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHV  711

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  712  AVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  759



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   216 bits (551),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 157/228 (69%), Gaps = 2/228 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA KD ++++I+WAG+PG+ GG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  535  IDISFAEKDRRISAIVWAGYPGQEGGTAIADILFGSANPGGKLPMTWYPQDYLTNLPMTE  594

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A   +++A+   +   S 
Sbjct  595  MSMRPVHSKRIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADAPKVIAIAVRGRNSTVSG  654

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            K  SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V +
Sbjct  655  K--SVRVTHARCDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHV  712

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG  +H+++++
Sbjct  713  AVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDERHTVSLQ  760



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 151/230 (66%), Gaps = 4/230 (2%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA  DPK+ +I+W G+PG+AGG A+ADV+FG  NPSG+LP TWYPQ +   V M +
Sbjct  537  IDMSFAKNDPKIGAIIWVGYPGQAGGTAMADVLFGTTNPSGKLPMTWYPQDYVSKVPMTN  596

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQ-GHPCRS  452
            M MR     GYPGRTYRFY GP +F FG GLSYT FRHS+ Q   SVS+ L        S
Sbjct  597  MAMRAG--RGYPGRTYRFYKGPVVFPFGLGLSYTTFRHSLAQVPTSVSVPLTSLSATTNS  654

Query  451  TKCES-VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  275
            T   S V  +   C   +L +H++VKN G   G H++L+FSSPP+   A  KQLVGF KV
Sbjct  655  TMLSSAVRVSHTNCNPLSLALHVDVKNTGARDGTHTLLVFSSPPSGKWAVNKQLVGFHKV  714

Query  274  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
             +     + V F+V VCKHLSVVD+ G +++ +G H L IG L+H ++VE
Sbjct  715  HIVAGSQKRVKFDVHVCKHLSVVDQFGIQRIPIGEHKLQIGDLEHHISVE  764



>dbj|BAC41913.1| putative beta-xylosidase [Arabidopsis thaliana]
Length=732

 Score =   215 bits (548),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 151/242 (62%), Gaps = 16/242 (7%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP++ SI+W G+PGE GG A+A++IFG  NP GRLP TWYP+SF D V+M D
Sbjct  494  VDVTFAKNDPRIGSIIWIGYPGETGGQALAEIIFGDFNPGGRLPTTWYPESFTD-VAMSD  552

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLA----------  479
            M MR +   GYPGRTYRFYTGP ++ FG GLSYTKF + I+ A   +SL+          
Sbjct  553  MHMRANSSRGYPGRTYRFYTGPQVYSFGTGLSYTKFEYKILSAPIRLSLSELLPQQSSHK  612

Query  478  --LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS-PPALHNA  308
              L  G   R  + +  D    +C S   ++ ++V N G + G H V+LFS  PP L   
Sbjct  613  KQLQHGEELRYLQLD--DVIVNSCESLRFNVRVHVSNTGEIDGSHVVMLFSKMPPVLSGV  670

Query  307  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  128
            P KQL+G+ +V +  NE    VF +D CK LSV ++ G R + LG HVL +G L+HSL+V
Sbjct  671  PEKQLIGYDRVHVRSNEMMETVFVIDPCKQLSVANDVGKRVIPLGSHVLFLGDLQHSLSV  730

Query  127  EI  122
            E 
Sbjct  731  EF  732



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 156/228 (68%), Gaps = 2/228 (1%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA KDPK+++I+WAG+PG+ GG AIAD++FG  NP G+LP TWYPQ +  ++ M +
Sbjct  533  IDVTFAEKDPKISAIVWAGYPGQEGGRAIADILFGAANPGGKLPMTWYPQEYLTNLPMTE  592

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MR       PGRTYRFY GP ++ FG+GLSYT+F HSI  A   + +A+   +   S 
Sbjct  593  MSMRAIRSKRIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADAPKVIPIAVRGRNGTVSG  652

Query  448  KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRL  269
            K  SV      C   +L +H+++KNVGT  G H++L+FS+PP+   APRKQLV F +V +
Sbjct  653  K--SVRVTHARCNRLSLGVHVDIKNVGTRDGTHTMLVFSAPPSGEWAPRKQLVAFTRVHV  710

Query  268  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            +  E++ V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  711  AAGENKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  758



>gb|KCW58371.1| hypothetical protein EUGRSUZ_H010551, partial [Eucalyptus grandis]
Length=642

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 151/234 (65%), Gaps = 6/234 (3%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +D+SFA  DP+V +ILWAG+PG+AGG AIAD++FG  NP G+LP TWYPQ +  SV M  
Sbjct  402  VDISFAKNDPRVAAILWAGYPGQAGGTAIADILFGATNPGGKLPMTWYPQDYLASVPMTV  461

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALDQGHPCRST  449
            M MRP     YPGRTYRFY GP ++ FG+GLSYT F H++  A  +V + L    P  +T
Sbjct  462  MDMRPTRSNLYPGRTYRFYGGPVVYPFGHGLSYTHFVHTLASAPSTVVVPLAGRRPANAT  521

Query  448  K--CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA----PRKQLVG  287
                ++V      CA  +L + L+V+N G   G H+VL+FS+PP    A    PR QLVG
Sbjct  522  MGPGKAVRVTHARCARLSLGVQLDVQNAGARDGAHTVLVFSTPPEDGGARWAPPRSQLVG  581

Query  286  FQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  125
            FQ+V ++    E V  N+ VCK LSVVD AG R++ +G H L IG + HS++++
Sbjct  582  FQRVHVAAGARERVGINIHVCKSLSVVDGAGVRRIPMGEHRLQIGDVVHSVSLQ  635



>ref|XP_006352077.1| PREDICTED: beta-D-xylosidase 1-like [Solanum tuberosum]
Length=773

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 151/238 (63%), Gaps = 12/238 (5%)
 Frame = -2

Query  808  MDVSFAVKDPKVTSILWAGFPGEAGGGAIADVIFGYHNPSGRLPNTWYPQSFADSVSMID  629
            +DV+FA  DP+V++I+W G+PG+AGG AIADV+FG  NP G+LP TWYPQ +   VSM +
Sbjct  530  IDVTFAKNDPRVSAIIWVGYPGQAGGAAIADVLFGAANPGGKLPMTWYPQDYVAKVSMAN  589

Query  628  MRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVSLALD-QGHPCRS  452
            M MR +P  GYPGRTYRFY GPT+F FG G SYT F   +V A  +VS+      H   S
Sbjct  590  MDMRANPTKGYPGRTYRFYKGPTVFPFGAGFSYTTFSQHLVSAPITVSVPTTLHSHDLVS  649

Query  451  TKCE--------SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQ  296
                        +V      C S  +D+H++VKN+G + G H+VL+FS+PP       KQ
Sbjct  650  NNTTTSLMKTKATVRTIHTNCESLDIDMHIDVKNIGDMDGTHTVLIFSTPP--DPTETKQ  707

Query  295  LVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  125
            LV F+KV +    ++ V  N++ CKHLSV DE G R++ +G H +H+G  LKHS+T +
Sbjct  708  LVAFEKVHVVAGANQRVKINMNACKHLSVADEYGVRRIYMGEHKIHVGDDLKHSITFQ  765



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410